HBVdb

Dataset for protein HBe of genotype E

[Download (right click)] [Edit] [Sequences] [Repertoires]

670 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KT001364_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110874_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALFRD
AM110877_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALFRD
AF289938_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494791_HBe_P-E      SKLCLGWLWGMDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363575_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTGSSLYGD
HM363576_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTGSSLCGD
MN507840_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRD
LT623847_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVQLLSFLPPDFFPSVRDLLDTASALYRD
HM214736_HBe_P-E      SKLCLGGLWGMDIDPFKKFGATGELLSFLPFDFFPSVRDFLDTPSALYRE
FN594758_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRD
KT001363_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AM110911_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRNLLDTASALYRD
KF849716_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM214749_HBe_P-E      SKLCLGWLWGMDIDPYKKFGATGELLSFLPFDFFPSVRDFLDTPSALYRE
AM110902_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRD
AM110821_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001348_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363595_HBe_P-E      SKMSLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLIDTASALYRD
GQ161814_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRD
AF350215_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFWPSDFFPSVRDLLDTASALYRD
MT427111_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDVLDTASALYRD
KF849725_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF849713_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161796_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY382496_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AM110856_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRD
AB915178_HBe_P-E      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AM110901_HBe_P-E      SKLCLEWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRD
GQ161801_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494703_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY935700_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350159_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350160_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350166_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350183_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110892_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRD
MW455164_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885171_HBe_P-E      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161835_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161797_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161756_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161755_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGD
MZ962190_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGD
MZ962196_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGD
AM110879_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110826_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350168_HBe_P-E      SKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AF350164_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350146_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350123_HBe_P-E      FKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AF350117_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRD
AF350107_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350101_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB274972_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB205190_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB205188_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB201290_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570115_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570119_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570124_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570126_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570131_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570134_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570142_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001350_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001356_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110853_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110868_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110880_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110904_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363567_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363568_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363588_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363589_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363590_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363591_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363592_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885547_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001337_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001338_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001344_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001349_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001361_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001366_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161782_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161792_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110897_HBe_P-E      SKLCLEWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRD
GQ161795_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001334_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001352_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161794_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ962194_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB274973_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRD
AM494714_HBe_P-E      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161826_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLYTASALYRD
JQ000009_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN507841_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF289937_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MW455162_HBe_P-E      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MH580626_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001347_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001342_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF849720_HBe_P-E      SKLCLGWLWGMVIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF849719_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVEFLSFLPSDFFPSVRDLLDTASALYRD
EU726883_HBe_P-E      SKLCLGWLWGMDIDAYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EF395269_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY382484_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AM494695_HBe_P-E      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AM494692_HBe_P-E      SKLCLGWLWGMDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTALALYRD
AM494691_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYRD
AM110872_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALFRD
AM110818_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRNLLDTASALYRD
AF350180_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350154_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVESLSFLPSDFFPSVRDLLDTASALYRD
AF350112_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVEILSFLPSDFFPSVRDLLDTASALYRD
AF350111_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350191_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350202_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY739675_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRD
EU239217_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161758_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRD
GQ161766_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRD
GQ161774_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRD
GQ161778_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161790_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161810_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM214721_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HM363584_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HQ700551_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885475_HBe_P-E      SKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KM606738_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001332_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ962189_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRD
MT427156_HBe_P-E      SKLCLGWLWGMDIDPYKELGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427140_HBe_P-E      SKLCLGWLWGMDIDPYIDFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MF772360_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001378_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLNTASALYRD
KC885357_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KC885518_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KF798275_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HM164134_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU239223_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350139_HBe_P-E      CKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350105_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRD
AB091255_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB091256_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB106564_HBe_C-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB194947_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB201287_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB201288_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB201289_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB205129_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB205189_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB205191_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB205192_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB274969_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB274970_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB274971_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB915175_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350099_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350100_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350102_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350103_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350106_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350108_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350109_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350116_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350118_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350119_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350120_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350121_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350122_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350124_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350125_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350126_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350127_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350128_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350130_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350131_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350132_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350133_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350134_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350135_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350136_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350138_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350140_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350141_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350142_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350143_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350147_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350148_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350149_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350150_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350151_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350152_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350153_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350155_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350156_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350157_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350158_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350161_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350162_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350163_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350165_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350167_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350169_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350170_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350171_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350172_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350173_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350174_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350178_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350179_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350181_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350182_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350185_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350186_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350188_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350189_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350190_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350192_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350193_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350194_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350195_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350196_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350197_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350198_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350199_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350200_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350201_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350203_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350205_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350206_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350210_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350212_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350213_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350214_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350216_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350217_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350218_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350219_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350220_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110808_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110809_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110817_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110819_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110822_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110823_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110824_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110848_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF350115_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRD
AF350137_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRD
GQ161803_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRD
MH580650_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRD
MN507847_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRD
MN507844_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRD
GQ161820_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRD
GQ161836_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRD
MT427196_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFSSVRDLLDTASALYRD
MF772357_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRD
AF350114_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH725141_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
MH725024_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRD
HM363604_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALFRD
AM494832_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYRE
AM110871_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSXRDLLDTASALYRD
AM110875_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427171_HBe_P-E      FKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110900_HBe_P-E      SKXXLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110913_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736895_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLXFLPSDFFPSVRDLLDTASALYRD
KU736896_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
Z68143_HBe_P-E        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
Z68140_HBe_P-E        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW082636_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570130_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH464856_HBe_P-E      SKLCLGWLWGMDIDPYKGFGATVELLSFLPSDFFPSVRDLLDTASALYRD
LT623848_HBe_P-E      SKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736910_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736908_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736907_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736906_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736905_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736903_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736902_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736901_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736900_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736899_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736898_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736897_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736894_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736893_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736892_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736891_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT192626_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001375_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001373_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001371_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001370_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001360_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001359_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001358_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001357_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001355_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001354_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPAVRDLLDTASALYRD
KT001346_HBe_P-E      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KT001345_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001343_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001341_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001340_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001336_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT001333_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP288876_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYRD
KP243569_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243525_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243481_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243478_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243472_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243459_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243446_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243421_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243360_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP243347_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243340_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243325_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243321_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243307_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243240_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP243216_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF849727_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF849723_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF849722_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF849721_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF849717_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF849715_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF849714_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELXSFLPSDFFPSVRDLLDTASALYRD
KF798298_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF798270_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF798259_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF170742_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF170741_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885542_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885512_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885501_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885490_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC885470_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885464_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885443_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885442_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885395_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885386_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885354_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885351_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885233_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC885220_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC885210_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ000008_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HQ700552_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HQ700550_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363593_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRD
HM363583_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363582_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363581_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363580_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363579_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363577_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363574_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363573_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363572_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363570_HBe_P-E      SKLSLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM363569_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ491114_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161833_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161832_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161829_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161828_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161827_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161819_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161817_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161816_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161815_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161808_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161804_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161800_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161798_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161793_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161791_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161789_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161787_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161784_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161781_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161780_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161779_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161777_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161776_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161772_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161771_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161770_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161769_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161765_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161764_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161763_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161761_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161760_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161759_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FN545841_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FJ349239_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FJ349238_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FJ349237_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FJ349226_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU620071_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU239226_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU239221_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU239219_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU239218_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ060830_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ060829_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ060828_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ060827_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ060826_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ060825_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ060824_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ060823_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ060822_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY967466_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY967464_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY739674_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY738147_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY738146_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY738145_HBe_C-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY738144_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY382492_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AM494790_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494789_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494788_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494717_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494715_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494713_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494712_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494711_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494710_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494709_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494708_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494707_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494706_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494705_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494704_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494702_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494701_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494700_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494699_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494698_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494697_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494696_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494694_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494693_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494690_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM494689_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110912_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110899_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110893_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110890_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110888_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110887_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110886_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110885_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110884_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110883_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110882_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110869_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110867_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110866_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110865_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110864_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110863_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110858_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110857_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110852_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
X75657_HBe_P-E        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
OM256457_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ962199_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ962198_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ962197_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRD
MZ962195_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ962193_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ962192_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ962191_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MW679683_HBe_P-E      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MW679682_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MW455165_HBe_P-E      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MW455163_HBe_P-E      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MW455161_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRD
MT731885_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570146_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570145_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570144_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570143_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570141_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570140_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570139_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570138_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570137_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570136_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570135_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570133_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570129_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570128_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570127_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570125_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570123_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570122_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570121_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570118_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570117_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570116_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570114_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570113_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT570112_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427201_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427200_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427199_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427198_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427197_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427195_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427194_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427193_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427192_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427191_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427190_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427189_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427188_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427187_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427186_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427185_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427184_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427183_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427182_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427181_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427180_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427179_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427178_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427177_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427176_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427175_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427174_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427173_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427172_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427170_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427169_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427168_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427167_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427166_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427165_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427164_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427163_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427162_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427161_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427159_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427158_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427157_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427155_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427154_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427153_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427152_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427151_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427150_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427149_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427148_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427147_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427146_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427144_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427143_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427142_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427141_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427139_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427138_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427137_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427136_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427135_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427134_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427132_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427131_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427130_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427129_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427128_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427127_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427126_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYRD
MT427125_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427124_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427123_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSYFFPSVRDLLDTASALYRD
MT427122_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427121_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYRD
MT427120_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427119_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427117_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427116_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427115_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427114_HBe_P-E      SKLCLGWIWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT427110_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT426115_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN967529_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN967528_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN967527_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN967526_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN507848_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN507846_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN507845_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN507843_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN507842_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK720632_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK720631_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK321264_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH918655_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH725192_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH725114_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH725042_HBe_P-E      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH725021_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH725020_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH725010_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH592467_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRQ
MH580652_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580651_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580649_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580647_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580646_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580644_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580641_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580640_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580638_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580637_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580636_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580635_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580634_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580633_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580632_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580631_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580630_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580629_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580628_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580625_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580624_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580623_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580622_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580621_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580620_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580619_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580618_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580617_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580616_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580615_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MH580614_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MF772362_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MF772354_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
LT623850_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
LT623846_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
LT623842_HBe_P-E      SKLCLGWLXDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KX186584_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736911_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVZLLSFLPSDFFPSVRDLLDTASALYRD
KJ810862_HBe_P-E      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AM110854_HBe_P-E      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
LT623849_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRD
MT731837_HBe_P-E      SKLCLGWLXXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FN545823_HBe_P-E      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVXDLLDTASALFRD
KU736909_HBe_P-E      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736912_HBe_P-E      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110914_HBe_P-E      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736904_HBe_P-E      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110850_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM110889_HBe_P-E      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
                       *  *  :  * **..  :**:     * *  ** :  ..: *  :*  :

KT001364_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLENPASRDLVFSYVN
AM110874_HBe_P-E      ALESPEHCTPHHTALRQAILCWGDLMNLATWVGVNLEDQPSRDLVVSYVN
AM110877_HBe_P-E      ALESPEHCTPHHTALRQAILCWGDLMNLATWVGVNLEDQPSRDLVVSYVN
AF289938_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLQDQPSRDLVVNYVN
AM494791_HBe_P-E      ALESPEHWSPHHSAIRQAILCWGELMTLATWVGVKLEDPASRDLVVSYVN
HM363575_HBe_P-E      ALQSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363576_HBe_P-E      ALESPEHCSPHHTELRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507840_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDVMNLATWVGVNLEDPASRDLVVGYVN
LT623847_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDIMNIATWVGANLEDQTSRDLVVSYVN
HM214736_HBe_P-E      ALEFPEHCSPPHTALRQAIFCWGEIMTLATWGGVNLEDPASRDLVVSYVN
FN594758_HBe_P-E      ALESPEHCSXHHTALRQAILCWGDLMNLATWVGANLEDPSSRELVVGYVN
KT001363_HBe_P-E      ALKSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110911_HBe_P-E      ALKSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF849716_HBe_P-E      ALKSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM214749_HBe_P-E      ALEFPEHCSPHHTALRQAIFCWGEIMTLATWGGVNLEDPASRDLVVSYVN
AM110902_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
AM110821_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLAPWVGVNLENPASRDLLFSYVN
KT001348_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLENPASRDLLFSYVN
HM363595_HBe_P-E      AFESPEHCSPYHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161814_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRELLVSYVN
AF350215_HBe_P-E      ALESPEHCSPHHTAIRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427111_HBe_P-E      ALECPEHCSPPHTAVRRAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF849725_HBe_P-E      ALESPEHCSPHHTALRQACLCWGDVMNLATWVGVNLEDPASRDLVVGYVN
KF849713_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161796_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMNLGTWVGANLDDQASRDLVVSYVN
AY382496_HBe_P-E      ALESPEHCSPHHTALRQAILCWRELMTLATWVGVNLEDPASRDLVVSYVN
AM110856_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AB915178_HBe_P-E      AIESPEHCSPHHTALRQAIICWGDLMSLATWVGENLQDQASRDLVVSYVN
AM110901_HBe_P-E      ALESPDHVSSHHTALRQAILCWGDLMSLATWVGVNLEDQASRDLVVSYVN
GQ161801_HBe_P-E      ALESPEHCSPHHTALRQAILCWGEVMTLATWVGVNLEDPASRDLVVSYVN
AM494703_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDVMTLATWVGVNLEDPASRDLVVGYVN
AY935700_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDVMSLATWVGVNLEDPASRDLVVGYVN
AF350159_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AF350160_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350166_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350183_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110892_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MW455164_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVN
KC885171_HBe_P-E      ALESPEHCSPHHTAIRQAFLCWGDLMSLATWVGVNLEDPASRDLVVSYVN
GQ161835_HBe_P-E      ALESLEHCSPHHTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVN
GQ161797_HBe_P-E      ALESPEHCSPHHTAIRQAIICWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161756_HBe_P-E      ALESPEHCSPHHTAFRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
GQ161755_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVN
MZ962190_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVN
MZ962196_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVN
AM110879_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVN
AM110826_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350168_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVN
AF350164_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350146_HBe_P-E      ALESPEHCSPYHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350123_HBe_P-E      ALESPEHCSRHHIALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350117_HBe_P-E      ALESPEHGSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AF350107_HBe_P-E      ALESPEHCSPNHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350101_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AB274972_HBe_P-E      ALESPEHCSPHHTALREAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB205190_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVN
AB205188_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMNLGTWVGGNLEDPASRDLVVSYVN
AB201290_HBe_P-E      ALESPEHCSPHHTALRQVILCWGDLMTLATWVGVNLDDPASRDLVVSYVN
MT570115_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570119_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570124_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570126_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570131_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570134_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570142_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001350_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001356_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110853_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110868_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110880_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110904_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363567_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363568_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363588_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363589_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363590_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363591_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363592_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885547_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001337_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001338_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLENPASRDLVVSYVN
KT001344_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001349_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001361_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001366_HBe_P-E      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161782_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ161792_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AM110897_HBe_P-E      ALESPDHVSSHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
GQ161795_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
KT001334_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
KT001352_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVN
GQ161794_HBe_P-E      ALESHEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ962194_HBe_P-E      ALESHEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB274973_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVN
AM494714_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVN
GQ161826_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVN
JQ000009_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507841_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF289937_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MW455162_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVN
MH580626_HBe_P-E      ALESSEHCSPHHTALRQAILCWGDLMNLGTWVGGNLEDPASRDLVVSYVN
KT001347_HBe_P-E      ALQSPEHCSPHHTALRQAILCWGELMTLATWVGENLEDPASRDLVVSYVN
KT001342_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVN
KF849720_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVN
KF849719_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU726883_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EF395269_HBe_P-E      ALESSEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AY382484_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494695_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494692_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVN
AM494691_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVN
AM110872_HBe_P-E      ALESPEHCSPHHTAIRQAILCWGELMTLATWVGANLEDPASRDLVVSYVN
AM110818_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350180_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPAPRDLVVSYVN
AF350154_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350112_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350111_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AF350191_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AF350202_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AY739675_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
EU239217_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ161758_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ161766_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ161774_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ161778_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ161790_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ161810_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
HM214721_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
HM363584_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
HQ700551_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
KC885475_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
KM606738_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
KT001332_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MZ962189_HBe_P-E      ALESPEHCSPHHTALRQAILFSGELMTLATWVGVNLEDPASRDLVVSYVN
MT427156_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427140_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF772360_HBe_P-E      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001378_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
KC885357_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KC885518_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF798275_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HM164134_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU239223_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDIMTIATWVGVNLEDPASRDLVVSYVN
AF350139_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350105_HBe_P-E      ALESPEHRSPHHTALRQAILCWGELMTLATWVGVNLEDPASKDLVVSYAN
AB091255_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB091256_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB106564_HBe_C-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB194947_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB201287_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB201288_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB201289_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB205129_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB205189_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB205191_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB205192_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB274969_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB274970_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB274971_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB915175_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350099_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350100_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350102_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350103_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350106_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350108_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350109_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350116_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350118_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350119_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350120_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350121_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350122_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350124_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350125_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350126_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350127_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350128_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350130_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350131_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350132_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350133_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350134_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350135_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350136_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350138_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350140_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350141_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350142_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350143_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350147_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350148_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350149_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350150_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350151_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350152_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350153_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350155_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350156_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350157_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350158_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350161_HBe_P-E      ALESPEHCSPHHTALKQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350162_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350163_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350165_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350167_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350169_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350170_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350171_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350172_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350173_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350174_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350178_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350179_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350181_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350182_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AF350185_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350186_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350188_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350189_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350190_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350192_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350193_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350194_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350195_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350196_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350197_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350198_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350199_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350200_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350201_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350203_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AF350205_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350206_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350210_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350212_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350213_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350214_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350216_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350217_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350218_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350219_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTIATWVGVNLEDPASRDLVVSYVN
AF350220_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTIATWVGVNLEDPASRDLVVSYVN
AM110808_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110809_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110817_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110819_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110822_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPPSRDLVVSYVN
AM110823_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110824_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELITLATWVGVNLENPASRDLVVSYVN
AM110848_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350115_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF350137_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161803_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580650_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507847_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507844_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161820_HBe_P-E      ALESPEHCSXHHTALRQAILCWGEXMTLATWVGVNLEDPASRDLVVSYVN
GQ161836_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427196_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF772357_HBe_P-E      ALESPEHFSPHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
AF350114_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH725141_HBe_P-E      ALESPDHCSPHHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVSYVN
MH725024_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363604_HBe_P-E      ALESPDHCSPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVN
AM494832_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110871_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110875_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427171_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110900_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110913_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736895_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736896_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
Z68143_HBe_P-E        ALESPEHCSPHHTALRQAILCWGESMTLATWVGVNLEIPASRDLVVSYVN
Z68140_HBe_P-E        ALESPEHCSPHHTALRQAILCWGESMTLATWVGVNLEIPASRDLVVSYVN
MW082636_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMNLGTWVGGNLEDPASRDLVVSYVN
MT570130_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH464856_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
LT623848_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
KU736910_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736908_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736907_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736906_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736905_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736903_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736902_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736901_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736900_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736899_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736898_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736897_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736894_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736893_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736892_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDVMNLATWVGVNLEDPVSRDLVVSYVN
KU736891_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT192626_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001375_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001373_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001371_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001370_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001360_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001359_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001358_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001357_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001355_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001354_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001346_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
KT001345_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001343_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001341_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001340_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001336_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT001333_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP288876_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243569_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243525_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243481_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243478_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243472_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243459_HBe_P-E      ALESPEHCSSHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243446_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243421_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243360_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP243347_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243340_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243325_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243321_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243307_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243240_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP243216_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF849727_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF849723_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF849722_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF849721_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF849717_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF849715_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF849714_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF798298_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF798270_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF798259_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF170742_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF170741_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885542_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885512_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885501_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885490_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC885470_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885464_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885443_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885442_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885395_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885386_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885354_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885351_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885233_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC885220_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC885210_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ000008_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HQ700552_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HQ700550_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363593_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363583_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
HM363582_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363581_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363580_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363579_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363577_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363574_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363573_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363572_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363570_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HM363569_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ491114_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161833_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ161832_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161829_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161828_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161827_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161819_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161817_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161816_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161815_HBe_P-E      ALESPEHCSPHHTALRQAILCWGXLMTLATWVGVNLEDPASRDLVVSYVN
GQ161808_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ161804_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161800_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161798_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161793_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161791_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161789_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161787_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161784_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161781_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161780_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161779_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161777_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161776_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161772_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161771_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161770_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161769_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161765_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161764_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161763_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161761_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161760_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ161759_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FN545841_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FJ349239_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FJ349238_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FJ349237_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FJ349226_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVN
EU620071_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU239226_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU239221_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU239219_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU239218_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ060830_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ060829_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ060828_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ060827_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ060826_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ060825_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ060824_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ060823_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ060822_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY967466_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AY967464_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AY739674_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY738147_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY738146_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY738145_HBe_C-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY738144_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY382492_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNWEDPASRDLVVSYVT
AM494790_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494789_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494788_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494717_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494715_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494713_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494712_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494711_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AM494710_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494709_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494708_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494707_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494706_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494705_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494704_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494702_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494701_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494700_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494699_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494698_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494697_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494696_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494694_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494693_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494690_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494689_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110912_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110899_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110893_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110890_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110888_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110887_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110886_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110885_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110884_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110883_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110882_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110869_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110867_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110866_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110865_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110864_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110863_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110858_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110857_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110852_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
X75657_HBe_P-E        ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
OM256457_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MZ962199_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ962198_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ962197_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MZ962195_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MZ962193_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ962192_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ962191_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MW679683_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MW679682_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MW455165_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGANLEDPASRDLVVSYVN
MW455163_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MW455161_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT731885_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570146_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570145_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570144_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570143_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570141_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570140_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570139_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570138_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570137_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570136_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570135_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570133_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570129_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570128_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570127_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570125_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570123_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570122_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570121_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570118_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570117_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570116_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570114_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570113_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT570112_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427201_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427200_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427199_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427198_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427197_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427195_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427194_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427193_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427192_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427191_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427190_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427189_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427188_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427187_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427186_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427185_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427184_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427183_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427182_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427181_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427180_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427179_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427178_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427177_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427176_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427175_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427174_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427173_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427172_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427170_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427169_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427168_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427167_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427166_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427165_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427164_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427163_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427162_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427161_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427159_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427158_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427157_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427155_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427154_HBe_P-E      ALESPEHCSLHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427153_HBe_P-E      ALESPEHCSLHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427152_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427151_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427150_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427149_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427148_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427147_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427146_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427144_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427143_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427142_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427141_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427139_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427138_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427137_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427136_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427135_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427134_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427132_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427131_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427130_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427129_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427128_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427127_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427126_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427125_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427124_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427123_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427122_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427121_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427120_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427119_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427117_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427116_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427115_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427114_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT427110_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT426115_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN967529_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN967528_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN967527_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN967526_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
MN507848_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507846_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507845_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507843_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507842_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK720632_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK720631_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK321264_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH918655_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH725192_HBe_P-E      ALESPEHCSSHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
MH725114_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH725042_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH725021_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH725020_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH725010_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH592467_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580652_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580651_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580649_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580647_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580646_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580644_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580641_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580640_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580638_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580637_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580636_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580635_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580634_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580633_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MH580632_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580631_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580630_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580629_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580628_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580625_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580624_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580623_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580622_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580621_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580620_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580619_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580618_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580617_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580616_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580615_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH580614_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF772362_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF772354_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
LT623850_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
LT623846_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
LT623842_HBe_P-E      ALESPEHXSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
KX186584_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736911_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
KJ810862_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110854_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDVMNLATWVGXNLEDPASRDXVVSYVN
LT623849_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MT731837_HBe_P-E      ALESPEHCSPHHTALRQAILCWGXLMTLATWVGVNLEDPASRDLVVSYVN
FN545823_HBe_P-E      ALESPEHCSPHHTALRQAILCWGXLXXLATWVGVNLEDPASRDXVVSYVN
KU736909_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDLMXLATWVGVNLEDPASRDLVVSYVN
KU736912_HBe_P-E      ALESPEHCSPHHTALRQAILCWGDIMTIXTWVGVNLEDPASRDLVVSYVN
AM110914_HBe_P-E      ALESPEHCSPHHTALRQAILCWGXLMTLATWVGVNLEDPASRDLVVSYVN
KU736904_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM110850_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRXLVVSYVN
AM110889_HBe_P-E      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
                      *::  :* :  *  .. . :       : .* * : :   ..  :..*..

KT001364_HBe_P-E      TNVGLKFRQLWWFHISCLTFGKKTVIKYLVSFEVW
AM110874_HBe_P-E      INIGLKFRQLLWFHISCLTFGREVVLEYLVSFGVW
AM110877_HBe_P-E      INIGLKFRQLLWFHISCLTFGREVVLEYLVSFGVW
AF289938_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVAFG--
AM494791_HBe_P-E      TNLGLKFQQLLWFHISCLTFGRETVIEYLVSFGVW
HM363575_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363576_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MN507840_HBe_P-E      TNMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVW
LT623847_HBe_P-E      TNMGIKFRQLLWFHISCLTFGREVVIEYLVSFGVW
HM214736_HBe_P-E      TNMGLKFRQLLGFPISCLTFGKETVIEYLVSFGGG
FN594758_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
KT001363_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRKTVIEYLVSFGVW
AM110911_HBe_P-E      TNMGLKXRQLLWFHISCLTFGRETVIEYLVSFGVW
KF849716_HBe_P-E      TNMGLKFXQLLWFHISCLTFGRETVIEYLVSFGVW
HM214749_HBe_P-E      TNMGLKFRQLLWFHISCFTFGRETVIEYLVSFGVW
AM110902_HBe_P-E      TNMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVW
AM110821_HBe_P-E      TNMGLKFRQLLWFHISCLTFGKKTVIKYLVSFGVW
KT001348_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFEVW
HM363595_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161814_HBe_P-E      TNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350215_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MT427111_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF849725_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
KF849713_HBe_P-E      TNMGLKFRELLWFHISCLTLGRETVXDYLVSFGVW
GQ161796_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY382496_HBe_P-E      TNMGLKFRQLLWFHISWLTFGREPVIEYLVSFGVW
AM110856_HBe_P-E      TNMGLKFRQLLWFHVSCLTFGRDTVLEYLVSFGVW
AB915178_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
AM110901_HBe_P-E      TNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVW
GQ161801_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494703_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY935700_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350159_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
AF350160_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
AF350166_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
AF350183_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
AM110892_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRDTVIEXLVSFG--
MW455164_HBe_P-E      TNMGLKFRQLLWFHTSCITFGRETVVEYLVSFGVW
KC885171_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVW
GQ161835_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161797_HBe_P-E      TNMGLKFRQLLWFHTSCITFGRETVLEYLVSFGVW
GQ161756_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161755_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MZ962190_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MZ962196_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110879_HBe_P-E      NNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVW
AM110826_HBe_P-E      TNMGLKFRQLLWLHLSCLTFGRETVIEYLVSFGVW
AF350168_HBe_P-E      TNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVW
AF350164_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYSVSFGVW
AF350146_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350123_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350117_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
AF350107_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350101_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETAIEYLVSFGVW
AB274972_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB205190_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB205188_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVW
AB201290_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MT570115_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
MT570119_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
MT570124_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
MT570126_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
MT570131_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
MT570134_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
MT570142_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
KT001350_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIKYLVSFGVW
KT001356_HBe_P-E      TNMGLKFRQLLWFHISCLTFGKETVLKYLVSFGVW
AM110853_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110868_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110880_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110904_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363567_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVW
HM363568_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363588_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363589_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363590_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363591_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
HM363592_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885547_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001337_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001338_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001344_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001349_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001361_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001366_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161782_HBe_P-E      TNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161792_HBe_P-E      TNIALKFRQLLWFHISCLTFGREPVIEYLVSFGVW
AM110897_HBe_P-E      TNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVW
GQ161795_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001334_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001352_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161794_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MZ962194_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB274973_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494714_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161826_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
JQ000009_HBe_P-E      TNMGLKFRQLLWLHISCLTFGRETVIEYLVSFGVW
MN507841_HBe_P-E      TNMGLKFRQLLWLHISCLTFGRETVIEYLVSFGVW
AF289937_HBe_P-E      TNMGLKFRQLLWFHISWLTFGRETVIEYLVSFG--
MW455162_HBe_P-E      NNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MH580626_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001347_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001342_HBe_P-E      TNMGLKFRQLLWFHISCLTFERETVIEYLVSFGVW
KF849720_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF849719_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
EU726883_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
EF395269_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY382484_HBe_P-E      TNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494695_HBe_P-E      TNMGLKFRQLLWFHTSCITFGRETVVEYLVSFGVW
AM494692_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494691_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110872_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
AM110818_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350180_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350154_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350112_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350111_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350191_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350202_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY739675_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
EU239217_HBe_P-E      TNVGLKFRQLLGFHISCLTFGRETVIEYLVSFGVW
GQ161758_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161766_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161774_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161778_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161790_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161810_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM214721_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363584_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HQ700551_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885475_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KM606738_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001332_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MZ962189_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MT427156_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MT427140_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MF772360_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
KT001378_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRKTVIEYLVSFGVW
KC885357_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885518_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF798275_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
HM164134_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVW
EU239223_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350139_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350105_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB091255_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB091256_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB106564_HBe_C-E      TNMGLKFRQLLWFHISCLTLGRETVIEYLVSFGVW
AB194947_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB201287_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB201288_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
AB201289_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB205129_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB205189_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB205191_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB205192_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB274969_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB274970_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB274971_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AB915175_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350099_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350100_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350102_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350103_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350106_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350108_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350109_HBe_P-E      TNMGLKFRQLLWFHISCLTFGREPVIEYLVSFGVW
AF350116_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350118_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350119_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350120_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350121_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350122_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350124_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350125_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350126_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350127_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350128_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350130_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350131_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350132_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350133_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350134_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350135_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350136_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350138_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350140_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350141_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350142_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350143_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350147_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350148_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350149_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350150_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350151_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350152_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350153_HBe_P-E      TNMGLKFRQLLWFHISCLTIGRETVIEYLVSFGVW
AF350155_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350156_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350157_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350158_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350161_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350162_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350163_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350165_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350167_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350169_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350170_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350171_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350172_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350173_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350174_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350178_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350179_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350181_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350182_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350185_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350186_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350188_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350189_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350190_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350192_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350193_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350194_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350195_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350196_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350197_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350198_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350199_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350200_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350201_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350203_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350205_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350206_HBe_P-E      TNMGLKFRQLLWFHISCVTFGRETVIEYLVSFGVW
AF350210_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350212_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350213_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350214_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350216_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350217_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350218_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350219_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350220_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110808_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110809_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110817_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110819_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110822_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110823_HBe_P-E      TNMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVW
AM110824_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110848_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350115_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350137_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161803_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MH580650_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MN507847_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MN507844_HBe_P-E      NNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161820_HBe_P-E      XNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161836_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MT427196_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MF772357_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AF350114_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVC
MH725141_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MH725024_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363604_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494832_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
AM110871_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110875_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MT427171_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110900_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM110913_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736895_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736896_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
Z68143_HBe_P-E        TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
Z68140_HBe_P-E        TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MW082636_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MT570130_HBe_P-E      TNMGIKFRQLLWFHISCLTFGRETVIEYLVSFGVW
MH464856_HBe_P-E      TNMGLKFRQLLWFHISSLTFGRETVIEYLVSFGVW
LT623848_HBe_P-E      TNVGLKFRQLLWFHISCLTFGRETVXEYLVSFGVW
KU736910_HBe_P-E      TNMGLKFRQLLWFHISXLTFGRETVIEYLVSFGVW
KU736908_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736907_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736906_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736905_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736903_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736902_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736901_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736900_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736899_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736898_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736897_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736894_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736893_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736892_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KU736891_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT192626_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001375_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001373_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001371_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001370_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001360_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001359_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001358_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001357_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001355_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001354_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001346_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVW
KT001345_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001343_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001341_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001340_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001336_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KT001333_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP288876_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243569_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243525_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243481_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243478_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243472_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243459_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
KP243446_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243421_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243360_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243347_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243340_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243325_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243321_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243307_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243240_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KP243216_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF849727_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF849723_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF849722_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF849721_HBe_P-E      TNMGLKFRQLLWFHISCLTLGRETVIEYLVSFGVW
KF849717_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF849715_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF849714_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF798298_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF798270_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF798259_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF170742_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KF170741_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885542_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885512_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885501_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885490_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885470_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885464_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885443_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885442_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885395_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885386_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885354_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885351_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885233_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885220_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
KC885210_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
JQ000008_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HQ700552_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HQ700550_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363593_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363583_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363582_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363581_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363580_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363579_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363577_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363574_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363573_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363572_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363570_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
HM363569_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ491114_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161833_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161832_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161829_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161828_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161827_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161819_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161817_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161816_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161815_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSCGVW
GQ161808_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161804_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161800_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161798_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161793_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161791_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161789_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161787_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161784_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161781_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161780_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGGW
GQ161779_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161777_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161776_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161772_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161771_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161770_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161769_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161765_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161764_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161763_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161761_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
GQ161760_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVW
GQ161759_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
FN545841_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
FJ349239_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
FJ349238_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
FJ349237_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
FJ349226_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
EU620071_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
EU239226_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
EU239221_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
EU239219_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
EU239218_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
DQ060830_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
DQ060829_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
DQ060828_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
DQ060827_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
DQ060826_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
DQ060825_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
DQ060824_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
DQ060823_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
DQ060822_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY967466_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY967464_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY739674_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY738147_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY738146_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY738145_HBe_C-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY738144_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AY382492_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494790_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494789_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494788_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494717_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494715_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494713_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494712_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494711_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494710_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494709_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494708_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494707_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494706_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494705_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494704_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494702_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494701_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494700_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494699_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494698_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494697_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494696_HBe_P-E      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
AM494694_HBe_P-E      TNMG