HBVdb

Dataset for protein HBe of genotype E

[Download (right click)] [Alignment] [Repertoires]

670 sequence(s)

>gnl|hbvpro|AB091255_HBe_P-E Product feature CHAIN AB091255_HBe_P-E of FT:mat_peptide AB091255_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-129). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB091256_HBe_P-E Product feature CHAIN AB091256_HBe_P-E of FT:mat_peptide AB091256_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ABI-212). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB106564_HBe_C-E Product feature CHAIN AB106564_HBe_C-E of FT:mat_peptide AB106564_HBe_C-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-GA325). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTLGRETVIEYLVSFGVW
>gnl|hbvpro|AB194947_HBe_P-E Product feature CHAIN AB194947_HBe_P-E of FT:mat_peptide AB194947_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CMR954). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB201287_HBe_P-E Product feature CHAIN AB201287_HBe_P-E of FT:mat_peptide AB201287_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB201288_HBe_P-E Product feature CHAIN AB201288_HBe_P-E of FT:mat_peptide AB201288_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin89). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB201289_HBe_P-E Product feature CHAIN AB201289_HBe_P-E of FT:mat_peptide AB201289_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin269). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB201290_HBe_P-E Product feature CHAIN AB201290_HBe_P-E of FT:mat_peptide AB201290_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Benin293). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQVILCWGDLMTLAT
WVGVNLDDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB205129_HBe_P-E Product feature CHAIN AB205129_HBe_P-E of FT:mat_peptide AB205129_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB205188_HBe_P-E Product feature CHAIN AB205188_HBe_P-E of FT:mat_peptide AB205188_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-GA283). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLGT
WVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVW
>gnl|hbvpro|AB205189_HBe_P-E Product feature CHAIN AB205189_HBe_P-E of FT:mat_peptide AB205189_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G138). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB205190_HBe_P-E Product feature CHAIN AB205190_HBe_P-E of FT:mat_peptide AB205190_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G123). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB205191_HBe_P-E Product feature CHAIN AB205191_HBe_P-E of FT:mat_peptide AB205191_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G166). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB205192_HBe_P-E Product feature CHAIN AB205192_HBe_P-E of FT:mat_peptide AB205192_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-G758). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB274969_HBe_P-E Product feature CHAIN AB274969_HBe_P-E of FT:mat_peptide AB274969_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB274970_HBe_P-E Product feature CHAIN AB274970_HBe_P-E of FT:mat_peptide AB274970_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB274971_HBe_P-E Product feature CHAIN AB274971_HBe_P-E of FT:mat_peptide AB274971_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB274972_HBe_P-E Product feature CHAIN AB274972_HBe_P-E of FT:mat_peptide AB274972_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALREAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB274973_HBe_P-E Product feature CHAIN AB274973_HBe_P-E of FT:mat_peptide AB274973_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB915175_HBe_P-E Product feature CHAIN AB915175_HBe_P-E of FT:mat_peptide AB915175_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB915178_HBe_P-E Product feature CHAIN AB915178_HBe_P-E of FT:mat_peptide AB915178_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDAIESPEHCSPHHTALRQAIICWGDLMSLAT
WVGENLQDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF289937_HBe_P-E Product feature CHAIN AF289937_HBe_P-E of FT:mat_peptide AF289937_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BBsHCC58). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=133 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISWLTFGRETVIEYLVSFG
>gnl|hbvpro|AF289938_HBe_P-E Product feature CHAIN AF289938_HBe_P-E of FT:mat_peptide AF289938_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BBsHCC64). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=133 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLQDQPSRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVAFG
>gnl|hbvpro|AF350099_HBe_P-E Product feature CHAIN AF350099_HBe_P-E of FT:mat_peptide AF350099_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4102). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350100_HBe_P-E Product feature CHAIN AF350100_HBe_P-E of FT:mat_peptide AF350100_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350101_HBe_P-E Product feature CHAIN AF350101_HBe_P-E of FT:mat_peptide AF350101_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4527). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETAIEYLVSFGVW
>gnl|hbvpro|AF350102_HBe_P-E Product feature CHAIN AF350102_HBe_P-E of FT:mat_peptide AF350102_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4537). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350103_HBe_P-E Product feature CHAIN AF350103_HBe_P-E of FT:mat_peptide AF350103_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4531). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350105_HBe_P-E Product feature CHAIN AF350105_HBe_P-E of FT:mat_peptide AF350105_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4550). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHRSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASKDLVVSYANTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350106_HBe_P-E Product feature CHAIN AF350106_HBe_P-E of FT:mat_peptide AF350106_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4607). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350107_HBe_P-E Product feature CHAIN AF350107_HBe_P-E of FT:mat_peptide AF350107_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4625). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPNHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350108_HBe_P-E Product feature CHAIN AF350108_HBe_P-E of FT:mat_peptide AF350108_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4628). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350109_HBe_P-E Product feature CHAIN AF350109_HBe_P-E of FT:mat_peptide AF350109_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4640). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREPVIEYLVSFGVW
>gnl|hbvpro|AF350111_HBe_P-E Product feature CHAIN AF350111_HBe_P-E of FT:mat_peptide AF350111_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4539). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350112_HBe_P-E Product feature CHAIN AF350112_HBe_P-E of FT:mat_peptide AF350112_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4618). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVEILSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350114_HBe_P-E Product feature CHAIN AF350114_HBe_P-E of FT:mat_peptide AF350114_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam4697). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVC
>gnl|hbvpro|AF350115_HBe_P-E Product feature CHAIN AF350115_HBe_P-E of FT:mat_peptide AF350115_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1001F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350116_HBe_P-E Product feature CHAIN AF350116_HBe_P-E of FT:mat_peptide AF350116_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1002F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350117_HBe_P-E Product feature CHAIN AF350117_HBe_P-E of FT:mat_peptide AF350117_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1003F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHGSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
>gnl|hbvpro|AF350118_HBe_P-E Product feature CHAIN AF350118_HBe_P-E of FT:mat_peptide AF350118_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1011F5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350119_HBe_P-E Product feature CHAIN AF350119_HBe_P-E of FT:mat_peptide AF350119_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1013F5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350120_HBe_P-E Product feature CHAIN AF350120_HBe_P-E of FT:mat_peptide AF350120_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1073F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350121_HBe_P-E Product feature CHAIN AF350121_HBe_P-E of FT:mat_peptide AF350121_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1074F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350122_HBe_P-E Product feature CHAIN AF350122_HBe_P-E of FT:mat_peptide AF350122_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1076F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350123_HBe_P-E Product feature CHAIN AF350123_HBe_P-E of FT:mat_peptide AF350123_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1081F20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
FKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSRHHIALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350124_HBe_P-E Product feature CHAIN AF350124_HBe_P-E of FT:mat_peptide AF350124_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1099F18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350125_HBe_P-E Product feature CHAIN AF350125_HBe_P-E of FT:mat_peptide AF350125_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1100F20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350126_HBe_P-E Product feature CHAIN AF350126_HBe_P-E of FT:mat_peptide AF350126_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1115). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350127_HBe_P-E Product feature CHAIN AF350127_HBe_P-E of FT:mat_peptide AF350127_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1119F29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350128_HBe_P-E Product feature CHAIN AF350128_HBe_P-E of FT:mat_peptide AF350128_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1121F29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350130_HBe_P-E Product feature CHAIN AF350130_HBe_P-E of FT:mat_peptide AF350130_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1127F28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350131_HBe_P-E Product feature CHAIN AF350131_HBe_P-E of FT:mat_peptide AF350131_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1129). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350132_HBe_P-E Product feature CHAIN AF350132_HBe_P-E of FT:mat_peptide AF350132_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1131F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350133_HBe_P-E Product feature CHAIN AF350133_HBe_P-E of FT:mat_peptide AF350133_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1132F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350134_HBe_P-E Product feature CHAIN AF350134_HBe_P-E of FT:mat_peptide AF350134_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1135F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350135_HBe_P-E Product feature CHAIN AF350135_HBe_P-E of FT:mat_peptide AF350135_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1136F31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350136_HBe_P-E Product feature CHAIN AF350136_HBe_P-E of FT:mat_peptide AF350136_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1139). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350137_HBe_P-E Product feature CHAIN AF350137_HBe_P-E of FT:mat_peptide AF350137_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1142F33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350138_HBe_P-E Product feature CHAIN AF350138_HBe_P-E of FT:mat_peptide AF350138_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1143F33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350139_HBe_P-E Product feature CHAIN AF350139_HBe_P-E of FT:mat_peptide AF350139_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1145F33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
CKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350140_HBe_P-E Product feature CHAIN AF350140_HBe_P-E of FT:mat_peptide AF350140_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1149F34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350141_HBe_P-E Product feature CHAIN AF350141_HBe_P-E of FT:mat_peptide AF350141_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1152F34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350142_HBe_P-E Product feature CHAIN AF350142_HBe_P-E of FT:mat_peptide AF350142_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1157F35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350143_HBe_P-E Product feature CHAIN AF350143_HBe_P-E of FT:mat_peptide AF350143_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1158F35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350146_HBe_P-E Product feature CHAIN AF350146_HBe_P-E of FT:mat_peptide AF350146_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1167). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPYHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350147_HBe_P-E Product feature CHAIN AF350147_HBe_P-E of FT:mat_peptide AF350147_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1175F40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350148_HBe_P-E Product feature CHAIN AF350148_HBe_P-E of FT:mat_peptide AF350148_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1179F42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350149_HBe_P-E Product feature CHAIN AF350149_HBe_P-E of FT:mat_peptide AF350149_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1181F41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350150_HBe_P-E Product feature CHAIN AF350150_HBe_P-E of FT:mat_peptide AF350150_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1182F41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350151_HBe_P-E Product feature CHAIN AF350151_HBe_P-E of FT:mat_peptide AF350151_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1184F41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350152_HBe_P-E Product feature CHAIN AF350152_HBe_P-E of FT:mat_peptide AF350152_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1187F42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350153_HBe_P-E Product feature CHAIN AF350153_HBe_P-E of FT:mat_peptide AF350153_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1194). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTIGRETVIEYLVSFGVW
>gnl|hbvpro|AF350154_HBe_P-E Product feature CHAIN AF350154_HBe_P-E of FT:mat_peptide AF350154_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1208). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVESLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350155_HBe_P-E Product feature CHAIN AF350155_HBe_P-E of FT:mat_peptide AF350155_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1211). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350156_HBe_P-E Product feature CHAIN AF350156_HBe_P-E of FT:mat_peptide AF350156_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1246F53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350157_HBe_P-E Product feature CHAIN AF350157_HBe_P-E of FT:mat_peptide AF350157_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1247F53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350158_HBe_P-E Product feature CHAIN AF350158_HBe_P-E of FT:mat_peptide AF350158_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1249F53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350159_HBe_P-E Product feature CHAIN AF350159_HBe_P-E of FT:mat_peptide AF350159_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1285). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
>gnl|hbvpro|AF350160_HBe_P-E Product feature CHAIN AF350160_HBe_P-E of FT:mat_peptide AF350160_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1288F61). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
>gnl|hbvpro|AF350161_HBe_P-E Product feature CHAIN AF350161_HBe_P-E of FT:mat_peptide AF350161_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1307). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALKQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350162_HBe_P-E Product feature CHAIN AF350162_HBe_P-E of FT:mat_peptide AF350162_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1325F81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350163_HBe_P-E Product feature CHAIN AF350163_HBe_P-E of FT:mat_peptide AF350163_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1326F81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350164_HBe_P-E Product feature CHAIN AF350164_HBe_P-E of FT:mat_peptide AF350164_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1327F81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYSVSFGVW
>gnl|hbvpro|AF350165_HBe_P-E Product feature CHAIN AF350165_HBe_P-E of FT:mat_peptide AF350165_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1328F82). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350166_HBe_P-E Product feature CHAIN AF350166_HBe_P-E of FT:mat_peptide AF350166_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1331). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
>gnl|hbvpro|AF350167_HBe_P-E Product feature CHAIN AF350167_HBe_P-E of FT:mat_peptide AF350167_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1348F82). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350168_HBe_P-E Product feature CHAIN AF350168_HBe_P-E of FT:mat_peptide AF350168_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1349F90). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDSYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPSSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVW
>gnl|hbvpro|AF350169_HBe_P-E Product feature CHAIN AF350169_HBe_P-E of FT:mat_peptide AF350169_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1352F90). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350170_HBe_P-E Product feature CHAIN AF350170_HBe_P-E of FT:mat_peptide AF350170_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1353F89). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350171_HBe_P-E Product feature CHAIN AF350171_HBe_P-E of FT:mat_peptide AF350171_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1374). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350172_HBe_P-E Product feature CHAIN AF350172_HBe_P-E of FT:mat_peptide AF350172_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1376). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350173_HBe_P-E Product feature CHAIN AF350173_HBe_P-E of FT:mat_peptide AF350173_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1442). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350174_HBe_P-E Product feature CHAIN AF350174_HBe_P-E of FT:mat_peptide AF350174_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1444). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350178_HBe_P-E Product feature CHAIN AF350178_HBe_P-E of FT:mat_peptide AF350178_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1482F89). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350179_HBe_P-E Product feature CHAIN AF350179_HBe_P-E of FT:mat_peptide AF350179_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1520). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350180_HBe_P-E Product feature CHAIN AF350180_HBe_P-E of FT:mat_peptide AF350180_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1522F137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPAPRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350181_HBe_P-E Product feature CHAIN AF350181_HBe_P-E of FT:mat_peptide AF350181_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1524F137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350182_HBe_P-E Product feature CHAIN AF350182_HBe_P-E of FT:mat_peptide AF350182_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1525F137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350183_HBe_P-E Product feature CHAIN AF350183_HBe_P-E of FT:mat_peptide AF350183_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1535). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
>gnl|hbvpro|AF350185_HBe_P-E Product feature CHAIN AF350185_HBe_P-E of FT:mat_peptide AF350185_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1557F61). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350186_HBe_P-E Product feature CHAIN AF350186_HBe_P-E of FT:mat_peptide AF350186_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1560). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350188_HBe_P-E Product feature CHAIN AF350188_HBe_P-E of FT:mat_peptide AF350188_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1590). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350189_HBe_P-E Product feature CHAIN AF350189_HBe_P-E of FT:mat_peptide AF350189_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1594). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350190_HBe_P-E Product feature CHAIN AF350190_HBe_P-E of FT:mat_peptide AF350190_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1615). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350191_HBe_P-E Product feature CHAIN AF350191_HBe_P-E of FT:mat_peptide AF350191_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1654F172). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350192_HBe_P-E Product feature CHAIN AF350192_HBe_P-E of FT:mat_peptide AF350192_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1660F173). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350193_HBe_P-E Product feature CHAIN AF350193_HBe_P-E of FT:mat_peptide AF350193_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1664F174). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350194_HBe_P-E Product feature CHAIN AF350194_HBe_P-E of FT:mat_peptide AF350194_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1665F174). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350195_HBe_P-E Product feature CHAIN AF350195_HBe_P-E of FT:mat_peptide AF350195_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1670F172). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350196_HBe_P-E Product feature CHAIN AF350196_HBe_P-E of FT:mat_peptide AF350196_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1676F174). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350197_HBe_P-E Product feature CHAIN AF350197_HBe_P-E of FT:mat_peptide AF350197_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1678). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350198_HBe_P-E Product feature CHAIN AF350198_HBe_P-E of FT:mat_peptide AF350198_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1682). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350199_HBe_P-E Product feature CHAIN AF350199_HBe_P-E of FT:mat_peptide AF350199_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1691). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350200_HBe_P-E Product feature CHAIN AF350200_HBe_P-E of FT:mat_peptide AF350200_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1713). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350201_HBe_P-E Product feature CHAIN AF350201_HBe_P-E of FT:mat_peptide AF350201_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1720). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350202_HBe_P-E Product feature CHAIN AF350202_HBe_P-E of FT:mat_peptide AF350202_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1722). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350203_HBe_P-E Product feature CHAIN AF350203_HBe_P-E of FT:mat_peptide AF350203_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1729F202). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350205_HBe_P-E Product feature CHAIN AF350205_HBe_P-E of FT:mat_peptide AF350205_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1821F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350206_HBe_P-E Product feature CHAIN AF350206_HBe_P-E of FT:mat_peptide AF350206_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1822F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCVTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350210_HBe_P-E Product feature CHAIN AF350210_HBe_P-E of FT:mat_peptide AF350210_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1828F219). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350212_HBe_P-E Product feature CHAIN AF350212_HBe_P-E of FT:mat_peptide AF350212_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1833F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350213_HBe_P-E Product feature CHAIN AF350213_HBe_P-E of FT:mat_peptide AF350213_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1834F217). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350214_HBe_P-E Product feature CHAIN AF350214_HBe_P-E of FT:mat_peptide AF350214_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1842). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350215_HBe_P-E Product feature CHAIN AF350215_HBe_P-E of FT:mat_peptide AF350215_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1847). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFWPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350216_HBe_P-E Product feature CHAIN AF350216_HBe_P-E of FT:mat_peptide AF350216_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1862F231). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350217_HBe_P-E Product feature CHAIN AF350217_HBe_P-E of FT:mat_peptide AF350217_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1863F231). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350218_HBe_P-E Product feature CHAIN AF350218_HBe_P-E of FT:mat_peptide AF350218_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1872). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350219_HBe_P-E Product feature CHAIN AF350219_HBe_P-E of FT:mat_peptide AF350219_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1874F238). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTIAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AF350220_HBe_P-E Product feature CHAIN AF350220_HBe_P-E of FT:mat_peptide AF350220_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Gam1876F238). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTIAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110808_HBe_P-E Product feature CHAIN AM110808_HBe_P-E of FT:mat_peptide AM110808_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAEch60). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110809_HBe_P-E Product feature CHAIN AM110809_HBe_P-E of FT:mat_peptide AM110809_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAEch62). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110817_HBe_P-E Product feature CHAIN AM110817_HBe_P-E of FT:mat_peptide AM110817_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MAL57). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110818_HBe_P-E Product feature CHAIN AM110818_HBe_P-E of FT:mat_peptide AM110818_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MAL58). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRNLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110819_HBe_P-E Product feature CHAIN AM110819_HBe_P-E of FT:mat_peptide AM110819_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MAL61). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110821_HBe_P-E Product feature CHAIN AM110821_HBe_P-E of FT:mat_peptide AM110821_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MAL69). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAP
WVGVNLENPASRDLLFSYVNTNMGLKFRQLLWFHISCLTFGKKTVIKYLVSFGVW
>gnl|hbvpro|AM110822_HBe_P-E Product feature CHAIN AM110822_HBe_P-E of FT:mat_peptide AM110822_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MAL74). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPPSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110823_HBe_P-E Product feature CHAIN AM110823_HBe_P-E of FT:mat_peptide AM110823_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MAL75). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVW
>gnl|hbvpro|AM110824_HBe_P-E Product feature CHAIN AM110824_HBe_P-E of FT:mat_peptide AM110824_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MAL77). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELITLAT
WVGVNLENPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110826_HBe_P-E Product feature CHAIN AM110826_HBe_P-E of FT:mat_peptide AM110826_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MAL82). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWLHLSCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110848_HBe_P-E Product feature CHAIN AM110848_HBe_P-E of FT:mat_peptide AM110848_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24008). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110850_HBe_P-E Product feature CHAIN AM110850_HBe_P-E of FT:mat_peptide AM110850_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24072). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRXLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110852_HBe_P-E Product feature CHAIN AM110852_HBe_P-E of FT:mat_peptide AM110852_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24093). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110853_HBe_P-E Product feature CHAIN AM110853_HBe_P-E of FT:mat_peptide AM110853_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24095). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110854_HBe_P-E Product feature CHAIN AM110854_HBe_P-E of FT:mat_peptide AM110854_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24173). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGXNLEDPASRDXVVSYVNTNMGLKFRQLLWFHISCLTFGRETVXEYLVSFGVW
>gnl|hbvpro|AM110856_HBe_P-E Product feature CHAIN AM110856_HBe_P-E of FT:mat_peptide AM110856_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24169). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|AM110857_HBe_P-E Product feature CHAIN AM110857_HBe_P-E of FT:mat_peptide AM110857_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24146). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110858_HBe_P-E Product feature CHAIN AM110858_HBe_P-E of FT:mat_peptide AM110858_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24142). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110863_HBe_P-E Product feature CHAIN AM110863_HBe_P-E of FT:mat_peptide AM110863_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24177). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110864_HBe_P-E Product feature CHAIN AM110864_HBe_P-E of FT:mat_peptide AM110864_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24180). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110865_HBe_P-E Product feature CHAIN AM110865_HBe_P-E of FT:mat_peptide AM110865_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24186). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110866_HBe_P-E Product feature CHAIN AM110866_HBe_P-E of FT:mat_peptide AM110866_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24195). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110867_HBe_P-E Product feature CHAIN AM110867_HBe_P-E of FT:mat_peptide AM110867_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24233). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110868_HBe_P-E Product feature CHAIN AM110868_HBe_P-E of FT:mat_peptide AM110868_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24255). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110869_HBe_P-E Product feature CHAIN AM110869_HBe_P-E of FT:mat_peptide AM110869_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24259). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110871_HBe_P-E Product feature CHAIN AM110871_HBe_P-E of FT:mat_peptide AM110871_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24263). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSXRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110872_HBe_P-E Product feature CHAIN AM110872_HBe_P-E of FT:mat_peptide AM110872_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE24315). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALFRDALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110874_HBe_P-E Product feature CHAIN AM110874_HBe_P-E of FT:mat_peptide AM110874_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Lag558). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALFRDALESPEHCTPHHTALRQAILCWGDLMNLAT
WVGVNLEDQPSRDLVVSYVNINIGLKFRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|AM110875_HBe_P-E Product feature CHAIN AM110875_HBe_P-E of FT:mat_peptide AM110875_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Lag561). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110877_HBe_P-E Product feature CHAIN AM110877_HBe_P-E of FT:mat_peptide AM110877_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Lag555). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALFRDALESPEHCTPHHTALRQAILCWGDLMNLAT
WVGVNLEDQPSRDLVVSYVNINIGLKFRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|AM110879_HBe_P-E Product feature CHAIN AM110879_HBe_P-E of FT:mat_peptide AM110879_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Lag551). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNNNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVW
>gnl|hbvpro|AM110880_HBe_P-E Product feature CHAIN AM110880_HBe_P-E of FT:mat_peptide AM110880_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE12260). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110882_HBe_P-E Product feature CHAIN AM110882_HBe_P-E of FT:mat_peptide AM110882_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE12243). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110883_HBe_P-E Product feature CHAIN AM110883_HBe_P-E of FT:mat_peptide AM110883_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE12255). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110884_HBe_P-E Product feature CHAIN AM110884_HBe_P-E of FT:mat_peptide AM110884_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE12050). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110885_HBe_P-E Product feature CHAIN AM110885_HBe_P-E of FT:mat_peptide AM110885_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE12106). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110886_HBe_P-E Product feature CHAIN AM110886_HBe_P-E of FT:mat_peptide AM110886_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE12195). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110887_HBe_P-E Product feature CHAIN AM110887_HBe_P-E of FT:mat_peptide AM110887_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE12179). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110888_HBe_P-E Product feature CHAIN AM110888_HBe_P-E of FT:mat_peptide AM110888_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE12178). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110889_HBe_P-E Product feature CHAIN AM110889_HBe_P-E of FT:mat_peptide AM110889_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE12193). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVX
>gnl|hbvpro|AM110890_HBe_P-E Product feature CHAIN AM110890_HBe_P-E of FT:mat_peptide AM110890_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NIE12169). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110892_HBe_P-E Product feature CHAIN AM110892_HBe_P-E of FT:mat_peptide AM110892_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAE92). Partial genome (Contains: HBe, HBc). [Hepadnaviridae] (length=133 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEXLVSFG
>gnl|hbvpro|AM110893_HBe_P-E Product feature CHAIN AM110893_HBe_P-E of FT:mat_peptide AM110893_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAE189). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110897_HBe_P-E Product feature CHAIN AM110897_HBe_P-E of FT:mat_peptide AM110897_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAE283). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLEWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPDHVSSHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVW
>gnl|hbvpro|AM110899_HBe_P-E Product feature CHAIN AM110899_HBe_P-E of FT:mat_peptide AM110899_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAE353). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110900_HBe_P-E Product feature CHAIN AM110900_HBe_P-E of FT:mat_peptide AM110900_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAE388). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKXXLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110901_HBe_P-E Product feature CHAIN AM110901_HBe_P-E of FT:mat_peptide AM110901_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAE296). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLEWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPDHVSSHHTALRQAILCWGDLMSLAT
WVGVNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVW
>gnl|hbvpro|AM110902_HBe_P-E Product feature CHAIN AM110902_HBe_P-E of FT:mat_peptide AM110902_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAE374). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110904_HBe_P-E Product feature CHAIN AM110904_HBe_P-E of FT:mat_peptide AM110904_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAE375). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110911_HBe_P-E Product feature CHAIN AM110911_HBe_P-E of FT:mat_peptide AM110911_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAEch43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRNLLDTASALYRDALKSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKXRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110912_HBe_P-E Product feature CHAIN AM110912_HBe_P-E of FT:mat_peptide AM110912_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAEch45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLXSFGXG
>gnl|hbvpro|AM110913_HBe_P-E Product feature CHAIN AM110913_HBe_P-E of FT:mat_peptide AM110913_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAEch46). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM110914_HBe_P-E Product feature CHAIN AM110914_HBe_P-E of FT:mat_peptide AM110914_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAEch48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGXLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494689_HBe_P-E Product feature CHAIN AM494689_HBe_P-E of FT:mat_peptide AM494689_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR006). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494690_HBe_P-E Product feature CHAIN AM494690_HBe_P-E of FT:mat_peptide AM494690_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR008). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494691_HBe_P-E Product feature CHAIN AM494691_HBe_P-E of FT:mat_peptide AM494691_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR024). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGANLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494692_HBe_P-E Product feature CHAIN AM494692_HBe_P-E of FT:mat_peptide AM494692_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR026). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTALALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494693_HBe_P-E Product feature CHAIN AM494693_HBe_P-E of FT:mat_peptide AM494693_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR039). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494694_HBe_P-E Product feature CHAIN AM494694_HBe_P-E of FT:mat_peptide AM494694_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR047). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494695_HBe_P-E Product feature CHAIN AM494695_HBe_P-E of FT:mat_peptide AM494695_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR053). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRETVVEYLVSFGVW
>gnl|hbvpro|AM494696_HBe_P-E Product feature CHAIN AM494696_HBe_P-E of FT:mat_peptide AM494696_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR060). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494697_HBe_P-E Product feature CHAIN AM494697_HBe_P-E of FT:mat_peptide AM494697_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR063). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494698_HBe_P-E Product feature CHAIN AM494698_HBe_P-E of FT:mat_peptide AM494698_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR066). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494699_HBe_P-E Product feature CHAIN AM494699_HBe_P-E of FT:mat_peptide AM494699_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR082). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494700_HBe_P-E Product feature CHAIN AM494700_HBe_P-E of FT:mat_peptide AM494700_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR083). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494701_HBe_P-E Product feature CHAIN AM494701_HBe_P-E of FT:mat_peptide AM494701_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR097). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494702_HBe_P-E Product feature CHAIN AM494702_HBe_P-E of FT:mat_peptide AM494702_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR106). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494703_HBe_P-E Product feature CHAIN AM494703_HBe_P-E of FT:mat_peptide AM494703_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR107). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGVNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494704_HBe_P-E Product feature CHAIN AM494704_HBe_P-E of FT:mat_peptide AM494704_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR112). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494705_HBe_P-E Product feature CHAIN AM494705_HBe_P-E of FT:mat_peptide AM494705_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR115). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494706_HBe_P-E Product feature CHAIN AM494706_HBe_P-E of FT:mat_peptide AM494706_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR131). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494707_HBe_P-E Product feature CHAIN AM494707_HBe_P-E of FT:mat_peptide AM494707_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR137). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494708_HBe_P-E Product feature CHAIN AM494708_HBe_P-E of FT:mat_peptide AM494708_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR138). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494709_HBe_P-E Product feature CHAIN AM494709_HBe_P-E of FT:mat_peptide AM494709_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR143). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494710_HBe_P-E Product feature CHAIN AM494710_HBe_P-E of FT:mat_peptide AM494710_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR144). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494711_HBe_P-E Product feature CHAIN AM494711_HBe_P-E of FT:mat_peptide AM494711_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR146). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494712_HBe_P-E Product feature CHAIN AM494712_HBe_P-E of FT:mat_peptide AM494712_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR150). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494713_HBe_P-E Product feature CHAIN AM494713_HBe_P-E of FT:mat_peptide AM494713_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR154). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494714_HBe_P-E Product feature CHAIN AM494714_HBe_P-E of FT:mat_peptide AM494714_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR165). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494715_HBe_P-E Product feature CHAIN AM494715_HBe_P-E of FT:mat_peptide AM494715_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR171). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494717_HBe_P-E Product feature CHAIN AM494717_HBe_P-E of FT:mat_peptide AM494717_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR187). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494788_HBe_P-E Product feature CHAIN AM494788_HBe_P-E of FT:mat_peptide AM494788_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR145). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494789_HBe_P-E Product feature CHAIN AM494789_HBe_P-E of FT:mat_peptide AM494789_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR198). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494790_HBe_P-E Product feature CHAIN AM494790_HBe_P-E of FT:mat_peptide AM494790_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR234). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494791_HBe_P-E Product feature CHAIN AM494791_HBe_P-E of FT:mat_peptide AM494791_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR001-1). Partial genome (Contains: HBe, HBc, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHWSPHHSAIRQAILCWGELMTLAT
WVGVKLEDPASRDLVVSYVNTNLGLKFQQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494832_HBe_P-E Product feature CHAIN AM494832_HBe_P-E of FT:mat_peptide AM494832_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR177-4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY382484_HBe_P-E Product feature CHAIN AY382484_HBe_P-E of FT:mat_peptide AY382484_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Vu9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY382492_HBe_P-E Product feature CHAIN AY382492_HBe_P-E of FT:mat_peptide AY382492_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Vu29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNWEDPASRDLVVSYVTTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY382496_HBe_P-E Product feature CHAIN AY382496_HBe_P-E of FT:mat_peptide AY382496_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Vu34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWRELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISWLTFGREPVIEYLVSFGVW
>gnl|hbvpro|AY738144_HBe_P-E Product feature CHAIN AY738144_HBe_P-E of FT:mat_peptide AY738144_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY738145_HBe_C-E Product feature CHAIN AY738145_HBe_C-E of FT:mat_peptide AY738145_HBe_C-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY738146_HBe_P-E Product feature CHAIN AY738146_HBe_P-E of FT:mat_peptide AY738146_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 7/98). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY738147_HBe_P-E Product feature CHAIN AY738147_HBe_P-E of FT:mat_peptide AY738147_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient B, 10/98). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY739674_HBe_P-E Product feature CHAIN AY739674_HBe_P-E of FT:mat_peptide AY739674_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY739675_HBe_P-E Product feature CHAIN AY739675_HBe_P-E of FT:mat_peptide AY739675_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate patient P2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY935700_HBe_P-E Product feature CHAIN AY935700_HBe_P-E of FT:mat_peptide AY935700_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate TH-HBV-012). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMSLAT
WVGVNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY967464_HBe_P-E Product feature CHAIN AY967464_HBe_P-E of FT:mat_peptide AY967464_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EI03194). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY967466_HBe_P-E Product feature CHAIN AY967466_HBe_P-E of FT:mat_peptide AY967466_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EI00628). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ060822_HBe_P-E Product feature CHAIN DQ060822_HBe_P-E of FT:mat_peptide DQ060822_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8510-91). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ060823_HBe_P-E Product feature CHAIN DQ060823_HBe_P-E of FT:mat_peptide DQ060823_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8504-91). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ060824_HBe_P-E Product feature CHAIN DQ060824_HBe_P-E of FT:mat_peptide DQ060824_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0121-20). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ060825_HBe_P-E Product feature CHAIN DQ060825_HBe_P-E of FT:mat_peptide DQ060825_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0262-09). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ060826_HBe_P-E Product feature CHAIN DQ060826_HBe_P-E of FT:mat_peptide DQ060826_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0433-20). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ060827_HBe_P-E Product feature CHAIN DQ060827_HBe_P-E of FT:mat_peptide DQ060827_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0317-04). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ060828_HBe_P-E Product feature CHAIN DQ060828_HBe_P-E of FT:mat_peptide DQ060828_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0443-03). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ060829_HBe_P-E Product feature CHAIN DQ060829_HBe_P-E of FT:mat_peptide DQ060829_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 0350-03). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ060830_HBe_P-E Product feature CHAIN DQ060830_HBe_P-E of FT:mat_peptide DQ060830_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 235-01). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EF395269_HBe_P-E Product feature CHAIN EF395269_HBe_P-E of FT:mat_peptide EF395269_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EIBB470). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU239217_HBe_P-E Product feature CHAIN EU239217_HBe_P-E of FT:mat_peptide EU239217_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate G2451). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLGFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU239218_HBe_P-E Product feature CHAIN EU239218_HBe_P-E of FT:mat_peptide EU239218_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BD2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU239219_HBe_P-E Product feature CHAIN EU239219_HBe_P-E of FT:mat_peptide EU239219_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU239221_HBe_P-E Product feature CHAIN EU239221_HBe_P-E of FT:mat_peptide EU239221_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU239223_HBe_P-E Product feature CHAIN EU239223_HBe_P-E of FT:mat_peptide EU239223_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDIMTIAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU239226_HBe_P-E Product feature CHAIN EU239226_HBe_P-E of FT:mat_peptide EU239226_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PW6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU620071_HBe_P-E Product feature CHAIN EU620071_HBe_P-E of FT:mat_peptide EU620071_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Irish-16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU726883_HBe_P-E Product feature CHAIN EU726883_HBe_P-E of FT:mat_peptide EU726883_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IR-RCGLD-7064). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDAYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FJ349226_HBe_P-E Product feature CHAIN FJ349226_HBe_P-E of FT:mat_peptide FJ349226_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate H6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPSSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FJ349237_HBe_P-E Product feature CHAIN FJ349237_HBe_P-E of FT:mat_peptide FJ349237_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C27). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FJ349238_HBe_P-E Product feature CHAIN FJ349238_HBe_P-E of FT:mat_peptide FJ349238_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C65). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FJ349239_HBe_P-E Product feature CHAIN FJ349239_HBe_P-E of FT:mat_peptide FJ349239_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C74). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FN545823_HBe_P-E Product feature CHAIN FN545823_HBe_P-E of FT:mat_peptide FN545823_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVXDLLDTASALFRDALESPEHCSPHHTALRQAILCWGXLXXLAT
WVGVNLEDPASRDXVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVW
>gnl|hbvpro|FN545841_HBe_P-E Product feature CHAIN FN545841_HBe_P-E of FT:mat_peptide FN545841_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FN594758_HBe_P-E Product feature CHAIN FN594758_HBe_P-E of FT:mat_peptide FN594758_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate bne341). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSXHHTALRQAILCWGDLMNLAT
WVGANLEDPSSRELVVGYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ161755_HBe_P-E Product feature CHAIN GQ161755_HBe_P-E of FT:mat_peptide GQ161755_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1694). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGDALESPEHCSPHHTALRQAILCWGELMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161756_HBe_P-E Product feature CHAIN GQ161756_HBe_P-E of FT:mat_peptide GQ161756_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1684). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAFRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161758_HBe_P-E Product feature CHAIN GQ161758_HBe_P-E of FT:mat_peptide GQ161758_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1506). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161759_HBe_P-E Product feature CHAIN GQ161759_HBe_P-E of FT:mat_peptide GQ161759_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU934). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161760_HBe_P-E Product feature CHAIN GQ161760_HBe_P-E of FT:mat_peptide GQ161760_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1374). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVW
>gnl|hbvpro|GQ161761_HBe_P-E Product feature CHAIN GQ161761_HBe_P-E of FT:mat_peptide GQ161761_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1033). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161763_HBe_P-E Product feature CHAIN GQ161763_HBe_P-E of FT:mat_peptide GQ161763_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1013). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161764_HBe_P-E Product feature CHAIN GQ161764_HBe_P-E of FT:mat_peptide GQ161764_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1056). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161765_HBe_P-E Product feature CHAIN GQ161765_HBe_P-E of FT:mat_peptide GQ161765_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU952). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161766_HBe_P-E Product feature CHAIN GQ161766_HBe_P-E of FT:mat_peptide GQ161766_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1671). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161769_HBe_P-E Product feature CHAIN GQ161769_HBe_P-E of FT:mat_peptide GQ161769_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU865). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161770_HBe_P-E Product feature CHAIN GQ161770_HBe_P-E of FT:mat_peptide GQ161770_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU927). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161771_HBe_P-E Product feature CHAIN GQ161771_HBe_P-E of FT:mat_peptide GQ161771_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU896). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161772_HBe_P-E Product feature CHAIN GQ161772_HBe_P-E of FT:mat_peptide GQ161772_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU873). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161774_HBe_P-E Product feature CHAIN GQ161774_HBe_P-E of FT:mat_peptide GQ161774_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1501). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161776_HBe_P-E Product feature CHAIN GQ161776_HBe_P-E of FT:mat_peptide GQ161776_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1178). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161777_HBe_P-E Product feature CHAIN GQ161777_HBe_P-E of FT:mat_peptide GQ161777_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU807). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161778_HBe_P-E Product feature CHAIN GQ161778_HBe_P-E of FT:mat_peptide GQ161778_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1035). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161779_HBe_P-E Product feature CHAIN GQ161779_HBe_P-E of FT:mat_peptide GQ161779_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU557). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161780_HBe_P-E Product feature CHAIN GQ161780_HBe_P-E of FT:mat_peptide GQ161780_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU50). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGGW
>gnl|hbvpro|GQ161781_HBe_P-E Product feature CHAIN GQ161781_HBe_P-E of FT:mat_peptide GQ161781_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU200). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161782_HBe_P-E Product feature CHAIN GQ161782_HBe_P-E of FT:mat_peptide GQ161782_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1489). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161784_HBe_P-E Product feature CHAIN GQ161784_HBe_P-E of FT:mat_peptide GQ161784_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU766). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161787_HBe_P-E Product feature CHAIN GQ161787_HBe_P-E of FT:mat_peptide GQ161787_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU841). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161789_HBe_P-E Product feature CHAIN GQ161789_HBe_P-E of FT:mat_peptide GQ161789_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1169). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161790_HBe_P-E Product feature CHAIN GQ161790_HBe_P-E of FT:mat_peptide GQ161790_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1408). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161791_HBe_P-E Product feature CHAIN GQ161791_HBe_P-E of FT:mat_peptide GQ161791_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU459). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161792_HBe_P-E Product feature CHAIN GQ161792_HBe_P-E of FT:mat_peptide GQ161792_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU605). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNIALKFRQLLWFHISCLTFGREPVIEYLVSFGVW
>gnl|hbvpro|GQ161793_HBe_P-E Product feature CHAIN GQ161793_HBe_P-E of FT:mat_peptide GQ161793_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU932). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161794_HBe_P-E Product feature CHAIN GQ161794_HBe_P-E of FT:mat_peptide GQ161794_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU846). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESHEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161795_HBe_P-E Product feature CHAIN GQ161795_HBe_P-E of FT:mat_peptide GQ161795_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1558). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161796_HBe_P-E Product feature CHAIN GQ161796_HBe_P-E of FT:mat_peptide GQ161796_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1146). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLGT
WVGANLDDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161797_HBe_P-E Product feature CHAIN GQ161797_HBe_P-E of FT:mat_peptide GQ161797_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1660). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQAIICWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ161798_HBe_P-E Product feature CHAIN GQ161798_HBe_P-E of FT:mat_peptide GQ161798_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1222). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161800_HBe_P-E Product feature CHAIN GQ161800_HBe_P-E of FT:mat_peptide GQ161800_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1039). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161801_HBe_P-E Product feature CHAIN GQ161801_HBe_P-E of FT:mat_peptide GQ161801_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU438). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGEVMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161803_HBe_P-E Product feature CHAIN GQ161803_HBe_P-E of FT:mat_peptide GQ161803_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1700). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161804_HBe_P-E Product feature CHAIN GQ161804_HBe_P-E of FT:mat_peptide GQ161804_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1428). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161808_HBe_P-E Product feature CHAIN GQ161808_HBe_P-E of FT:mat_peptide GQ161808_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1398). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161810_HBe_P-E Product feature CHAIN GQ161810_HBe_P-E of FT:mat_peptide GQ161810_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU852). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161814_HBe_P-E Product feature CHAIN GQ161814_HBe_P-E of FT:mat_peptide GQ161814_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU625). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRELLVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161815_HBe_P-E Product feature CHAIN GQ161815_HBe_P-E of FT:mat_peptide GQ161815_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1241). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGXLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSCGVW
>gnl|hbvpro|GQ161816_HBe_P-E Product feature CHAIN GQ161816_HBe_P-E of FT:mat_peptide GQ161816_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1214). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161817_HBe_P-E Product feature CHAIN GQ161817_HBe_P-E of FT:mat_peptide GQ161817_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU630). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161819_HBe_P-E Product feature CHAIN GQ161819_HBe_P-E of FT:mat_peptide GQ161819_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1062). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161820_HBe_P-E Product feature CHAIN GQ161820_HBe_P-E of FT:mat_peptide GQ161820_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1089). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSXHHTALRQAILCWGEXMTLAT
WVGVNLEDPASRDLVVSYVNXNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161826_HBe_P-E Product feature CHAIN GQ161826_HBe_P-E of FT:mat_peptide GQ161826_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU607). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLYTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161827_HBe_P-E Product feature CHAIN GQ161827_HBe_P-E of FT:mat_peptide GQ161827_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU180). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161828_HBe_P-E Product feature CHAIN GQ161828_HBe_P-E of FT:mat_peptide GQ161828_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1399). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161829_HBe_P-E Product feature CHAIN GQ161829_HBe_P-E of FT:mat_peptide GQ161829_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU719). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161832_HBe_P-E Product feature CHAIN GQ161832_HBe_P-E of FT:mat_peptide GQ161832_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1091). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161833_HBe_P-E Product feature CHAIN GQ161833_HBe_P-E of FT:mat_peptide GQ161833_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU489). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161835_HBe_P-E Product feature CHAIN GQ161835_HBe_P-E of FT:mat_peptide GQ161835_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU925). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESLEHCSPHHTALRQAILCWGELMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161836_HBe_P-E Product feature CHAIN GQ161836_HBe_P-E of FT:mat_peptide GQ161836_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate GU1051). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ491114_HBe_P-E Product feature CHAIN GQ491114_HBe_P-E of FT:mat_peptide GQ491114_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 8802131). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM164134_HBe_P-E Product feature CHAIN HM164134_HBe_P-E of FT:mat_peptide HM164134_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BA173). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVW
>gnl|hbvpro|HM214721_HBe_P-E Product feature CHAIN HM214721_HBe_P-E of FT:mat_peptide HM214721_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BA48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM214736_HBe_P-E Product feature CHAIN HM214736_HBe_P-E of FT:mat_peptide HM214736_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BA115). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGGLWGMDIDPFKKFGATGELLSFLPFDFFPSVRDFLDTPSALYREALEFPEHCSPPHTALRQAIFCWGEIMTLAT
WGGVNLEDPASRDLVVSYVNTNMGLKFRQLLGFPISCLTFGKETVIEYLVSFGGG
>gnl|hbvpro|HM214749_HBe_P-E Product feature CHAIN HM214749_HBe_P-E of FT:mat_peptide HM214749_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate BA93). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKKFGATGELLSFLPFDFFPSVRDFLDTPSALYREALEFPEHCSPHHTALRQAIFCWGEIMTLAT
WGGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCFTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363567_HBe_P-E Product feature CHAIN HM363567_HBe_P-E of FT:mat_peptide HM363567_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVW
>gnl|hbvpro|HM363568_HBe_P-E Product feature CHAIN HM363568_HBe_P-E of FT:mat_peptide HM363568_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C98). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363569_HBe_P-E Product feature CHAIN HM363569_HBe_P-E of FT:mat_peptide HM363569_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A51). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363570_HBe_P-E Product feature CHAIN HM363570_HBe_P-E of FT:mat_peptide HM363570_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A85). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLSLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363572_HBe_P-E Product feature CHAIN HM363572_HBe_P-E of FT:mat_peptide HM363572_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363573_HBe_P-E Product feature CHAIN HM363573_HBe_P-E of FT:mat_peptide HM363573_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363574_HBe_P-E Product feature CHAIN HM363574_HBe_P-E of FT:mat_peptide HM363574_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V70). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363575_HBe_P-E Product feature CHAIN HM363575_HBe_P-E of FT:mat_peptide HM363575_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V30). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTGSSLYGDALQSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363576_HBe_P-E Product feature CHAIN HM363576_HBe_P-E of FT:mat_peptide HM363576_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V43). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTGSSLCGDALESPEHCSPHHTELRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363577_HBe_P-E Product feature CHAIN HM363577_HBe_P-E of FT:mat_peptide HM363577_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate C19). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363579_HBe_P-E Product feature CHAIN HM363579_HBe_P-E of FT:mat_peptide HM363579_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A32). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363580_HBe_P-E Product feature CHAIN HM363580_HBe_P-E of FT:mat_peptide HM363580_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A79). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363581_HBe_P-E Product feature CHAIN HM363581_HBe_P-E of FT:mat_peptide HM363581_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A84). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363582_HBe_P-E Product feature CHAIN HM363582_HBe_P-E of FT:mat_peptide HM363582_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL314). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363583_HBe_P-E Product feature CHAIN HM363583_HBe_P-E of FT:mat_peptide HM363583_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V137). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363584_HBe_P-E Product feature CHAIN HM363584_HBe_P-E of FT:mat_peptide HM363584_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V129). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363588_HBe_P-E Product feature CHAIN HM363588_HBe_P-E of FT:mat_peptide HM363588_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A100). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363589_HBe_P-E Product feature CHAIN HM363589_HBe_P-E of FT:mat_peptide HM363589_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A178). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363590_HBe_P-E Product feature CHAIN HM363590_HBe_P-E of FT:mat_peptide HM363590_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate V119). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363591_HBe_P-E Product feature CHAIN HM363591_HBe_P-E of FT:mat_peptide HM363591_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A114). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM363592_HBe_P-E Product feature CHAIN HM363592_HBe_P-E of FT:mat_peptide HM363592_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A153). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363593_HBe_P-E Product feature CHAIN HM363593_HBe_P-E of FT:mat_peptide HM363593_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1577). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363595_HBe_P-E Product feature CHAIN HM363595_HBe_P-E of FT:mat_peptide HM363595_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate IBL1219). Complete genome. [Hepadnaviridae] (length=135 residues).
SKMSLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLIDTASALYRDAFESPEHCSPYHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM363604_HBe_P-E Product feature CHAIN HM363604_HBe_P-E of FT:mat_peptide HM363604_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A28). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALFRDALESPDHCSPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HQ700550_HBe_P-E Product feature CHAIN HQ700550_HBe_P-E of FT:mat_peptide HQ700550_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_A032a). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HQ700551_HBe_P-E Product feature CHAIN HQ700551_HBe_P-E of FT:mat_peptide HQ700551_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_F017A). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HQ700552_HBe_P-E Product feature CHAIN HQ700552_HBe_P-E of FT:mat_peptide HQ700552_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate E_Mad_030). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JQ000008_HBe_P-E Product feature CHAIN JQ000008_HBe_P-E of FT:mat_peptide JQ000008_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JQ000009_HBe_P-E Product feature CHAIN JQ000009_HBe_P-E of FT:mat_peptide JQ000009_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate S2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWLHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885171_HBe_P-E Product feature CHAIN KC885171_HBe_P-E of FT:mat_peptide KC885171_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero39-08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQAFLCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVW
>gnl|hbvpro|KC885210_HBe_P-E Product feature CHAIN KC885210_HBe_P-E of FT:mat_peptide KC885210_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero03-09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885220_HBe_P-E Product feature CHAIN KC885220_HBe_P-E of FT:mat_peptide KC885220_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero21-09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885233_HBe_P-E Product feature CHAIN KC885233_HBe_P-E of FT:mat_peptide KC885233_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate other06-09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885351_HBe_P-E Product feature CHAIN KC885351_HBe_P-E of FT:mat_peptide KC885351_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero16-04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885354_HBe_P-E Product feature CHAIN KC885354_HBe_P-E of FT:mat_peptide KC885354_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero17-04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885357_HBe_P-E Product feature CHAIN KC885357_HBe_P-E of FT:mat_peptide KC885357_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero15-04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885386_HBe_P-E Product feature CHAIN KC885386_HBe_P-E of FT:mat_peptide KC885386_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero35-04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885395_HBe_P-E Product feature CHAIN KC885395_HBe_P-E of FT:mat_peptide KC885395_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate unknown03-05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885442_HBe_P-E Product feature CHAIN KC885442_HBe_P-E of FT:mat_peptide KC885442_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate unknown39-05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885443_HBe_P-E Product feature CHAIN KC885443_HBe_P-E of FT:mat_peptide KC885443_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero41-05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885464_HBe_P-E Product feature CHAIN KC885464_HBe_P-E of FT:mat_peptide KC885464_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MSM35-06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885470_HBe_P-E Product feature CHAIN KC885470_HBe_P-E of FT:mat_peptide KC885470_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MSM07-07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885475_HBe_P-E Product feature CHAIN KC885475_HBe_P-E of FT:mat_peptide KC885475_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero32-07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885490_HBe_P-E Product feature CHAIN KC885490_HBe_P-E of FT:mat_peptide KC885490_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero14-07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885501_HBe_P-E Product feature CHAIN KC885501_HBe_P-E of FT:mat_peptide KC885501_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate unknown01-04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885512_HBe_P-E Product feature CHAIN KC885512_HBe_P-E of FT:mat_peptide KC885512_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate unknown17-07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885518_HBe_P-E Product feature CHAIN KC885518_HBe_P-E of FT:mat_peptide KC885518_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate unknown18-07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885542_HBe_P-E Product feature CHAIN KC885542_HBe_P-E of FT:mat_peptide KC885542_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero06-04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC885547_HBe_P-E Product feature CHAIN KC885547_HBe_P-E of FT:mat_peptide KC885547_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate hetero08-04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF170741_HBe_P-E Product feature CHAIN KF170741_HBe_P-E of FT:mat_peptide KF170741_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_047). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF170742_HBe_P-E Product feature CHAIN KF170742_HBe_P-E of FT:mat_peptide KF170742_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SDAC_125). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF798259_HBe_P-E Product feature CHAIN KF798259_HBe_P-E of FT:mat_peptide KF798259_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF798270_HBe_P-E Product feature CHAIN KF798270_HBe_P-E of FT:mat_peptide KF798270_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF798275_HBe_P-E Product feature CHAIN KF798275_HBe_P-E of FT:mat_peptide KF798275_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798298_HBe_P-E Product feature CHAIN KF798298_HBe_P-E of FT:mat_peptide KF798298_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate EICIB-40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF849713_HBe_P-E Product feature CHAIN KF849713_HBe_P-E of FT:mat_peptide KF849713_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA277). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRELLWFHISCLTLGRETVXDYLVSFGVW
>gnl|hbvpro|KF849714_HBe_P-E Product feature CHAIN KF849714_HBe_P-E of FT:mat_peptide KF849714_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA439). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELXSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF849715_HBe_P-E Product feature CHAIN KF849715_HBe_P-E of FT:mat_peptide KF849715_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA445). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF849716_HBe_P-E Product feature CHAIN KF849716_HBe_P-E of FT:mat_peptide KF849716_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA278). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFXQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF849717_HBe_P-E Product feature CHAIN KF849717_HBe_P-E of FT:mat_peptide KF849717_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA504). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF849719_HBe_P-E Product feature CHAIN KF849719_HBe_P-E of FT:mat_peptide KF849719_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA154). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVEFLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF849720_HBe_P-E Product feature CHAIN KF849720_HBe_P-E of FT:mat_peptide KF849720_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA265). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMVIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF849721_HBe_P-E Product feature CHAIN KF849721_HBe_P-E of FT:mat_peptide KF849721_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA379). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTLGRETVIEYLVSFGVW
>gnl|hbvpro|KF849722_HBe_P-E Product feature CHAIN KF849722_HBe_P-E of FT:mat_peptide KF849722_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA386). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF849723_HBe_P-E Product feature CHAIN KF849723_HBe_P-E of FT:mat_peptide KF849723_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA173). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF849725_HBe_P-E Product feature CHAIN KF849725_HBe_P-E of FT:mat_peptide KF849725_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA399). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQACLCWGDVMNLAT
WVGVNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF849727_HBe_P-E Product feature CHAIN KF849727_HBe_P-E of FT:mat_peptide KF849727_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate LDA405). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KJ810862_HBe_P-E Product feature CHAIN KJ810862_HBe_P-E of FT:mat_peptide KJ810862_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 591). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVW
>gnl|hbvpro|KM606738_HBe_P-E Product feature CHAIN KM606738_HBe_P-E of FT:mat_peptide KM606738_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Cuba27a). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243216_HBe_P-E Product feature CHAIN KP243216_HBe_P-E of FT:mat_peptide KP243216_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1010669_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243240_HBe_P-E Product feature CHAIN KP243240_HBe_P-E of FT:mat_peptide KP243240_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1029765_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243307_HBe_P-E Product feature CHAIN KP243307_HBe_P-E of FT:mat_peptide KP243307_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1300089_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243321_HBe_P-E Product feature CHAIN KP243321_HBe_P-E of FT:mat_peptide KP243321_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1400015_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243325_HBe_P-E Product feature CHAIN KP243325_HBe_P-E of FT:mat_peptide KP243325_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1400019_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243340_HBe_P-E Product feature CHAIN KP243340_HBe_P-E of FT:mat_peptide KP243340_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 823995_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243347_HBe_P-E Product feature CHAIN KP243347_HBe_P-E of FT:mat_peptide KP243347_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 829037_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243360_HBe_P-E Product feature CHAIN KP243360_HBe_P-E of FT:mat_peptide KP243360_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 836193_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243421_HBe_P-E Product feature CHAIN KP243421_HBe_P-E of FT:mat_peptide KP243421_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 890001_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243446_HBe_P-E Product feature CHAIN KP243446_HBe_P-E of FT:mat_peptide KP243446_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 903449_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243459_HBe_P-E Product feature CHAIN KP243459_HBe_P-E of FT:mat_peptide KP243459_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 906547_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSSHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243472_HBe_P-E Product feature CHAIN KP243472_HBe_P-E of FT:mat_peptide KP243472_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 915063_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243478_HBe_P-E Product feature CHAIN KP243478_HBe_P-E of FT:mat_peptide KP243478_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 917283_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243481_HBe_P-E Product feature CHAIN KP243481_HBe_P-E of FT:mat_peptide KP243481_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 918235_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243525_HBe_P-E Product feature CHAIN KP243525_HBe_P-E of FT:mat_peptide KP243525_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 946797_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243569_HBe_P-E Product feature CHAIN KP243569_HBe_P-E of FT:mat_peptide KP243569_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 977133_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP288876_HBe_P-E Product feature CHAIN KP288876_HBe_P-E of FT:mat_peptide KP288876_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate PatA). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001332_HBe_P-E Product feature CHAIN KT001332_HBe_P-E of FT:mat_peptide KT001332_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 325). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001333_HBe_P-E Product feature CHAIN KT001333_HBe_P-E of FT:mat_peptide KT001333_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 551). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001334_HBe_P-E Product feature CHAIN KT001334_HBe_P-E of FT:mat_peptide KT001334_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 523). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001336_HBe_P-E Product feature CHAIN KT001336_HBe_P-E of FT:mat_peptide KT001336_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 287). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001337_HBe_P-E Product feature CHAIN KT001337_HBe_P-E of FT:mat_peptide KT001337_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 359). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001338_HBe_P-E Product feature CHAIN KT001338_HBe_P-E of FT:mat_peptide KT001338_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 510). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLENPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001340_HBe_P-E Product feature CHAIN KT001340_HBe_P-E of FT:mat_peptide KT001340_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 168). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001341_HBe_P-E Product feature CHAIN KT001341_HBe_P-E of FT:mat_peptide KT001341_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 363). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001342_HBe_P-E Product feature CHAIN KT001342_HBe_P-E of FT:mat_peptide KT001342_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 306). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPSSRDLVVSYVNTNMGLKFRQLLWFHISCLTFERETVIEYLVSFGVW
>gnl|hbvpro|KT001343_HBe_P-E Product feature CHAIN KT001343_HBe_P-E of FT:mat_peptide KT001343_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 269). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001344_HBe_P-E Product feature CHAIN KT001344_HBe_P-E of FT:mat_peptide KT001344_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 284). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001345_HBe_P-E Product feature CHAIN KT001345_HBe_P-E of FT:mat_peptide KT001345_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 301). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001346_HBe_P-E Product feature CHAIN KT001346_HBe_P-E of FT:mat_peptide KT001346_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 317). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVW
>gnl|hbvpro|KT001347_HBe_P-E Product feature CHAIN KT001347_HBe_P-E of FT:mat_peptide KT001347_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 314). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALQSPEHCSPHHTALRQAILCWGELMTLAT
WVGENLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001348_HBe_P-E Product feature CHAIN KT001348_HBe_P-E of FT:mat_peptide KT001348_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 373). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLENPASRDLLFSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFEVW
>gnl|hbvpro|KT001349_HBe_P-E Product feature CHAIN KT001349_HBe_P-E of FT:mat_peptide KT001349_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 454). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001350_HBe_P-E Product feature CHAIN KT001350_HBe_P-E of FT:mat_peptide KT001350_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 500). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIKYLVSFGVW
>gnl|hbvpro|KT001352_HBe_P-E Product feature CHAIN KT001352_HBe_P-E of FT:mat_peptide KT001352_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 508). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001354_HBe_P-E Product feature CHAIN KT001354_HBe_P-E of FT:mat_peptide KT001354_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 532). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPAVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001355_HBe_P-E Product feature CHAIN KT001355_HBe_P-E of FT:mat_peptide KT001355_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 552). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001356_HBe_P-E Product feature CHAIN KT001356_HBe_P-E of FT:mat_peptide KT001356_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 573). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVLKYLVSFGVW
>gnl|hbvpro|KT001357_HBe_P-E Product feature CHAIN KT001357_HBe_P-E of FT:mat_peptide KT001357_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 644). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001358_HBe_P-E Product feature CHAIN KT001358_HBe_P-E of FT:mat_peptide KT001358_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 660). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001359_HBe_P-E Product feature CHAIN KT001359_HBe_P-E of FT:mat_peptide KT001359_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 658). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001360_HBe_P-E Product feature CHAIN KT001360_HBe_P-E of FT:mat_peptide KT001360_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 683). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001361_HBe_P-E Product feature CHAIN KT001361_HBe_P-E of FT:mat_peptide KT001361_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 365). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001363_HBe_P-E Product feature CHAIN KT001363_HBe_P-E of FT:mat_peptide KT001363_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 483). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRKTVIEYLVSFGVW
>gnl|hbvpro|KT001364_HBe_P-E Product feature CHAIN KT001364_HBe_P-E of FT:mat_peptide KT001364_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 259). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLENPASRDLVFSYVNTNVGLKFRQLWWFHISCLTFGKKTVIKYLVSFEVW
>gnl|hbvpro|KT001366_HBe_P-E Product feature CHAIN KT001366_HBe_P-E of FT:mat_peptide KT001366_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 657). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001370_HBe_P-E Product feature CHAIN KT001370_HBe_P-E of FT:mat_peptide KT001370_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 525). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001371_HBe_P-E Product feature CHAIN KT001371_HBe_P-E of FT:mat_peptide KT001371_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 611). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001373_HBe_P-E Product feature CHAIN KT001373_HBe_P-E of FT:mat_peptide KT001373_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 364). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001375_HBe_P-E Product feature CHAIN KT001375_HBe_P-E of FT:mat_peptide KT001375_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 257). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT001378_HBe_P-E Product feature CHAIN KT001378_HBe_P-E of FT:mat_peptide KT001378_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 502). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLNTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRKTVIEYLVSFGVW
>gnl|hbvpro|KT192626_HBe_P-E Product feature CHAIN KT192626_HBe_P-E of FT:mat_peptide KT192626_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736891_HBe_P-E Product feature CHAIN KU736891_HBe_P-E of FT:mat_peptide KU736891_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736892_HBe_P-E Product feature CHAIN KU736892_HBe_P-E of FT:mat_peptide KU736892_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Egypt_2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGVNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736893_HBe_P-E Product feature CHAIN KU736893_HBe_P-E of FT:mat_peptide KU736893_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Ethiopia_3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736894_HBe_P-E Product feature CHAIN KU736894_HBe_P-E of FT:mat_peptide KU736894_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736895_HBe_P-E Product feature CHAIN KU736895_HBe_P-E of FT:mat_peptide KU736895_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLXFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736896_HBe_P-E Product feature CHAIN KU736896_HBe_P-E of FT:mat_peptide KU736896_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736897_HBe_P-E Product feature CHAIN KU736897_HBe_P-E of FT:mat_peptide KU736897_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736898_HBe_P-E Product feature CHAIN KU736898_HBe_P-E of FT:mat_peptide KU736898_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736899_HBe_P-E Product feature CHAIN KU736899_HBe_P-E of FT:mat_peptide KU736899_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Liberia_6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736900_HBe_P-E Product feature CHAIN KU736900_HBe_P-E of FT:mat_peptide KU736900_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Somalia_2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736901_HBe_P-E Product feature CHAIN KU736901_HBe_P-E of FT:mat_peptide KU736901_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736902_HBe_P-E Product feature CHAIN KU736902_HBe_P-E of FT:mat_peptide KU736902_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736903_HBe_P-E Product feature CHAIN KU736903_HBe_P-E of FT:mat_peptide KU736903_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736904_HBe_P-E Product feature CHAIN KU736904_HBe_P-E of FT:mat_peptide KU736904_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736905_HBe_P-E Product feature CHAIN KU736905_HBe_P-E of FT:mat_peptide KU736905_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_17). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736906_HBe_P-E Product feature CHAIN KU736906_HBe_P-E of FT:mat_peptide KU736906_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736907_HBe_P-E Product feature CHAIN KU736907_HBe_P-E of FT:mat_peptide KU736907_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736908_HBe_P-E Product feature CHAIN KU736908_HBe_P-E of FT:mat_peptide KU736908_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736909_HBe_P-E Product feature CHAIN KU736909_HBe_P-E of FT:mat_peptide KU736909_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMXLAT
WVGVNLEDPASRDLVVSYVNTXMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736910_HBe_P-E Product feature CHAIN KU736910_HBe_P-E of FT:mat_peptide KU736910_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISXLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736911_HBe_P-E Product feature CHAIN KU736911_HBe_P-E of FT:mat_peptide KU736911_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVZLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU736912_HBe_P-E Product feature CHAIN KU736912_HBe_P-E of FT:mat_peptide KU736912_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Sudan_4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDIMTIXT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KX186584_HBe_P-E Product feature CHAIN KX186584_HBe_P-E of FT:mat_peptide KX186584_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Eafr). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|LT623842_HBe_P-E Product feature CHAIN LT623842_HBe_P-E of FT:mat_peptide LT623842_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHXSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|LT623846_HBe_P-E Product feature CHAIN LT623846_HBe_P-E of FT:mat_peptide LT623846_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|LT623847_HBe_P-E Product feature CHAIN LT623847_HBe_P-E of FT:mat_peptide LT623847_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVQLLSFLPPDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDIMNIAT
WVGANLEDQTSRDLVVSYVNTNMGIKFRQLLWFHISCLTFGREVVIEYLVSFGVW
>gnl|hbvpro|LT623848_HBe_P-E Product feature CHAIN LT623848_HBe_P-E of FT:mat_peptide LT623848_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVXEYLVSFGVW
>gnl|hbvpro|LT623849_HBe_P-E Product feature CHAIN LT623849_HBe_P-E of FT:mat_peptide LT623849_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|LT623850_HBe_P-E Product feature CHAIN LT623850_HBe_P-E of FT:mat_peptide LT623850_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MF772354_HBe_P-E Product feature CHAIN MF772354_HBe_P-E of FT:mat_peptide MF772354_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1067). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MF772357_HBe_P-E Product feature CHAIN MF772357_HBe_P-E of FT:mat_peptide MF772357_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 222). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHFSPHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MF772360_HBe_P-E Product feature CHAIN MF772360_HBe_P-E of FT:mat_peptide MF772360_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 666). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF772362_HBe_P-E Product feature CHAIN MF772362_HBe_P-E of FT:mat_peptide MF772362_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 960). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH464856_HBe_P-E Product feature CHAIN MH464856_HBe_P-E of FT:mat_peptide MH464856_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate MA134). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKGFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISSLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580614_HBe_P-E Product feature CHAIN MH580614_HBe_P-E of FT:mat_peptide MH580614_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 177). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580615_HBe_P-E Product feature CHAIN MH580615_HBe_P-E of FT:mat_peptide MH580615_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 188). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580616_HBe_P-E Product feature CHAIN MH580616_HBe_P-E of FT:mat_peptide MH580616_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 190). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580617_HBe_P-E Product feature CHAIN MH580617_HBe_P-E of FT:mat_peptide MH580617_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 193). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580618_HBe_P-E Product feature CHAIN MH580618_HBe_P-E of FT:mat_peptide MH580618_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 199). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580619_HBe_P-E Product feature CHAIN MH580619_HBe_P-E of FT:mat_peptide MH580619_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 200). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580620_HBe_P-E Product feature CHAIN MH580620_HBe_P-E of FT:mat_peptide MH580620_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 201). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580621_HBe_P-E Product feature CHAIN MH580621_HBe_P-E of FT:mat_peptide MH580621_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 209). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580622_HBe_P-E Product feature CHAIN MH580622_HBe_P-E of FT:mat_peptide MH580622_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 210). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580623_HBe_P-E Product feature CHAIN MH580623_HBe_P-E of FT:mat_peptide MH580623_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 232). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580624_HBe_P-E Product feature CHAIN MH580624_HBe_P-E of FT:mat_peptide MH580624_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 226). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580625_HBe_P-E Product feature CHAIN MH580625_HBe_P-E of FT:mat_peptide MH580625_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 239). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580626_HBe_P-E Product feature CHAIN MH580626_HBe_P-E of FT:mat_peptide MH580626_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 240). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSPHHTALRQAILCWGDLMNLGT
WVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580628_HBe_P-E Product feature CHAIN MH580628_HBe_P-E of FT:mat_peptide MH580628_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 304). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580629_HBe_P-E Product feature CHAIN MH580629_HBe_P-E of FT:mat_peptide MH580629_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 306). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580630_HBe_P-E Product feature CHAIN MH580630_HBe_P-E of FT:mat_peptide MH580630_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 310). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580631_HBe_P-E Product feature CHAIN MH580631_HBe_P-E of FT:mat_peptide MH580631_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 333). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580632_HBe_P-E Product feature CHAIN MH580632_HBe_P-E of FT:mat_peptide MH580632_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 334). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580633_HBe_P-E Product feature CHAIN MH580633_HBe_P-E of FT:mat_peptide MH580633_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 398). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580634_HBe_P-E Product feature CHAIN MH580634_HBe_P-E of FT:mat_peptide MH580634_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 400). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580635_HBe_P-E Product feature CHAIN MH580635_HBe_P-E of FT:mat_peptide MH580635_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 401). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580636_HBe_P-E Product feature CHAIN MH580636_HBe_P-E of FT:mat_peptide MH580636_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 402). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580637_HBe_P-E Product feature CHAIN MH580637_HBe_P-E of FT:mat_peptide MH580637_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 408). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580638_HBe_P-E Product feature CHAIN MH580638_HBe_P-E of FT:mat_peptide MH580638_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 416). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580640_HBe_P-E Product feature CHAIN MH580640_HBe_P-E of FT:mat_peptide MH580640_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 438). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580641_HBe_P-E Product feature CHAIN MH580641_HBe_P-E of FT:mat_peptide MH580641_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 439). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580644_HBe_P-E Product feature CHAIN MH580644_HBe_P-E of FT:mat_peptide MH580644_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 458). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580646_HBe_P-E Product feature CHAIN MH580646_HBe_P-E of FT:mat_peptide MH580646_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 476). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580647_HBe_P-E Product feature CHAIN MH580647_HBe_P-E of FT:mat_peptide MH580647_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 490). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580649_HBe_P-E Product feature CHAIN MH580649_HBe_P-E of FT:mat_peptide MH580649_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 523). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580650_HBe_P-E Product feature CHAIN MH580650_HBe_P-E of FT:mat_peptide MH580650_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 619). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580651_HBe_P-E Product feature CHAIN MH580651_HBe_P-E of FT:mat_peptide MH580651_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 623). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH580652_HBe_P-E Product feature CHAIN MH580652_HBe_P-E of FT:mat_peptide MH580652_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 668). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH592467_HBe_P-E Product feature CHAIN MH592467_HBe_P-E of FT:mat_peptide MH592467_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate HBV-As-Nb-95). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH725010_HBe_P-E Product feature CHAIN MH725010_HBe_P-E of FT:mat_peptide MH725010_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-263). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH725020_HBe_P-E Product feature CHAIN MH725020_HBe_P-E of FT:mat_peptide MH725020_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-298). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH725021_HBe_P-E Product feature CHAIN MH725021_HBe_P-E of FT:mat_peptide MH725021_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-311). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH725024_HBe_P-E Product feature CHAIN MH725024_HBe_P-E of FT:mat_peptide MH725024_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-321). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH725042_HBe_P-E Product feature CHAIN MH725042_HBe_P-E of FT:mat_peptide MH725042_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-387). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH725114_HBe_P-E Product feature CHAIN MH725114_HBe_P-E of FT:mat_peptide MH725114_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-870). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH725141_HBe_P-E Product feature CHAIN MH725141_HBe_P-E of FT:mat_peptide MH725141_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-1227). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPDHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH725192_HBe_P-E Product feature CHAIN MH725192_HBe_P-E of FT:mat_peptide MH725192_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate SA-1435). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSSHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH918655_HBe_P-E Product feature CHAIN MH918655_HBe_P-E of FT:mat_peptide MH918655_HBe_P-E of [Viruses] Hepatitis B Virus genotype E. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK321264_HBe_P-E Product feature CHAIN MK321264_HBe_P-E of FT:mat_peptide MK321264_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1332). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK720631_HBe_P-E Product feature CHAIN MK720631_HBe_P-E of FT:mat_peptide MK720631_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate p1332_RCA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK720632_HBe_P-E Product feature CHAIN MK720632_HBe_P-E of FT:mat_peptide MK720632_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate p1332_CL). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN507840_HBe_P-E Product feature CHAIN MN507840_HBe_P-E of FT:mat_peptide MN507840_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 3816_HBVe_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGVNLEDPASRDLVVGYVNTNMGLKFRQLLWFHTSCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN507841_HBe_P-E Product feature CHAIN MN507841_HBe_P-E of FT:mat_peptide MN507841_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 7032_HBVe_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWLHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN507842_HBe_P-E Product feature CHAIN MN507842_HBe_P-E of FT:mat_peptide MN507842_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1048_ocHBVe_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTLGRETVIEYLVSFGVW
>gnl|hbvpro|MN507843_HBe_P-E Product feature CHAIN MN507843_HBe_P-E of FT:mat_peptide MN507843_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1969_ocHBVe_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN507844_HBe_P-E Product feature CHAIN MN507844_HBe_P-E of FT:mat_peptide MN507844_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 2504_ocHBVe_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN507845_HBe_P-E Product feature CHAIN MN507845_HBe_P-E of FT:mat_peptide MN507845_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 2547_ocHBVe_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN507846_HBe_P-E Product feature CHAIN MN507846_HBe_P-E of FT:mat_peptide MN507846_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 2506_ocHBVe_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN507847_HBe_P-E Product feature CHAIN MN507847_HBe_P-E of FT:mat_peptide MN507847_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 2664_HBVe_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN507848_HBe_P-E Product feature CHAIN MN507848_HBe_P-E of FT:mat_peptide MN507848_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 6778_HBVe_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN967526_HBe_P-E Product feature CHAIN MN967526_HBe_P-E of FT:mat_peptide MN967526_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR_39). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN967527_HBe_P-E Product feature CHAIN MN967527_HBe_P-E of FT:mat_peptide MN967527_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR_59). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN967528_HBe_P-E Product feature CHAIN MN967528_HBe_P-E of FT:mat_peptide MN967528_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR_78). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN967529_HBe_P-E Product feature CHAIN MN967529_HBe_P-E of FT:mat_peptide MN967529_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate CAR_93). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT426115_HBe_P-E Product feature CHAIN MT426115_HBe_P-E of FT:mat_peptide MT426115_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate A84 transfection clone). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427110_HBe_P-E Product feature CHAIN MT427110_HBe_P-E of FT:mat_peptide MT427110_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C46). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427111_HBe_P-E Product feature CHAIN MT427111_HBe_P-E of FT:mat_peptide MT427111_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDVLDTASALYRDALECPEHCSPPHTAVRRAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427114_HBe_P-E Product feature CHAIN MT427114_HBe_P-E of FT:mat_peptide MT427114_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWIWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427115_HBe_P-E Product feature CHAIN MT427115_HBe_P-E of FT:mat_peptide MT427115_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C10). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427116_HBe_P-E Product feature CHAIN MT427116_HBe_P-E of FT:mat_peptide MT427116_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C64). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427117_HBe_P-E Product feature CHAIN MT427117_HBe_P-E of FT:mat_peptide MT427117_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427119_HBe_P-E Product feature CHAIN MT427119_HBe_P-E of FT:mat_peptide MT427119_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C30). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427120_HBe_P-E Product feature CHAIN MT427120_HBe_P-E of FT:mat_peptide MT427120_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427121_HBe_P-E Product feature CHAIN MT427121_HBe_P-E of FT:mat_peptide MT427121_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427122_HBe_P-E Product feature CHAIN MT427122_HBe_P-E of FT:mat_peptide MT427122_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C60). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427123_HBe_P-E Product feature CHAIN MT427123_HBe_P-E of FT:mat_peptide MT427123_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSYFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427124_HBe_P-E Product feature CHAIN MT427124_HBe_P-E of FT:mat_peptide MT427124_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427125_HBe_P-E Product feature CHAIN MT427125_HBe_P-E of FT:mat_peptide MT427125_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C56). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427126_HBe_P-E Product feature CHAIN MT427126_HBe_P-E of FT:mat_peptide MT427126_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427127_HBe_P-E Product feature CHAIN MT427127_HBe_P-E of FT:mat_peptide MT427127_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427128_HBe_P-E Product feature CHAIN MT427128_HBe_P-E of FT:mat_peptide MT427128_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C18). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427129_HBe_P-E Product feature CHAIN MT427129_HBe_P-E of FT:mat_peptide MT427129_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C48). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427130_HBe_P-E Product feature CHAIN MT427130_HBe_P-E of FT:mat_peptide MT427130_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C51). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427131_HBe_P-E Product feature CHAIN MT427131_HBe_P-E of FT:mat_peptide MT427131_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C20). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427132_HBe_P-E Product feature CHAIN MT427132_HBe_P-E of FT:mat_peptide MT427132_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427134_HBe_P-E Product feature CHAIN MT427134_HBe_P-E of FT:mat_peptide MT427134_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427135_HBe_P-E Product feature CHAIN MT427135_HBe_P-E of FT:mat_peptide MT427135_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427136_HBe_P-E Product feature CHAIN MT427136_HBe_P-E of FT:mat_peptide MT427136_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427137_HBe_P-E Product feature CHAIN MT427137_HBe_P-E of FT:mat_peptide MT427137_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427138_HBe_P-E Product feature CHAIN MT427138_HBe_P-E of FT:mat_peptide MT427138_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C17). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427139_HBe_P-E Product feature CHAIN MT427139_HBe_P-E of FT:mat_peptide MT427139_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427140_HBe_P-E Product feature CHAIN MT427140_HBe_P-E of FT:mat_peptide MT427140_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C35). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYIDFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427141_HBe_P-E Product feature CHAIN MT427141_HBe_P-E of FT:mat_peptide MT427141_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C53). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427142_HBe_P-E Product feature CHAIN MT427142_HBe_P-E of FT:mat_peptide MT427142_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427143_HBe_P-E Product feature CHAIN MT427143_HBe_P-E of FT:mat_peptide MT427143_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427144_HBe_P-E Product feature CHAIN MT427144_HBe_P-E of FT:mat_peptide MT427144_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427146_HBe_P-E Product feature CHAIN MT427146_HBe_P-E of FT:mat_peptide MT427146_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427147_HBe_P-E Product feature CHAIN MT427147_HBe_P-E of FT:mat_peptide MT427147_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427148_HBe_P-E Product feature CHAIN MT427148_HBe_P-E of FT:mat_peptide MT427148_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427149_HBe_P-E Product feature CHAIN MT427149_HBe_P-E of FT:mat_peptide MT427149_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427150_HBe_P-E Product feature CHAIN MT427150_HBe_P-E of FT:mat_peptide MT427150_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C40). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427151_HBe_P-E Product feature CHAIN MT427151_HBe_P-E of FT:mat_peptide MT427151_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427152_HBe_P-E Product feature CHAIN MT427152_HBe_P-E of FT:mat_peptide MT427152_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427153_HBe_P-E Product feature CHAIN MT427153_HBe_P-E of FT:mat_peptide MT427153_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSLHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427154_HBe_P-E Product feature CHAIN MT427154_HBe_P-E of FT:mat_peptide MT427154_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C44). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSLHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427155_HBe_P-E Product feature CHAIN MT427155_HBe_P-E of FT:mat_peptide MT427155_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427156_HBe_P-E Product feature CHAIN MT427156_HBe_P-E of FT:mat_peptide MT427156_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKELGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427157_HBe_P-E Product feature CHAIN MT427157_HBe_P-E of FT:mat_peptide MT427157_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427158_HBe_P-E Product feature CHAIN MT427158_HBe_P-E of FT:mat_peptide MT427158_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427159_HBe_P-E Product feature CHAIN MT427159_HBe_P-E of FT:mat_peptide MT427159_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427161_HBe_P-E Product feature CHAIN MT427161_HBe_P-E of FT:mat_peptide MT427161_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C2). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427162_HBe_P-E Product feature CHAIN MT427162_HBe_P-E of FT:mat_peptide MT427162_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427163_HBe_P-E Product feature CHAIN MT427163_HBe_P-E of FT:mat_peptide MT427163_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C32). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427164_HBe_P-E Product feature CHAIN MT427164_HBe_P-E of FT:mat_peptide MT427164_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C38). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427165_HBe_P-E Product feature CHAIN MT427165_HBe_P-E of FT:mat_peptide MT427165_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C47). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427166_HBe_P-E Product feature CHAIN MT427166_HBe_P-E of FT:mat_peptide MT427166_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C49). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427167_HBe_P-E Product feature CHAIN MT427167_HBe_P-E of FT:mat_peptide MT427167_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C57). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427168_HBe_P-E Product feature CHAIN MT427168_HBe_P-E of FT:mat_peptide MT427168_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427169_HBe_P-E Product feature CHAIN MT427169_HBe_P-E of FT:mat_peptide MT427169_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C63). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427170_HBe_P-E Product feature CHAIN MT427170_HBe_P-E of FT:mat_peptide MT427170_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427171_HBe_P-E Product feature CHAIN MT427171_HBe_P-E of FT:mat_peptide MT427171_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C36). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
FKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427172_HBe_P-E Product feature CHAIN MT427172_HBe_P-E of FT:mat_peptide MT427172_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427173_HBe_P-E Product feature CHAIN MT427173_HBe_P-E of FT:mat_peptide MT427173_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427174_HBe_P-E Product feature CHAIN MT427174_HBe_P-E of FT:mat_peptide MT427174_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C41_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427175_HBe_P-E Product feature CHAIN MT427175_HBe_P-E of FT:mat_peptide MT427175_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427176_HBe_P-E Product feature CHAIN MT427176_HBe_P-E of FT:mat_peptide MT427176_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427177_HBe_P-E Product feature CHAIN MT427177_HBe_P-E of FT:mat_peptide MT427177_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427178_HBe_P-E Product feature CHAIN MT427178_HBe_P-E of FT:mat_peptide MT427178_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C37). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427179_HBe_P-E Product feature CHAIN MT427179_HBe_P-E of FT:mat_peptide MT427179_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427180_HBe_P-E Product feature CHAIN MT427180_HBe_P-E of FT:mat_peptide MT427180_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C16_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427181_HBe_P-E Product feature CHAIN MT427181_HBe_P-E of FT:mat_peptide MT427181_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427182_HBe_P-E Product feature CHAIN MT427182_HBe_P-E of FT:mat_peptide MT427182_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427183_HBe_P-E Product feature CHAIN MT427183_HBe_P-E of FT:mat_peptide MT427183_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427184_HBe_P-E Product feature CHAIN MT427184_HBe_P-E of FT:mat_peptide MT427184_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427185_HBe_P-E Product feature CHAIN MT427185_HBe_P-E of FT:mat_peptide MT427185_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C12_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427186_HBe_P-E Product feature CHAIN MT427186_HBe_P-E of FT:mat_peptide MT427186_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_40w_C11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427187_HBe_P-E Product feature CHAIN MT427187_HBe_P-E of FT:mat_peptide MT427187_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C30_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427188_HBe_P-E Product feature CHAIN MT427188_HBe_P-E of FT:mat_peptide MT427188_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427189_HBe_P-E Product feature CHAIN MT427189_HBe_P-E of FT:mat_peptide MT427189_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C20). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427190_HBe_P-E Product feature CHAIN MT427190_HBe_P-E of FT:mat_peptide MT427190_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C36). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427191_HBe_P-E Product feature CHAIN MT427191_HBe_P-E of FT:mat_peptide MT427191_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C41_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427192_HBe_P-E Product feature CHAIN MT427192_HBe_P-E of FT:mat_peptide MT427192_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427193_HBe_P-E Product feature CHAIN MT427193_HBe_P-E of FT:mat_peptide MT427193_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C39_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427194_HBe_P-E Product feature CHAIN MT427194_HBe_P-E of FT:mat_peptide MT427194_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427195_HBe_P-E Product feature CHAIN MT427195_HBe_P-E of FT:mat_peptide MT427195_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427196_HBe_P-E Product feature CHAIN MT427196_HBe_P-E of FT:mat_peptide MT427196_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C46). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFSSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427197_HBe_P-E Product feature CHAIN MT427197_HBe_P-E of FT:mat_peptide MT427197_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C55_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427198_HBe_P-E Product feature CHAIN MT427198_HBe_P-E of FT:mat_peptide MT427198_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C62). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427199_HBe_P-E Product feature CHAIN MT427199_HBe_P-E of FT:mat_peptide MT427199_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427200_HBe_P-E Product feature CHAIN MT427200_HBe_P-E of FT:mat_peptide MT427200_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_4w_C45_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT427201_HBe_P-E Product feature CHAIN MT427201_HBe_P-E of FT:mat_peptide MT427201_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 1006_BL_C33_19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570112_HBe_P-E Product feature CHAIN MT570112_HBe_P-E of FT:mat_peptide MT570112_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/SD-116). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570113_HBe_P-E Product feature CHAIN MT570113_HBe_P-E of FT:mat_peptide MT570113_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/SD-177). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570114_HBe_P-E Product feature CHAIN MT570114_HBe_P-E of FT:mat_peptide MT570114_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/ED-021). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570115_HBe_P-E Product feature CHAIN MT570115_HBe_P-E of FT:mat_peptide MT570115_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-048). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
>gnl|hbvpro|MT570116_HBe_P-E Product feature CHAIN MT570116_HBe_P-E of FT:mat_peptide MT570116_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/ED-023). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570117_HBe_P-E Product feature CHAIN MT570117_HBe_P-E of FT:mat_peptide MT570117_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/GM-029). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570118_HBe_P-E Product feature CHAIN MT570118_HBe_P-E of FT:mat_peptide MT570118_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/LA-080). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570119_HBe_P-E Product feature CHAIN MT570119_HBe_P-E of FT:mat_peptide MT570119_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-021). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
>gnl|hbvpro|MT570121_HBe_P-E Product feature CHAIN MT570121_HBe_P-E of FT:mat_peptide MT570121_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/GM-066). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570122_HBe_P-E Product feature CHAIN MT570122_HBe_P-E of FT:mat_peptide MT570122_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/LA-022). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570123_HBe_P-E Product feature CHAIN MT570123_HBe_P-E of FT:mat_peptide MT570123_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/LA-064). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570124_HBe_P-E Product feature CHAIN MT570124_HBe_P-E of FT:mat_peptide MT570124_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-043). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
>gnl|hbvpro|MT570125_HBe_P-E Product feature CHAIN MT570125_HBe_P-E of FT:mat_peptide MT570125_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-113). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570126_HBe_P-E Product feature CHAIN MT570126_HBe_P-E of FT:mat_peptide MT570126_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-056). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
>gnl|hbvpro|MT570127_HBe_P-E Product feature CHAIN MT570127_HBe_P-E of FT:mat_peptide MT570127_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/SD-013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570128_HBe_P-E Product feature CHAIN MT570128_HBe_P-E of FT:mat_peptide MT570128_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/GM-049). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570129_HBe_P-E Product feature CHAIN MT570129_HBe_P-E of FT:mat_peptide MT570129_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/SH-053). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570130_HBe_P-E Product feature CHAIN MT570130_HBe_P-E of FT:mat_peptide MT570130_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/SD-103). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGIKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570131_HBe_P-E Product feature CHAIN MT570131_HBe_P-E of FT:mat_peptide MT570131_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-042). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
>gnl|hbvpro|MT570133_HBe_P-E Product feature CHAIN MT570133_HBe_P-E of FT:mat_peptide MT570133_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/LA-006). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570134_HBe_P-E Product feature CHAIN MT570134_HBe_P-E of FT:mat_peptide MT570134_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-040). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
>gnl|hbvpro|MT570135_HBe_P-E Product feature CHAIN MT570135_HBe_P-E of FT:mat_peptide MT570135_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-085). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570136_HBe_P-E Product feature CHAIN MT570136_HBe_P-E of FT:mat_peptide MT570136_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/LA-028). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570137_HBe_P-E Product feature CHAIN MT570137_HBe_P-E of FT:mat_peptide MT570137_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/ED-020). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570138_HBe_P-E Product feature CHAIN MT570138_HBe_P-E of FT:mat_peptide MT570138_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-074). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570139_HBe_P-E Product feature CHAIN MT570139_HBe_P-E of FT:mat_peptide MT570139_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/LA-089). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570140_HBe_P-E Product feature CHAIN MT570140_HBe_P-E of FT:mat_peptide MT570140_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/SD-174). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570141_HBe_P-E Product feature CHAIN MT570141_HBe_P-E of FT:mat_peptide MT570141_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/SD-106). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570142_HBe_P-E Product feature CHAIN MT570142_HBe_P-E of FT:mat_peptide MT570142_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-026). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRGTVIEYLVSFGVW
>gnl|hbvpro|MT570143_HBe_P-E Product feature CHAIN MT570143_HBe_P-E of FT:mat_peptide MT570143_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/LA-038). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570144_HBe_P-E Product feature CHAIN MT570144_HBe_P-E of FT:mat_peptide MT570144_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/BD-067). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570145_HBe_P-E Product feature CHAIN MT570145_HBe_P-E of FT:mat_peptide MT570145_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/GM-073). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT570146_HBe_P-E Product feature CHAIN MT570146_HBe_P-E of FT:mat_peptide MT570146_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate NG/HBV/SD-165). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT731837_HBe_P-E Product feature CHAIN MT731837_HBe_P-E of FT:mat_peptide MT731837_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate B3519). Partial genome (Contains: HBe, HBc, HBx). [Riboviria] (length=135 residues).
SKLCLGWLXXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGXLMTLAT
WVGVNLEDPASRDLVVSYVNTNXXLKFRQLLWFHISCLTFGREXVIEYLVSFGVR
>gnl|hbvpro|MT731885_HBe_P-E Product feature CHAIN MT731885_HBe_P-E of FT:mat_peptide MT731885_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate B2580). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MW082636_HBe_P-E Product feature CHAIN MW082636_HBe_P-E of FT:mat_peptide MW082636_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate P1_D0). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLGT
WVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MW455161_HBe_P-E Product feature CHAIN MW455161_HBe_P-E of FT:mat_peptide MW455161_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 2678_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MW455162_HBe_P-E Product feature CHAIN MW455162_HBe_P-E of FT:mat_peptide MW455162_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 3029_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MW455163_HBe_P-E Product feature CHAIN MW455163_HBe_P-E of FT:mat_peptide MW455163_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 3485_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MW455164_HBe_P-E Product feature CHAIN MW455164_HBe_P-E of FT:mat_peptide MW455164_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 3509_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRETVVEYLVSFGVW
>gnl|hbvpro|MW455165_HBe_P-E Product feature CHAIN MW455165_HBe_P-E of FT:mat_peptide MW455165_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate 3517_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLITLST
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|MW679682_HBe_P-E Product feature CHAIN MW679682_HBe_P-E of FT:mat_peptide MW679682_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate FE032_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MW679683_HBe_P-E Product feature CHAIN MW679683_HBe_P-E of FT:mat_peptide MW679683_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate FE050_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|MZ962189_HBe_P-E Product feature CHAIN MZ962189_HBe_P-E of FT:mat_peptide MZ962189_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS018_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSPHHTALRQAILFSGELMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ962190_HBe_P-E Product feature CHAIN MZ962190_HBe_P-E of FT:mat_peptide MZ962190_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS012_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGDALESPEHCSPHHTALRQAILCWGELMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ962191_HBe_P-E Product feature CHAIN MZ962191_HBe_P-E of FT:mat_peptide MZ962191_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS005_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ962192_HBe_P-E Product feature CHAIN MZ962192_HBe_P-E of FT:mat_peptide MZ962192_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS007_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ962193_HBe_P-E Product feature CHAIN MZ962193_HBe_P-E of FT:mat_peptide MZ962193_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS100_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ962194_HBe_P-E Product feature CHAIN MZ962194_HBe_P-E of FT:mat_peptide MZ962194_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS095_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESHEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ962195_HBe_P-E Product feature CHAIN MZ962195_HBe_P-E of FT:mat_peptide MZ962195_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS089_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ962196_HBe_P-E Product feature CHAIN MZ962196_HBe_P-E of FT:mat_peptide MZ962196_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS168_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGDALESPEHCSPHHTALRQAILCWGELMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ962197_HBe_P-E Product feature CHAIN MZ962197_HBe_P-E of FT:mat_peptide MZ962197_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS173_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ962198_HBe_P-E Product feature CHAIN MZ962198_HBe_P-E of FT:mat_peptide MZ962198_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS184_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ962199_HBe_P-E Product feature CHAIN MZ962199_HBe_P-E of FT:mat_peptide MZ962199_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate DS232_ocHBVe_GC). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|OM256457_HBe_P-E Product feature CHAIN OM256457_HBe_P-E of FT:mat_peptide OM256457_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate ZAHMDM78). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQXLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|X75657_HBe_P-E Product feature CHAIN X75657_HBe_P-E of FT:mat_peptide X75657_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate Bas). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|Z68140_HBe_P-E Product feature CHAIN Z68140_HBe_P-E of FT:mat_peptide Z68140_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate case 6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGESMTLAT
WVGVNLEIPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|Z68143_HBe_P-E Product feature CHAIN Z68143_HBe_P-E of FT:mat_peptide Z68143_HBe_P-E of [Viruses] Hepatitis B Virus genotype E (isolate case 9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGESMTLAT
WVGVNLEIPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
© 1998-2022Legal notice