HBVdb

Dataset for protein HBe of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *  *  :  * **..  :**:     * *  ** :  ..: *  :*  :*::  :* :  *  .. . :       : .
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGeLMTLAT
        xd           s               k         e        t              dv s   
                                                                            n   

        90       100       110       120       130     
....:....|....:....|....:....|....:....|....:....|....:
* * : :   ..  :..*..    :*  :*  :  * .*: .  . .   :    
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
   g    q             v                   dv l         
   a                                       v         
© 1998-2022Legal notice