HBVdb

Dataset for protein HBe of genotype D

[Download (right click)] [Alignment] [Repertoires]

1422 sequence(s)

>gnl|hbvpro|AB048701_HBe_P-D Product feature CHAIN AB048701_HBe_P-D of FT:mat_peptide AB048701_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRHVCLCWGDLMNLAT
WVGTNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDLVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|AB078031_HBe_P-D Product feature CHAIN AB078031_HBe_P-D of FT:mat_peptide AB078031_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FH1-YS). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB078032_HBe_P-D Product feature CHAIN AB078032_HBe_P-D of FT:mat_peptide AB078032_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AH1-SY). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB078033_HBe_P-D Product feature CHAIN AB078033_HBe_P-D of FT:mat_peptide AB078033_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IS1-OY). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB090268_HBe_P-D Product feature CHAIN AB090268_HBe_P-D of FT:mat_peptide AB090268_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB090269_HBe_P-D Product feature CHAIN AB090269_HBe_P-D of FT:mat_peptide AB090269_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB090270_HBe_P-D Product feature CHAIN AB090270_HBe_P-D of FT:mat_peptide AB090270_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB104709_HBe_P-D Product feature CHAIN AB104709_HBe_P-D of FT:mat_peptide AB104709_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG64). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB104711_HBe_P-D Product feature CHAIN AB104711_HBe_P-D of FT:mat_peptide AB104711_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG104). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB104712_HBe_P-D Product feature CHAIN AB104712_HBe_P-D of FT:mat_peptide AB104712_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EG75). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB109475_HBe_P-D Product feature CHAIN AB109475_HBe_P-D of FT:mat_peptide AB109475_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB109476_HBe_P-D Product feature CHAIN AB109476_HBe_P-D of FT:mat_peptide AB109476_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB110075_HBe_P-D Product feature CHAIN AB110075_HBe_P-D of FT:mat_peptide AB110075_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB116266_HBe_P-D Product feature CHAIN AB116266_HBe_P-D of FT:mat_peptide AB116266_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB119253_HBe_P-D Product feature CHAIN AB119253_HBe_P-D of FT:mat_peptide AB119253_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPQDFFPAVRDLLDTASALYREALESPEHCTYHHTALRQAILCWGELMSLAT
WVGVNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB119255_HBe_P-D Product feature CHAIN AB119255_HBe_P-D of FT:mat_peptide AB119255_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGDLMSLAT
WVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRSTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|AB119256_HBe_P-D Product feature CHAIN AB119256_HBe_P-D of FT:mat_peptide AB119256_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WGGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSSLPEITVVR
RRGR
>gnl|hbvpro|AB120308_HBe_P-D Product feature CHAIN AB120308_HBe_P-D of FT:mat_peptide AB120308_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB126581_HBe_P-D Product feature CHAIN AB126581_HBe_P-D of FT:mat_peptide AB126581_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU301). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB188242_HBe_P-D Product feature CHAIN AB188242_HBe_P-D of FT:mat_peptide AB188242_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KAMCHATKA38). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGANLEDQPSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB188244_HBe_P-D Product feature CHAIN AB188244_HBe_P-D of FT:mat_peptide AB188244_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZ24). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB205126_HBe_P-D Product feature CHAIN AB205126_HBe_P-D of FT:mat_peptide AB205126_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-IF714-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB205127_HBe_P-D Product feature CHAIN AB205127_HBe_P-D of FT:mat_peptide AB205127_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU313-2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB205128_HBe_P-D Product feature CHAIN AB205128_HBe_P-D of FT:mat_peptide AB205128_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-RU316-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRGLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB210821_HBe_P-D Product feature CHAIN AB210821_HBe_P-D of FT:mat_peptide AB210821_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB210822_HBe_P-D Product feature CHAIN AB210822_HBe_P-D of FT:mat_peptide AB210822_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB222710_HBe_P-D Product feature CHAIN AB222710_HBe_P-D of FT:mat_peptide AB222710_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6M). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRHTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|AB222711_HBe_P-D Product feature CHAIN AB222711_HBe_P-D of FT:mat_peptide AB222711_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNV24). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB222712_HBe_P-D Product feature CHAIN AB222712_HBe_P-D of FT:mat_peptide AB222712_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZBV61). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB222713_HBe_P-D Product feature CHAIN AB222713_HBe_P-D of FT:mat_peptide AB222713_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate UZNVC6). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB246347_HBe_P-D Product feature CHAIN AB246347_HBe_P-D of FT:mat_peptide AB246347_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB246348_HBe_P-D Product feature CHAIN AB246348_HBe_P-D of FT:mat_peptide AB246348_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB267090_HBe_P-D Product feature CHAIN AB267090_HBe_P-D of FT:mat_peptide AB267090_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ehime 22-HS). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GRGR
>gnl|hbvpro|AB270543_HBe_P-D Product feature CHAIN AB270543_HBe_P-D of FT:mat_peptide AB270543_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL209F). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB270548_HBe_P-D Product feature CHAIN AB270548_HBe_P-D of FT:mat_peptide AB270548_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MGL207F). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB330369_HBe_P-D Product feature CHAIN AB330369_HBe_P-D of FT:mat_peptide AB330369_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ5HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB330370_HBe_P-D Product feature CHAIN AB330370_HBe_P-D of FT:mat_peptide AB330370_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TAJ6HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB355452_HBe_P-D Product feature CHAIN AB355452_HBe_P-D of FT:mat_peptide AB355452_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB471856_HBe_P-D Product feature CHAIN AB471856_HBe_P-D of FT:mat_peptide AB471856_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB471857_HBe_P-D Product feature CHAIN AB471857_HBe_P-D of FT:mat_peptide AB471857_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate F3O-C2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB493846_HBe_P-D Product feature CHAIN AB493846_HBe_P-D of FT:mat_peptide AB493846_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17UC). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB555497_HBe_P-D Product feature CHAIN AB555497_HBe_P-D of FT:mat_peptide AB555497_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-TA37). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRSPQAYRPPNAPILSTLLETTVVR
RRGR
>gnl|hbvpro|AB583680_HBe_P-D Product feature CHAIN AB583680_HBe_P-D of FT:mat_peptide AB583680_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Pkst7912). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB674403_HBe_P-D Product feature CHAIN AB674403_HBe_P-D of FT:mat_peptide AB674403_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD87). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLTTLAT
WVGGNLEDPTSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRCG
>gnl|hbvpro|AB674405_HBe_P-D Product feature CHAIN AB674405_HBe_P-D of FT:mat_peptide AB674405_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraHCCA12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|AB674407_HBe_P-D Product feature CHAIN AB674407_HBe_P-D of FT:mat_peptide AB674407_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD35). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB674416_HBe_P-D Product feature CHAIN AB674416_HBe_P-D of FT:mat_peptide AB674416_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AnkaraE19). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPDDFFPSARDLLDTATALYREALESQEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLEDQRSRDLVVTYVNANMGIKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPESTVIR
QRGR
>gnl|hbvpro|AB674426_HBe_P-D Product feature CHAIN AB674426_HBe_P-D of FT:mat_peptide AB674426_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD50). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALQSPEHCSPHHTALRQAILCWGDLMXLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB674427_HBe_P-D Product feature CHAIN AB674427_HBe_P-D of FT:mat_peptide AB674427_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD54). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDXDPYKEFGAXVELLSFLPLDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGSNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|AB674429_HBe_P-D Product feature CHAIN AB674429_HBe_P-D of FT:mat_peptide AB674429_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SamsunD89). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLQDPVSRDLVVRYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB674430_HBe_P-D Product feature CHAIN AB674430_HBe_P-D of FT:mat_peptide AB674430_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GaziantepLCC2). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF043593_HBe_P-D Product feature CHAIN AF043593_HBe_P-D of FT:mat_peptide AF043593_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6/89). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|AF043594_HBe_P-D Product feature CHAIN AF043594_HBe_P-D of FT:mat_peptide AF043594_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1/91). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVQLLSFLPHDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGANLQDPASRELVVTYVNINMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF121240_HBe_C-D Product feature CHAIN AF121240_HBe_C-D of FT:mat_peptide AF121240_HBe_C-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/11066). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF121241_HBe_P-D Product feature CHAIN AF121241_HBe_P-D of FT:mat_peptide AF121241_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV/1758). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF151735_HBe_P-D Product feature CHAIN AF151735_HBe_P-D of FT:mat_peptide AF151735_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF280817_HBe_P-D Product feature CHAIN AF280817_HBe_P-D of FT:mat_peptide AF280817_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV-D1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF419526_HBe_P-D Product feature CHAIN AF419526_HBe_P-D of FT:mat_peptide AF419526_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I44-Fam G). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTRLRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF419539_HBe_P-D Product feature CHAIN AF419539_HBe_P-D of FT:mat_peptide AF419539_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I62-Fam I). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWVMDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGVNLQDQASRELVVNYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
GRGR
>gnl|hbvpro|AJ131956_HBe_P-D Product feature CHAIN AJ131956_HBe_P-D of FT:mat_peptide AJ131956_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AJ627220_HBe_P-D Product feature CHAIN AJ627220_HBe_P-D of FT:mat_peptide AJ627220_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 29234). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AJ627223_HBe_P-D Product feature CHAIN AJ627223_HBe_P-D of FT:mat_peptide AJ627223_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33720). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AM422939_HBe_P-D Product feature CHAIN AM422939_HBe_P-D of FT:mat_peptide AM422939_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate X28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY090453_HBe_P-D Product feature CHAIN AY090453_HBe_P-D of FT:mat_peptide AY090453_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
RRGR
>gnl|hbvpro|AY161157_HBe_P-D Product feature CHAIN AY161157_HBe_P-D of FT:mat_peptide AY161157_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDTDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY230112_HBe_P-D Product feature CHAIN AY230112_HBe_P-D of FT:mat_peptide AY230112_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY230114_HBe_P-D Product feature CHAIN AY230114_HBe_P-D of FT:mat_peptide AY230114_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY233291_HBe_P-D Product feature CHAIN AY233291_HBe_P-D of FT:mat_peptide AY233291_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 179). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY233292_HBe_P-D Product feature CHAIN AY233292_HBe_P-D of FT:mat_peptide AY233292_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 184). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY233294_HBe_P-D Product feature CHAIN AY233294_HBe_P-D of FT:mat_peptide AY233294_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 305). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY233296_HBe_P-D Product feature CHAIN AY233296_HBe_P-D of FT:mat_peptide AY233296_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 185). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY236162_HBe_P-D Product feature CHAIN AY236162_HBe_P-D of FT:mat_peptide AY236162_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 23A). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALKQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY350614_HBe_P-D Product feature CHAIN AY350614_HBe_P-D of FT:mat_peptide AY350614_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY371901_HBe_P-D Product feature CHAIN AY371901_HBe_P-D of FT:mat_peptide AY371901_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY371902_HBe_P-D Product feature CHAIN AY371902_HBe_P-D of FT:mat_peptide AY371902_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY371905_HBe_P-D Product feature CHAIN AY371905_HBe_P-D of FT:mat_peptide AY371905_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY371907_HBe_P-D Product feature CHAIN AY371907_HBe_P-D of FT:mat_peptide AY371907_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY371912_HBe_P-D Product feature CHAIN AY371912_HBe_P-D of FT:mat_peptide AY371912_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY371914_HBe_P-D Product feature CHAIN AY371914_HBe_P-D of FT:mat_peptide AY371914_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY371920_HBe_P-D Product feature CHAIN AY371920_HBe_P-D of FT:mat_peptide AY371920_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY371921_HBe_P-D Product feature CHAIN AY371921_HBe_P-D of FT:mat_peptide AY371921_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY371922_HBe_P-D Product feature CHAIN AY371922_HBe_P-D of FT:mat_peptide AY371922_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR:40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY373431_HBe_P-D Product feature CHAIN AY373431_HBe_P-D of FT:mat_peptide AY373431_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY382510_HBe_P-D Product feature CHAIN AY382510_HBe_P-D of FT:mat_peptide AY382510_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Vu52). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRG
>gnl|hbvpro|AY603427_HBe_P-D Product feature CHAIN AY603427_HBe_P-D of FT:mat_peptide AY603427_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 12T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY603428_HBe_P-D Product feature CHAIN AY603428_HBe_P-D of FT:mat_peptide AY603428_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 13T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY603433_HBe_P-D Product feature CHAIN AY603433_HBe_P-D of FT:mat_peptide AY603433_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 26T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHIALRQAILWWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY603437_HBe_P-D Product feature CHAIN AY603437_HBe_P-D of FT:mat_peptide AY603437_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 33T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY603440_HBe_P-D Product feature CHAIN AY603440_HBe_P-D of FT:mat_peptide AY603440_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 58T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY603443_HBe_P-D Product feature CHAIN AY603443_HBe_P-D of FT:mat_peptide AY603443_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 02T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY603445_HBe_P-D Product feature CHAIN AY603445_HBe_P-D of FT:mat_peptide AY603445_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 09T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFSPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY661792_HBe_P-D Product feature CHAIN AY661792_HBe_P-D of FT:mat_peptide AY661792_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ayw). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY661793_HBe_P-D Product feature CHAIN AY661793_HBe_P-D of FT:mat_peptide AY661793_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY721605_HBe_P-D Product feature CHAIN AY721605_HBe_P-D of FT:mat_peptide AY721605_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AK1.1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSHVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY721606_HBe_P-D Product feature CHAIN AY721606_HBe_P-D of FT:mat_peptide AY721606_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AT1.2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY721607_HBe_P-D Product feature CHAIN AY721607_HBe_P-D of FT:mat_peptide AY721607_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HIY1.3). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY721608_HBe_P-D Product feature CHAIN AY721608_HBe_P-D of FT:mat_peptide AY721608_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IB1.4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY721609_HBe_P-D Product feature CHAIN AY721609_HBe_P-D of FT:mat_peptide AY721609_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate AA1.5). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY721610_HBe_P-D Product feature CHAIN AY721610_HBe_P-D of FT:mat_peptide AY721610_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FK1.6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY721611_HBe_P-D Product feature CHAIN AY721611_HBe_P-D of FT:mat_peptide AY721611_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SK1.7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY721612_HBe_P-D Product feature CHAIN AY721612_HBe_P-D of FT:mat_peptide AY721612_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BL1.8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY741797_HBe_P-D Product feature CHAIN AY741797_HBe_P-D of FT:mat_peptide AY741797_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-IPI-21). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY796031_HBe_P-D Product feature CHAIN AY796031_HBe_P-D of FT:mat_peptide AY796031_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RA1.10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDNASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY945307_HBe_P-D Product feature CHAIN AY945307_HBe_P-D of FT:mat_peptide AY945307_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ178011_HBe_P-D Product feature CHAIN DQ178011_HBe_P-D of FT:mat_peptide DQ178011_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVFSYVNTNMGLKFRQLLWLHTSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ178012_HBe_P-D Product feature CHAIN DQ178012_HBe_P-D of FT:mat_peptide DQ178012_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVISYVNTNMGLKFRPLLWFHISCLNFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ178015_HBe_P-D Product feature CHAIN DQ178015_HBe_P-D of FT:mat_peptide DQ178015_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-7). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAFRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ178016_HBe_P-D Product feature CHAIN DQ178016_HBe_P-D of FT:mat_peptide DQ178016_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-8). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ178018_HBe_P-D Product feature CHAIN DQ178018_HBe_P-D of FT:mat_peptide DQ178018_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ178019_HBe_P-D Product feature CHAIN DQ178019_HBe_P-D of FT:mat_peptide DQ178019_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ178020_HBe_P-D Product feature CHAIN DQ178020_HBe_P-D of FT:mat_peptide DQ178020_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Afgh-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVTTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ304547_HBe_P-D Product feature CHAIN DQ304547_HBe_P-D of FT:mat_peptide DQ304547_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLAFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ304548_HBe_P-D Product feature CHAIN DQ304548_HBe_P-D of FT:mat_peptide DQ304548_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ304549_HBe_P-D Product feature CHAIN DQ304549_HBe_P-D of FT:mat_peptide DQ304549_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ304550_HBe_P-D Product feature CHAIN DQ304550_HBe_P-D of FT:mat_peptide DQ304550_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ304551_HBe_P-D Product feature CHAIN DQ304551_HBe_P-D of FT:mat_peptide DQ304551_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ315776_HBe_P-D Product feature CHAIN DQ315776_HBe_P-D of FT:mat_peptide DQ315776_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI00615). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGIDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ315778_HBe_P-D Product feature CHAIN DQ315778_HBe_P-D of FT:mat_peptide DQ315778_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EI0388). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSFRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLINLST
WVGSNLEDPASRDLVVSYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ336688_HBe_P-D Product feature CHAIN DQ336688_HBe_P-D of FT:mat_peptide DQ336688_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFLPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCPTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ336692_HBe_P-D Product feature CHAIN DQ336692_HBe_P-D of FT:mat_peptide DQ336692_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT5). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFLPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGANLEDPASRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ399006_HBe_P-D Product feature CHAIN DQ399006_HBe_P-D of FT:mat_peptide DQ399006_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate G1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPVYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ464168_HBe_P-D Product feature CHAIN DQ464168_HBe_P-D of FT:mat_peptide DQ464168_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGGETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ464169_HBe_P-D Product feature CHAIN DQ464169_HBe_P-D of FT:mat_peptide DQ464169_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ464170_HBe_P-D Product feature CHAIN DQ464170_HBe_P-D of FT:mat_peptide DQ464170_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCRGGLKTLAT
WVGVNLEAPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ486021_HBe_P-D Product feature CHAIN DQ486021_HBe_P-D of FT:mat_peptide DQ486021_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT13). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLRDMDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFREALDAPEHCSPHHTALRQAILCWGDLMTLAT
WVGANLEDPASRDLVVSYVNTNIALKFRQLLWFHISCLTFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ486023_HBe_P-D Product feature CHAIN DQ486023_HBe_P-D of FT:mat_peptide DQ486023_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LT10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLLNLST
WVGGNLQDQTSRDLVVTYVNTNMGLKFRQLLWFHISCLMFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVR
RRGR
>gnl|hbvpro|EF103275_HBe_P-D Product feature CHAIN EF103275_HBe_P-D of FT:mat_peptide EF103275_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF103276_HBe_P-D Product feature CHAIN EF103276_HBe_P-D of FT:mat_peptide EF103276_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran22). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF103277_HBe_P-D Product feature CHAIN EF103277_HBe_P-D of FT:mat_peptide EF103277_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran33). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF103279_HBe_P-D Product feature CHAIN EF103279_HBe_P-D of FT:mat_peptide EF103279_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran99). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF103280_HBe_P-D Product feature CHAIN EF103280_HBe_P-D of FT:mat_peptide EF103280_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran100). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF103281_HBe_P-D Product feature CHAIN EF103281_HBe_P-D of FT:mat_peptide EF103281_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ran102). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SQLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU155893_HBe_P-D Product feature CHAIN EU155893_HBe_P-D of FT:mat_peptide EU155893_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRNTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPEVAVVR
GRGR
>gnl|hbvpro|EU185779_HBe_P-D Product feature CHAIN EU185779_HBe_P-D of FT:mat_peptide EU185779_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H-IDU6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGGNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RQGR
>gnl|hbvpro|EU234070_HBe_P-D Product feature CHAIN EU234070_HBe_P-D of FT:mat_peptide EU234070_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 127_AP78). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCXGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414054_HBe_P-D Product feature CHAIN EU414054_HBe_P-D of FT:mat_peptide EU414054_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414055_HBe_P-D Product feature CHAIN EU414055_HBe_P-D of FT:mat_peptide EU414055_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WXGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414056_HBe_P-D Product feature CHAIN EU414056_HBe_P-D of FT:mat_peptide EU414056_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASXLYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRXTXIXYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414057_HBe_P-D Product feature CHAIN EU414057_HBe_P-D of FT:mat_peptide EU414057_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYXPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414058_HBe_P-D Product feature CHAIN EU414058_HBe_P-D of FT:mat_peptide EU414058_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414059_HBe_P-D Product feature CHAIN EU414059_HBe_P-D of FT:mat_peptide EU414059_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALXSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414060_HBe_P-D Product feature CHAIN EU414060_HBe_P-D of FT:mat_peptide EU414060_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414061_HBe_P-D Product feature CHAIN EU414061_HBe_P-D of FT:mat_peptide EU414061_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WXGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYXPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414135_HBe_P-D Product feature CHAIN EU414135_HBe_P-D of FT:mat_peptide EU414135_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414136_HBe_P-D Product feature CHAIN EU414136_HBe_P-D of FT:mat_peptide EU414136_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414138_HBe_P-D Product feature CHAIN EU414138_HBe_P-D of FT:mat_peptide EU414138_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WXGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYXPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414139_HBe_P-D Product feature CHAIN EU414139_HBe_P-D of FT:mat_peptide EU414139_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALXSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414140_HBe_P-D Product feature CHAIN EU414140_HBe_P-D of FT:mat_peptide EU414140_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414141_HBe_P-D Product feature CHAIN EU414141_HBe_P-D of FT:mat_peptide EU414141_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASXLYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRXTXIXYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414142_HBe_P-D Product feature CHAIN EU414142_HBe_P-D of FT:mat_peptide EU414142_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WXGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU414143_HBe_P-D Product feature CHAIN EU414143_HBe_P-D of FT:mat_peptide EU414143_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYXPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594382_HBe_P-D Product feature CHAIN EU594382_HBe_P-D of FT:mat_peptide EU594382_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594396_HBe_P-D Product feature CHAIN EU594396_HBe_P-D of FT:mat_peptide EU594396_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594397_HBe_P-D Product feature CHAIN EU594397_HBe_P-D of FT:mat_peptide EU594397_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594399_HBe_P-D Product feature CHAIN EU594399_HBe_P-D of FT:mat_peptide EU594399_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLGFHISCLTFGKETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594400_HBe_P-D Product feature CHAIN EU594400_HBe_P-D of FT:mat_peptide EU594400_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594401_HBe_P-D Product feature CHAIN EU594401_HBe_P-D of FT:mat_peptide EU594401_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594402_HBe_P-D Product feature CHAIN EU594402_HBe_P-D of FT:mat_peptide EU594402_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594403_HBe_P-D Product feature CHAIN EU594403_HBe_P-D of FT:mat_peptide EU594403_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594405_HBe_P-D Product feature CHAIN EU594405_HBe_P-D of FT:mat_peptide EU594405_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594407_HBe_P-D Product feature CHAIN EU594407_HBe_P-D of FT:mat_peptide EU594407_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594408_HBe_P-D Product feature CHAIN EU594408_HBe_P-D of FT:mat_peptide EU594408_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594409_HBe_P-D Product feature CHAIN EU594409_HBe_P-D of FT:mat_peptide EU594409_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594410_HBe_P-D Product feature CHAIN EU594410_HBe_P-D of FT:mat_peptide EU594410_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594411_HBe_P-D Product feature CHAIN EU594411_HBe_P-D of FT:mat_peptide EU594411_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594412_HBe_P-D Product feature CHAIN EU594412_HBe_P-D of FT:mat_peptide EU594412_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594415_HBe_P-D Product feature CHAIN EU594415_HBe_P-D of FT:mat_peptide EU594415_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594416_HBe_P-D Product feature CHAIN EU594416_HBe_P-D of FT:mat_peptide EU594416_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594421_HBe_P-D Product feature CHAIN EU594421_HBe_P-D of FT:mat_peptide EU594421_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594422_HBe_P-D Product feature CHAIN EU594422_HBe_P-D of FT:mat_peptide EU594422_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594423_HBe_P-D Product feature CHAIN EU594423_HBe_P-D of FT:mat_peptide EU594423_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594424_HBe_P-D Product feature CHAIN EU594424_HBe_P-D of FT:mat_peptide EU594424_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594425_HBe_P-D Product feature CHAIN EU594425_HBe_P-D of FT:mat_peptide EU594425_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594427_HBe_P-D Product feature CHAIN EU594427_HBe_P-D of FT:mat_peptide EU594427_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594428_HBe_P-D Product feature CHAIN EU594428_HBe_P-D of FT:mat_peptide EU594428_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594430_HBe_P-D Product feature CHAIN EU594430_HBe_P-D of FT:mat_peptide EU594430_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594431_HBe_P-D Product feature CHAIN EU594431_HBe_P-D of FT:mat_peptide EU594431_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594432_HBe_P-D Product feature CHAIN EU594432_HBe_P-D of FT:mat_peptide EU594432_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594433_HBe_P-D Product feature CHAIN EU594433_HBe_P-D of FT:mat_peptide EU594433_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU594434_HBe_P-D Product feature CHAIN EU594434_HBe_P-D of FT:mat_peptide EU594434_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLDDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726844_HBe_P-D Product feature CHAIN EU726844_HBe_P-D of FT:mat_peptide EU726844_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3556). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726845_HBe_P-D Product feature CHAIN EU726845_HBe_P-D of FT:mat_peptide EU726845_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7061). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLENPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726854_HBe_P-D Product feature CHAIN EU726854_HBe_P-D of FT:mat_peptide EU726854_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3173). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726855_HBe_P-D Product feature CHAIN EU726855_HBe_P-D of FT:mat_peptide EU726855_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7179). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLINLST
WVGGNLEDQTSRDLIVNYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQPYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726860_HBe_P-D Product feature CHAIN EU726860_HBe_P-D of FT:mat_peptide EU726860_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3172). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|EU726861_HBe_P-D Product feature CHAIN EU726861_HBe_P-D of FT:mat_peptide EU726861_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7181). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILWWGELMTLAT
WVGDNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVWIRTPPDYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726862_HBe_P-D Product feature CHAIN EU726862_HBe_P-D of FT:mat_peptide EU726862_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7178). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726865_HBe_P-D Product feature CHAIN EU726865_HBe_P-D of FT:mat_peptide EU726865_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7474). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|EU726869_HBe_P-D Product feature CHAIN EU726869_HBe_P-D of FT:mat_peptide EU726869_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3886). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726874_HBe_P-D Product feature CHAIN EU726874_HBe_P-D of FT:mat_peptide EU726874_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7185). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726876_HBe_P-D Product feature CHAIN EU726876_HBe_P-D of FT:mat_peptide EU726876_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7054). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726878_HBe_P-D Product feature CHAIN EU726878_HBe_P-D of FT:mat_peptide EU726878_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4955). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726879_HBe_P-D Product feature CHAIN EU726879_HBe_P-D of FT:mat_peptide EU726879_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7180). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726887_HBe_P-D Product feature CHAIN EU726887_HBe_P-D of FT:mat_peptide EU726887_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4652). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726888_HBe_P-D Product feature CHAIN EU726888_HBe_P-D of FT:mat_peptide EU726888_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-N001). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726894_HBe_P-D Product feature CHAIN EU726894_HBe_P-D of FT:mat_peptide EU726894_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3171). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLLLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726895_HBe_P-D Product feature CHAIN EU726895_HBe_P-D of FT:mat_peptide EU726895_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-6021). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726898_HBe_P-D Product feature CHAIN EU726898_HBe_P-D of FT:mat_peptide EU726898_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4765). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726899_HBe_P-D Product feature CHAIN EU726899_HBe_P-D of FT:mat_peptide EU726899_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-0.02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726900_HBe_P-D Product feature CHAIN EU726900_HBe_P-D of FT:mat_peptide EU726900_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7132). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726901_HBe_P-D Product feature CHAIN EU726901_HBe_P-D of FT:mat_peptide EU726901_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-5779). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLDDPTSRDLVVSYVNTHMGLKFRQLLWFHVSCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
CRGR
>gnl|hbvpro|EU726902_HBe_P-D Product feature CHAIN EU726902_HBe_P-D of FT:mat_peptide EU726902_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-7145). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726907_HBe_P-D Product feature CHAIN EU726907_HBe_P-D of FT:mat_peptide EU726907_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3861). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726909_HBe_P-D Product feature CHAIN EU726909_HBe_P-D of FT:mat_peptide EU726909_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-4653). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726914_HBe_P-D Product feature CHAIN EU726914_HBe_P-D of FT:mat_peptide EU726914_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3865). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726918_HBe_P-D Product feature CHAIN EU726918_HBe_P-D of FT:mat_peptide EU726918_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-2336). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726919_HBe_P-D Product feature CHAIN EU726919_HBe_P-D of FT:mat_peptide EU726919_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-0.08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726923_HBe_P-D Product feature CHAIN EU726923_HBe_P-D of FT:mat_peptide EU726923_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L025). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726924_HBe_P-D Product feature CHAIN EU726924_HBe_P-D of FT:mat_peptide EU726924_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L002). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726930_HBe_P-D Product feature CHAIN EU726930_HBe_P-D of FT:mat_peptide EU726930_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726931_HBe_P-D Product feature CHAIN EU726931_HBe_P-D of FT:mat_peptide EU726931_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-9954). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726935_HBe_P-D Product feature CHAIN EU726935_HBe_P-D of FT:mat_peptide EU726935_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L020). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726940_HBe_P-D Product feature CHAIN EU726940_HBe_P-D of FT:mat_peptide EU726940_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L016). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726958_HBe_P-D Product feature CHAIN EU726958_HBe_P-D of FT:mat_peptide EU726958_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8111). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLAFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726959_HBe_P-D Product feature CHAIN EU726959_HBe_P-D of FT:mat_peptide EU726959_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8108). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726960_HBe_P-D Product feature CHAIN EU726960_HBe_P-D of FT:mat_peptide EU726960_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8122). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726962_HBe_P-D Product feature CHAIN EU726962_HBe_P-D of FT:mat_peptide EU726962_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8115). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726964_HBe_P-D Product feature CHAIN EU726964_HBe_P-D of FT:mat_peptide EU726964_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8118). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726967_HBe_P-D Product feature CHAIN EU726967_HBe_P-D of FT:mat_peptide EU726967_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-3257). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726971_HBe_P-D Product feature CHAIN EU726971_HBe_P-D of FT:mat_peptide EU726971_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-8142). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726972_HBe_P-D Product feature CHAIN EU726972_HBe_P-D of FT:mat_peptide EU726972_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-9550). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU726976_HBe_P-D Product feature CHAIN EU726976_HBe_P-D of FT:mat_peptide EU726976_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IR-RCGLD-L029). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU787436_HBe_P-D Product feature CHAIN EU787436_HBe_P-D of FT:mat_peptide EU787436_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 165). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGSNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU787437_HBe_P-D Product feature CHAIN EU787437_HBe_P-D of FT:mat_peptide EU787437_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 17). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU787439_HBe_P-D Product feature CHAIN EU787439_HBe_P-D of FT:mat_peptide EU787439_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 89). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WGGGNLEDPISRDLIVSYVNTNMGLKFKQLLGFHISCLTFGRKTVIEYLVSFGVWIPTPPAYKPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|EU787440_HBe_P-D Product feature CHAIN EU787440_HBe_P-D of FT:mat_peptide EU787440_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W17). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU787441_HBe_P-D Product feature CHAIN EU787441_HBe_P-D of FT:mat_peptide EU787441_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W32). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU787442_HBe_P-D Product feature CHAIN EU787442_HBe_P-D of FT:mat_peptide EU787442_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W37). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU787445_HBe_P-D Product feature CHAIN EU787445_HBe_P-D of FT:mat_peptide EU787445_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W51). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU787446_HBe_P-D Product feature CHAIN EU787446_HBe_P-D of FT:mat_peptide EU787446_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W75). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU787447_HBe_P-D Product feature CHAIN EU787447_HBe_P-D of FT:mat_peptide EU787447_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate W46). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU919197_HBe_P-D Product feature CHAIN EU919197_HBe_P-D of FT:mat_peptide EU919197_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJU). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPCKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU939681_HBe_P-D Product feature CHAIN EU939681_HBe_P-D of FT:mat_peptide EU939681_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAFRPQNAPILSTLPETTVVR
RRSR
>gnl|hbvpro|FJ040872_HBe_P-D Product feature CHAIN FJ040872_HBe_P-D of FT:mat_peptide FJ040872_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ349205_HBe_P-D Product feature CHAIN FJ349205_HBe_P-D of FT:mat_peptide FJ349205_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H5). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ349208_HBe_P-D Product feature CHAIN FJ349208_HBe_P-D of FT:mat_peptide FJ349208_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H25). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQACLCWGELMTLAT
WVGANLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ349216_HBe_P-D Product feature CHAIN FJ349216_HBe_P-D of FT:mat_peptide FJ349216_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H113). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ349217_HBe_P-D Product feature CHAIN FJ349217_HBe_P-D of FT:mat_peptide FJ349217_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H129). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ349218_HBe_P-D Product feature CHAIN FJ349218_HBe_P-D of FT:mat_peptide FJ349218_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H135). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ349228_HBe_P-D Product feature CHAIN FJ349228_HBe_P-D of FT:mat_peptide FJ349228_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ349229_HBe_P-D Product feature CHAIN FJ349229_HBe_P-D of FT:mat_peptide FJ349229_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C26). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ349232_HBe_P-D Product feature CHAIN FJ349232_HBe_P-D of FT:mat_peptide FJ349232_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C51). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ349234_HBe_P-D Product feature CHAIN FJ349234_HBe_P-D of FT:mat_peptide FJ349234_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C82). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRGR
>gnl|hbvpro|FJ386590_HBe_P-D Product feature CHAIN FJ386590_HBe_P-D of FT:mat_peptide FJ386590_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1841). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ692506_HBe_P-D Product feature CHAIN FJ692506_HBe_P-D of FT:mat_peptide FJ692506_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50157). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ692507_HBe_P-D Product feature CHAIN FJ692507_HBe_P-D of FT:mat_peptide FJ692507_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_50158). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ692532_HBe_P-D Product feature CHAIN FJ692532_HBe_P-D of FT:mat_peptide FJ692532_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50053). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ692533_HBe_P-D Product feature CHAIN FJ692533_HBe_P-D of FT:mat_peptide FJ692533_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D4_50064). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867964_HBe_P-D Product feature CHAIN FJ867964_HBe_P-D of FT:mat_peptide FJ867964_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867966_HBe_P-D Product feature CHAIN FJ867966_HBe_P-D of FT:mat_peptide FJ867966_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867970_HBe_P-D Product feature CHAIN FJ867970_HBe_P-D of FT:mat_peptide FJ867970_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867973_HBe_P-D Product feature CHAIN FJ867973_HBe_P-D of FT:mat_peptide FJ867973_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867974_HBe_P-D Product feature CHAIN FJ867974_HBe_P-D of FT:mat_peptide FJ867974_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC63). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867975_HBe_P-D Product feature CHAIN FJ867975_HBe_P-D of FT:mat_peptide FJ867975_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC72). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867979_HBe_P-D Product feature CHAIN FJ867979_HBe_P-D of FT:mat_peptide FJ867979_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC89). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867981_HBe_P-D Product feature CHAIN FJ867981_HBe_P-D of FT:mat_peptide FJ867981_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC92). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867983_HBe_P-D Product feature CHAIN FJ867983_HBe_P-D of FT:mat_peptide FJ867983_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC115). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867984_HBe_P-D Product feature CHAIN FJ867984_HBe_P-D of FT:mat_peptide FJ867984_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HCCNPC139). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867996_HBe_P-D Product feature CHAIN FJ867996_HBe_P-D of FT:mat_peptide FJ867996_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LCNPC21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ867998_HBe_P-D Product feature CHAIN FJ867998_HBe_P-D of FT:mat_peptide FJ867998_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LCNPC48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVR
RRGR
>gnl|hbvpro|FJ867999_HBe_P-D Product feature CHAIN FJ867999_HBe_P-D of FT:mat_peptide FJ867999_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LCNPC65). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ868004_HBe_P-D Product feature CHAIN FJ868004_HBe_P-D of FT:mat_peptide FJ868004_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHMPC32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ868009_HBe_P-D Product feature CHAIN FJ868009_HBe_P-D of FT:mat_peptide FJ868009_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNPC26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ868011_HBe_P-D Product feature CHAIN FJ868011_HBe_P-D of FT:mat_peptide FJ868011_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CHNPC69). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPYDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ899792_HBe_P-D Product feature CHAIN FJ899792_HBe_P-D of FT:mat_peptide FJ899792_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D146-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNMEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRAPPAFRPQNAPILSTLPETTVVR
RRSR
>gnl|hbvpro|FJ904402_HBe_P-D Product feature CHAIN FJ904402_HBe_P-D of FT:mat_peptide FJ904402_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate A26). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ904432_HBe_P-D Product feature CHAIN FJ904432_HBe_P-D of FT:mat_peptide FJ904432_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B14). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ904433_HBe_C-D Product feature CHAIN FJ904433_HBe_C-D of FT:mat_peptide FJ904433_HBe_C-D of [Viruses] Hepatitis B Virus genotype D (isolate B15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVNYVNSNMGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPPYRPTNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ904435_HBe_P-D Product feature CHAIN FJ904435_HBe_P-D of FT:mat_peptide FJ904435_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B27). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPFDFFPSVRDFLDSALALYRDSLEFPEPCSPPHXALRPTLFCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GRGR
>gnl|hbvpro|FJ904443_HBe_P-D Product feature CHAIN FJ904443_HBe_P-D of FT:mat_peptide FJ904443_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B46). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ904446_HBe_P-D Product feature CHAIN FJ904446_HBe_P-D of FT:mat_peptide FJ904446_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B64a). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183471_HBe_P-D Product feature CHAIN GQ183471_HBe_P-D of FT:mat_peptide GQ183471_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4610). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183473_HBe_P-D Product feature CHAIN GQ183473_HBe_P-D of FT:mat_peptide GQ183473_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4601). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183474_HBe_P-D Product feature CHAIN GQ183474_HBe_P-D of FT:mat_peptide GQ183474_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4594). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183475_HBe_P-D Product feature CHAIN GQ183475_HBe_P-D of FT:mat_peptide GQ183475_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4575). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVHTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183476_HBe_P-D Product feature CHAIN GQ183476_HBe_P-D of FT:mat_peptide GQ183476_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4603). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183477_HBe_P-D Product feature CHAIN GQ183477_HBe_P-D of FT:mat_peptide GQ183477_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4604). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183478_HBe_P-D Product feature CHAIN GQ183478_HBe_P-D of FT:mat_peptide GQ183478_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4605). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183479_HBe_P-D Product feature CHAIN GQ183479_HBe_P-D of FT:mat_peptide GQ183479_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4607). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183480_HBe_P-D Product feature CHAIN GQ183480_HBe_P-D of FT:mat_peptide GQ183480_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4609). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183481_HBe_P-D Product feature CHAIN GQ183481_HBe_P-D of FT:mat_peptide GQ183481_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4569). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183482_HBe_P-D Product feature CHAIN GQ183482_HBe_P-D of FT:mat_peptide GQ183482_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4570). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183483_HBe_P-D Product feature CHAIN GQ183483_HBe_P-D of FT:mat_peptide GQ183483_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4566). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ183484_HBe_P-D Product feature CHAIN GQ183484_HBe_P-D of FT:mat_peptide GQ183484_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MOD_4598). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ184322_HBe_P-D Product feature CHAIN GQ184322_HBe_P-D of FT:mat_peptide GQ184322_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGM4522). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLKDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVTYVNTNMGIKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ205380_HBe_P-D Product feature CHAIN GQ205380_HBe_P-D of FT:mat_peptide GQ205380_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1245). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ205382_HBe_P-D Product feature CHAIN GQ205382_HBe_P-D of FT:mat_peptide GQ205382_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1360d). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ205384_HBe_P-D Product feature CHAIN GQ205384_HBe_P-D of FT:mat_peptide GQ205384_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1434d). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ205385_HBe_P-D Product feature CHAIN GQ205385_HBe_P-D of FT:mat_peptide GQ205385_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1469). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAFRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ205388_HBe_P-D Product feature CHAIN GQ205388_HBe_P-D of FT:mat_peptide GQ205388_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1562). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ205389_HBe_P-D Product feature CHAIN GQ205389_HBe_P-D of FT:mat_peptide GQ205389_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1667). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377589_HBe_P-D Product feature CHAIN GQ377589_HBe_P-D of FT:mat_peptide GQ377589_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate J145). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ477456_HBe_P-D Product feature CHAIN GQ477456_HBe_P-D of FT:mat_peptide GQ477456_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P84). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPTVRDLLDTASALYREALESPEHVSAHHTALRQAILCWGDLMTLAT
WVGANLDDPQSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
GRGR
>gnl|hbvpro|GQ477457_HBe_P-D Product feature CHAIN GQ477457_HBe_P-D of FT:mat_peptide GQ477457_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P118). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|GQ477459_HBe_P-D Product feature CHAIN GQ477459_HBe_P-D of FT:mat_peptide GQ477459_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P127). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ922001_HBe_P-D Product feature CHAIN GQ922001_HBe_P-D of FT:mat_peptide GQ922001_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2B3654). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|GQ922002_HBe_P-D Product feature CHAIN GQ922002_HBe_P-D of FT:mat_peptide GQ922002_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1B3624). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU357846_HBe_P-D Product feature CHAIN GU357846_HBe_P-D of FT:mat_peptide GU357846_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Y10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU456636_HBe_P-D Product feature CHAIN GU456636_HBe_P-D of FT:mat_peptide GU456636_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|GU456649_HBe_P-D Product feature CHAIN GU456649_HBe_P-D of FT:mat_peptide GU456649_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T57). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU456650_HBe_P-D Product feature CHAIN GU456650_HBe_P-D of FT:mat_peptide GU456650_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T62). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDLDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAFLCWGELMNLAT
WVGGNLEDPTSRDLIVSYVNTNMGLKFRQLLWFHISCLNFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU456671_HBe_P-D Product feature CHAIN GU456671_HBe_P-D of FT:mat_peptide GU456671_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T56). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVNYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU456684_HBe_P-D Product feature CHAIN GU456684_HBe_P-D of FT:mat_peptide GU456684_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate I_T60). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMSLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|HM214720_HBe_P-D Product feature CHAIN HM214720_HBe_P-D of FT:mat_peptide HM214720_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BA47). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVR
RRG
>gnl|hbvpro|HM750151_HBe_P-D Product feature CHAIN HM750151_HBe_P-D of FT:mat_peptide HM750151_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSD-8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HM750152_HBe_P-D Product feature CHAIN HM750152_HBe_P-D of FT:mat_peptide HM750152_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate QHN-99). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HM750153_HBe_P-D Product feature CHAIN HM750153_HBe_P-D of FT:mat_peptide HM750153_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XJW-12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HM750154_HBe_P-D Product feature CHAIN HM750154_HBe_P-D of FT:mat_peptide HM750154_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate XGW-23). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HM750155_HBe_P-D Product feature CHAIN HM750155_HBe_P-D of FT:mat_peptide HM750155_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCLGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HM750156_HBe_P-D Product feature CHAIN HM750156_HBe_P-D of FT:mat_peptide HM750156_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate GSF-12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ236014_HBe_P-D Product feature CHAIN HQ236014_HBe_P-D of FT:mat_peptide HQ236014_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ236016_HBe_P-D Product feature CHAIN HQ236016_HBe_P-D of FT:mat_peptide HQ236016_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RS3). Complete genome. [Hepadnaviridae] (length=164 residues).
SRLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ257269_HBe_P-D Product feature CHAIN HQ257269_HBe_P-D of FT:mat_peptide HQ257269_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MS44-HBM-PC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ641710_HBe_P-D Product feature CHAIN HQ641710_HBe_P-D of FT:mat_peptide HQ641710_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVR
RRGR
>gnl|hbvpro|HQ700440_HBe_P-D Product feature CHAIN HQ700440_HBe_P-D of FT:mat_peptide HQ700440_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AD05_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700441_HBe_P-D Product feature CHAIN HQ700441_HBe_P-D of FT:mat_peptide HQ700441_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN10_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700442_HBe_P-D Product feature CHAIN HQ700442_HBe_P-D of FT:mat_peptide HQ700442_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700443_HBe_P-D Product feature CHAIN HQ700443_HBe_P-D of FT:mat_peptide HQ700443_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN12_1999). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700444_HBe_P-D Product feature CHAIN HQ700444_HBe_P-D of FT:mat_peptide HQ700444_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_AN19_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700445_HBe_P-D Product feature CHAIN HQ700445_HBe_P-D of FT:mat_peptide HQ700445_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700446_HBe_P-D Product feature CHAIN HQ700446_HBe_P-D of FT:mat_peptide HQ700446_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_BU12_1999). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700447_HBe_P-D Product feature CHAIN HQ700447_HBe_P-D of FT:mat_peptide HQ700447_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700448_HBe_P-D Product feature CHAIN HQ700448_HBe_P-D of FT:mat_peptide HQ700448_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_CH02_1999). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXLMTLAT
WVGGNLEDPXSRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700449_HBe_P-D Product feature CHAIN HQ700449_HBe_P-D of FT:mat_peptide HQ700449_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE06_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700450_HBe_P-D Product feature CHAIN HQ700450_HBe_P-D of FT:mat_peptide HQ700450_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GE09_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700451_HBe_P-D Product feature CHAIN HQ700451_HBe_P-D of FT:mat_peptide HQ700451_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_GI11_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700454_HBe_P-D Product feature CHAIN HQ700454_HBe_P-D of FT:mat_peptide HQ700454_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700455_HBe_P-D Product feature CHAIN HQ700455_HBe_P-D of FT:mat_peptide HQ700455_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HA53_1999). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRXLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700459_HBe_P-D Product feature CHAIN HQ700459_HBe_P-D of FT:mat_peptide HQ700459_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_HE55_1993). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700464_HBe_P-D Product feature CHAIN HQ700464_HBe_P-D of FT:mat_peptide HQ700464_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_KA40_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700466_HBe_P-D Product feature CHAIN HQ700466_HBe_P-D of FT:mat_peptide HQ700466_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI26_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700467_HBe_P-D Product feature CHAIN HQ700467_HBe_P-D of FT:mat_peptide HQ700467_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI26_1999). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSAHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700468_HBe_P-D Product feature CHAIN HQ700468_HBe_P-D of FT:mat_peptide HQ700468_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MI27_1984). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700469_HBe_P-D Product feature CHAIN HQ700469_HBe_P-D of FT:mat_peptide HQ700469_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700470_HBe_P-D Product feature CHAIN HQ700470_HBe_P-D of FT:mat_peptide HQ700470_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO59_1999). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700471_HBe_P-D Product feature CHAIN HQ700471_HBe_P-D of FT:mat_peptide HQ700471_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_MO70_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700473_HBe_P-D Product feature CHAIN HQ700473_HBe_P-D of FT:mat_peptide HQ700473_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700474_HBe_P-D Product feature CHAIN HQ700474_HBe_P-D of FT:mat_peptide HQ700474_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PA31_1999). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSSLPETCVIR
RRGR
>gnl|hbvpro|HQ700477_HBe_P-D Product feature CHAIN HQ700477_HBe_P-D of FT:mat_peptide HQ700477_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_PE09_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXLMTLAT
WVGGNLEDPISRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700479_HBe_P-D Product feature CHAIN HQ700479_HBe_P-D of FT:mat_peptide HQ700479_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA11_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700480_HBe_P-D Product feature CHAIN HQ700480_HBe_P-D of FT:mat_peptide HQ700480_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_RA37_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700482_HBe_P-D Product feature CHAIN HQ700482_HBe_P-D of FT:mat_peptide HQ700482_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA40_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700483_HBe_P-D Product feature CHAIN HQ700483_HBe_P-D of FT:mat_peptide HQ700483_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA120_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700484_HBe_P-D Product feature CHAIN HQ700484_HBe_P-D of FT:mat_peptide HQ700484_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TA229_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700487_HBe_P-D Product feature CHAIN HQ700487_HBe_P-D of FT:mat_peptide HQ700487_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_TU25_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700488_HBe_P-D Product feature CHAIN HQ700488_HBe_P-D of FT:mat_peptide HQ700488_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_WA13_1984). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700489_HBe_P-D Product feature CHAIN HQ700489_HBe_P-D of FT:mat_peptide HQ700489_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NZL_WA13_1999). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700511_HBe_P-D Product feature CHAIN HQ700511_HBe_P-D of FT:mat_peptide HQ700511_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_164317_2001). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700512_HBe_P-D Product feature CHAIN HQ700512_HBe_P-D of FT:mat_peptide HQ700512_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_182089_2001). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700513_HBe_P-D Product feature CHAIN HQ700513_HBe_P-D of FT:mat_peptide HQ700513_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_16600_2001). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ700514_HBe_P-D Product feature CHAIN HQ700514_HBe_P-D of FT:mat_peptide HQ700514_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D_NC_1664337_2001). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ833465_HBe_P-D Product feature CHAIN HQ833465_HBe_P-D of FT:mat_peptide HQ833465_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB6). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ833467_HBe_P-D Product feature CHAIN HQ833467_HBe_P-D of FT:mat_peptide HQ833467_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB27). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ833469_HBe_P-D Product feature CHAIN HQ833469_HBe_P-D of FT:mat_peptide HQ833469_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB79). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ833470_HBe_P-D Product feature CHAIN HQ833470_HBe_P-D of FT:mat_peptide HQ833470_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB80). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|HQ833471_HBe_P-D Product feature CHAIN HQ833471_HBe_P-D of FT:mat_peptide HQ833471_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Xinjiang HB97). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JF439692_HBe_P-D Product feature CHAIN JF439692_HBe_P-D of FT:mat_peptide JF439692_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN132). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNRGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVR
RRGR
>gnl|hbvpro|JF439695_HBe_P-D Product feature CHAIN JF439695_HBe_P-D of FT:mat_peptide JF439695_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN135). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|JF439696_HBe_P-D Product feature CHAIN JF439696_HBe_P-D of FT:mat_peptide JF439696_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNRGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVR
RRGR
>gnl|hbvpro|JF439699_HBe_P-D Product feature CHAIN JF439699_HBe_P-D of FT:mat_peptide JF439699_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNRGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVR
RRGR
>gnl|hbvpro|JF439700_HBe_P-D Product feature CHAIN JF439700_HBe_P-D of FT:mat_peptide JF439700_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN143). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNRGLKFRQLLWLHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASTLSTLPETTVVR
RRGR
>gnl|hbvpro|JF439701_HBe_P-D Product feature CHAIN JF439701_HBe_P-D of FT:mat_peptide JF439701_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN144). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNRGLKFRQLLWLHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASTLSTLPETTVVR
RRGR
>gnl|hbvpro|JF439703_HBe_P-D Product feature CHAIN JF439703_HBe_P-D of FT:mat_peptide JF439703_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN146). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNRGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVR
RRGR
>gnl|hbvpro|JF439704_HBe_P-D Product feature CHAIN JF439704_HBe_P-D of FT:mat_peptide JF439704_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN149). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPTLSTLPETCVVR
RRGR
>gnl|hbvpro|JF439705_HBe_P-D Product feature CHAIN JF439705_HBe_P-D of FT:mat_peptide JF439705_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN150). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPTLSTLPETCVVR
RRGR
>gnl|hbvpro|JF439712_HBe_P-D Product feature CHAIN JF439712_HBe_P-D of FT:mat_peptide JF439712_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN158). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JF439718_HBe_P-D Product feature CHAIN JF439718_HBe_P-D of FT:mat_peptide JF439718_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FEN167). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVSTNRGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNASILSTLPETTVVR
RRGR
>gnl|hbvpro|JF754591_HBe_P-D Product feature CHAIN JF754591_HBe_P-D of FT:mat_peptide JF754591_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK38). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JF754601_HBe_P-D Product feature CHAIN JF754601_HBe_P-D of FT:mat_peptide JF754601_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK88). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JF754602_HBe_P-D Product feature CHAIN JF754602_HBe_P-D of FT:mat_peptide JF754602_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK83). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETAVVR
PRGR
>gnl|hbvpro|JF754608_HBe_P-D Product feature CHAIN JF754608_HBe_P-D of FT:mat_peptide JF754608_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK63). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JF754618_HBe_P-D Product feature CHAIN JF754618_HBe_P-D of FT:mat_peptide JF754618_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK129). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JF754624_HBe_P-D Product feature CHAIN JF754624_HBe_P-D of FT:mat_peptide JF754624_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JF754625_HBe_P-D Product feature CHAIN JF754625_HBe_P-D of FT:mat_peptide JF754625_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK25). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTAKALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLDDQGSREQVVSYVNTNMGLKFRQILWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
QRRR
>gnl|hbvpro|JF754628_HBe_P-D Product feature CHAIN JF754628_HBe_P-D of FT:mat_peptide JF754628_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK32). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JF754629_HBe_P-D Product feature CHAIN JF754629_HBe_P-D of FT:mat_peptide JF754629_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK176). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESHEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVNYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JF754635_HBe_P-D Product feature CHAIN JF754635_HBe_P-D of FT:mat_peptide JF754635_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TK113). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALFRQALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040752_HBe_P-D Product feature CHAIN JN040752_HBe_P-D of FT:mat_peptide JN040752_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919033). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVR
RRGR
>gnl|hbvpro|JN040756_HBe_P-D Product feature CHAIN JN040756_HBe_P-D of FT:mat_peptide JN040756_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919039). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040758_HBe_P-D Product feature CHAIN JN040758_HBe_P-D of FT:mat_peptide JN040758_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919037). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040759_HBe_P-D Product feature CHAIN JN040759_HBe_P-D of FT:mat_peptide JN040759_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919063). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040771_HBe_P-D Product feature CHAIN JN040771_HBe_P-D of FT:mat_peptide JN040771_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919013). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMSLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLISFGVWMRTPPAYRPPNAPILSTLPETSVIR
RRGR
>gnl|hbvpro|JN040780_HBe_P-D Product feature CHAIN JN040780_HBe_P-D of FT:mat_peptide JN040780_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919072). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVQLLSFLPVDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAIICWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040785_HBe_P-D Product feature CHAIN JN040785_HBe_P-D of FT:mat_peptide JN040785_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919022). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|JN040786_HBe_P-D Product feature CHAIN JN040786_HBe_P-D of FT:mat_peptide JN040786_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919035). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040788_HBe_P-D Product feature CHAIN JN040788_HBe_P-D of FT:mat_peptide JN040788_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919024). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040790_HBe_P-D Product feature CHAIN JN040790_HBe_P-D of FT:mat_peptide JN040790_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919054). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040791_HBe_P-D Product feature CHAIN JN040791_HBe_P-D of FT:mat_peptide JN040791_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919082). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNSNMGLKFRQLLWFHLSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|JN040792_HBe_P-D Product feature CHAIN JN040792_HBe_P-D of FT:mat_peptide JN040792_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919079). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGKLEDPISRDLVVSYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|JN040793_HBe_P-D Product feature CHAIN JN040793_HBe_P-D of FT:mat_peptide JN040793_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919083). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|JN040794_HBe_P-D Product feature CHAIN JN040794_HBe_P-D of FT:mat_peptide JN040794_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919075). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040795_HBe_P-D Product feature CHAIN JN040795_HBe_P-D of FT:mat_peptide JN040795_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919003). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALFREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040796_HBe_P-D Product feature CHAIN JN040796_HBe_P-D of FT:mat_peptide JN040796_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919018). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKELGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVR
RRGR
>gnl|hbvpro|JN040797_HBe_P-D Product feature CHAIN JN040797_HBe_P-D of FT:mat_peptide JN040797_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919021). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|JN040805_HBe_P-D Product feature CHAIN JN040805_HBe_P-D of FT:mat_peptide JN040805_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919058). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040806_HBe_P-D Product feature CHAIN JN040806_HBe_P-D of FT:mat_peptide JN040806_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919066). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDR
>gnl|hbvpro|JN040807_HBe_P-D Product feature CHAIN JN040807_HBe_P-D of FT:mat_peptide JN040807_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919034). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040808_HBe_P-D Product feature CHAIN JN040808_HBe_P-D of FT:mat_peptide JN040808_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919011). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040813_HBe_P-D Product feature CHAIN JN040813_HBe_P-D of FT:mat_peptide JN040813_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919025). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGGFWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040814_HBe_P-D Product feature CHAIN JN040814_HBe_P-D of FT:mat_peptide JN040814_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919032). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040815_HBe_P-D Product feature CHAIN JN040815_HBe_P-D of FT:mat_peptide JN040815_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919073). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040816_HBe_P-D Product feature CHAIN JN040816_HBe_P-D of FT:mat_peptide JN040816_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919016). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040817_HBe_P-D Product feature CHAIN JN040817_HBe_P-D of FT:mat_peptide JN040817_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919020). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040820_HBe_P-D Product feature CHAIN JN040820_HBe_P-D of FT:mat_peptide JN040820_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919010). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGAAVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040821_HBe_P-D Product feature CHAIN JN040821_HBe_P-D of FT:mat_peptide JN040821_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919085). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGGNLQDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040822_HBe_P-D Product feature CHAIN JN040822_HBe_P-D of FT:mat_peptide JN040822_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919044). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLDDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040824_HBe_P-D Product feature CHAIN JN040824_HBe_P-D of FT:mat_peptide JN040824_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919071). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN040826_HBe_P-D Product feature CHAIN JN040826_HBe_P-D of FT:mat_peptide JN040826_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 919055). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN132126_HBe_P-D Product feature CHAIN JN132126_HBe_P-D of FT:mat_peptide JN132126_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-7642). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN132127_HBe_P-D Product feature CHAIN JN132127_HBe_P-D of FT:mat_peptide JN132127_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5204). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVR
RRGR
>gnl|hbvpro|JN132128_HBe_P-D Product feature CHAIN JN132128_HBe_P-D of FT:mat_peptide JN132128_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5256). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPGTTVVR
RRGR
>gnl|hbvpro|JN132130_HBe_P-D Product feature CHAIN JN132130_HBe_P-D of FT:mat_peptide JN132130_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5314). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN132131_HBe_P-D Product feature CHAIN JN132131_HBe_P-D of FT:mat_peptide JN132131_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5255). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGGETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN132132_HBe_P-D Product feature CHAIN JN132132_HBe_P-D of FT:mat_peptide JN132132_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-7974). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257148_HBe_P-D Product feature CHAIN JN257148_HBe_P-D of FT:mat_peptide JN257148_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMF). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|JN257149_HBe_P-D Product feature CHAIN JN257149_HBe_P-D of FT:mat_peptide JN257149_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSFN). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRXLLDTASALYREALESPEHCSPHHTALRQAILCWGXLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257150_HBe_P-D Product feature CHAIN JN257150_HBe_P-D of FT:mat_peptide JN257150_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABS). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257151_HBe_P-D Product feature CHAIN JN257151_HBe_P-D of FT:mat_peptide JN257151_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHHR). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257152_HBe_P-D Product feature CHAIN JN257152_HBe_P-D of FT:mat_peptide JN257152_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRJB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXLXTLXT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257155_HBe_P-D Product feature CHAIN JN257155_HBe_P-D of FT:mat_peptide JN257155_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJHM1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257165_HBe_P-D Product feature CHAIN JN257165_HBe_P-D of FT:mat_peptide JN257165_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDIVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVLR
RRGR
>gnl|hbvpro|JN257166_HBe_P-D Product feature CHAIN JN257166_HBe_P-D of FT:mat_peptide JN257166_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHHLL2). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRDIVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVLR
RRGR
>gnl|hbvpro|JN257171_HBe_P-D Product feature CHAIN JN257171_HBe_P-D of FT:mat_peptide JN257171_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHKML). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257179_HBe_P-D Product feature CHAIN JN257179_HBe_P-D of FT:mat_peptide JN257179_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMJD1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257181_HBe_P-D Product feature CHAIN JN257181_HBe_P-D of FT:mat_peptide JN257181_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHNDA). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257182_HBe_P-D Product feature CHAIN JN257182_HBe_P-D of FT:mat_peptide JN257182_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMSL). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257185_HBe_P-D Product feature CHAIN JN257185_HBe_P-D of FT:mat_peptide JN257185_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHZYD). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257186_HBe_P-D Product feature CHAIN JN257186_HBe_P-D of FT:mat_peptide JN257186_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHDHM). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVR
RRGR
>gnl|hbvpro|JN257187_HBe_P-D Product feature CHAIN JN257187_HBe_P-D of FT:mat_peptide JN257187_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL1). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257188_HBe_P-D Product feature CHAIN JN257188_HBe_P-D of FT:mat_peptide JN257188_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHMLL2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVXEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257193_HBe_P-D Product feature CHAIN JN257193_HBe_P-D of FT:mat_peptide JN257193_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRKN1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257194_HBe_P-D Product feature CHAIN JN257194_HBe_P-D of FT:mat_peptide JN257194_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRKN2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257196_HBe_P-D Product feature CHAIN JN257196_HBe_P-D of FT:mat_peptide JN257196_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHABR1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257199_HBe_P-D Product feature CHAIN JN257199_HBe_P-D of FT:mat_peptide JN257199_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHSOD2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257203_HBe_P-D Product feature CHAIN JN257203_HBe_P-D of FT:mat_peptide JN257203_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHJKF). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257205_HBe_P-D Product feature CHAIN JN257205_HBe_P-D of FT:mat_peptide JN257205_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHRYD). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLDDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN257209_HBe_P-D Product feature CHAIN JN257209_HBe_P-D of FT:mat_peptide JN257209_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate WHAMR2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXLXXLXT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN558561_HBe_P-D Product feature CHAIN JN558561_HBe_P-D of FT:mat_peptide JN558561_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5077). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN558562_HBe_P-D Product feature CHAIN JN558562_HBe_P-D of FT:mat_peptide JN558562_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5283). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSSGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN558563_HBe_P-D Product feature CHAIN JN558563_HBe_P-D of FT:mat_peptide JN558563_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-8082). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN558564_HBe_P-D Product feature CHAIN JN558564_HBe_P-D of FT:mat_peptide JN558564_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN642129_HBe_P-D Product feature CHAIN JN642129_HBe_P-D of FT:mat_peptide JN642129_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSAHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
QRRR
>gnl|hbvpro|JN642131_HBe_P-D Product feature CHAIN JN642131_HBe_P-D of FT:mat_peptide JN642131_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN642138_HBe_P-D Product feature CHAIN JN642138_HBe_P-D of FT:mat_peptide JN642138_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSYHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN642155_HBe_P-D Product feature CHAIN JN642155_HBe_P-D of FT:mat_peptide JN642155_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb49). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN642166_HBe_P-D Product feature CHAIN JN642166_HBe_P-D of FT:mat_peptide JN642166_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Leb35). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664909_HBe_P-D Product feature CHAIN JN664909_HBe_P-D of FT:mat_peptide JN664909_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB36_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664910_HBe_P-D Product feature CHAIN JN664910_HBe_P-D of FT:mat_peptide JN664910_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB43_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664911_HBe_P-D Product feature CHAIN JN664911_HBe_P-D of FT:mat_peptide JN664911_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB47_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664912_HBe_P-D Product feature CHAIN JN664912_HBe_P-D of FT:mat_peptide JN664912_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB49_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664913_HBe_P-D Product feature CHAIN JN664913_HBe_P-D of FT:mat_peptide JN664913_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN01_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664914_HBe_P-D Product feature CHAIN JN664914_HBe_P-D of FT:mat_peptide JN664914_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN48_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGANLEDPSSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664917_HBe_P-D Product feature CHAIN JN664917_HBe_P-D of FT:mat_peptide JN664917_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SKR_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664918_HBe_P-D Product feature CHAIN JN664918_HBe_P-D of FT:mat_peptide JN664918_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2198_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664919_HBe_P-D Product feature CHAIN JN664919_HBe_P-D of FT:mat_peptide JN664919_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2320_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVIMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664920_HBe_P-D Product feature CHAIN JN664920_HBe_P-D of FT:mat_peptide JN664920_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T1903_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPASRELVVSYVNANMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664921_HBe_P-D Product feature CHAIN JN664921_HBe_P-D of FT:mat_peptide JN664921_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN47_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664922_HBe_P-D Product feature CHAIN JN664922_HBe_P-D of FT:mat_peptide JN664922_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DH01_IC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVTNLAT
WVGSNLEDQASRELVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664926_HBe_P-D Product feature CHAIN JN664926_HBe_P-D of FT:mat_peptide JN664926_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN63_CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664927_HBe_P-D Product feature CHAIN JN664927_HBe_P-D of FT:mat_peptide JN664927_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HE20_CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664930_HBe_P-D Product feature CHAIN JN664930_HBe_P-D of FT:mat_peptide JN664930_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HEN9_CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664931_HBe_P-D Product feature CHAIN JN664931_HBe_P-D of FT:mat_peptide JN664931_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB6_CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664932_HBe_P-D Product feature CHAIN JN664932_HBe_P-D of FT:mat_peptide JN664932_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate T2235_CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGSNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664937_HBe_P-D Product feature CHAIN JN664937_HBe_P-D of FT:mat_peptide JN664937_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN45_LC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664938_HBe_P-D Product feature CHAIN JN664938_HBe_P-D of FT:mat_peptide JN664938_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN46_LC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664947_HBe_P-D Product feature CHAIN JN664947_HBe_P-D of FT:mat_peptide JN664947_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate THB41_LC). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN664948_HBe_P-D Product feature CHAIN JN664948_HBe_P-D of FT:mat_peptide JN664948_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EN64_LC). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN687947_HBe_P-D Product feature CHAIN JN687947_HBe_P-D of FT:mat_peptide JN687947_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-3111). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVGYVNTTVGLKFRQLLWSHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN688678_HBe_P-D Product feature CHAIN JN688678_HBe_P-D of FT:mat_peptide JN688678_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV007). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGVNLEDPGSRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEIVVVR
RRGR
>gnl|hbvpro|JN688685_HBe_P-D Product feature CHAIN JN688685_HBe_P-D of FT:mat_peptide JN688685_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV097). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVTYVNTNMGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN688713_HBe_P-D Product feature CHAIN JN688713_HBe_P-D of FT:mat_peptide JN688713_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV173). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPXVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDQSSRDLVVSYVNNNMGXKFRQLLWFHISCLTFGREVVIEYLVXFGVWIRTPPAYRPPNAPILSTLPETTVVR
REGR
>gnl|hbvpro|JN697591_HBe_P-D Product feature CHAIN JN697591_HBe_P-D of FT:mat_peptide JN697591_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NCVI-5293). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSSGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN792903_HBe_P-D Product feature CHAIN JN792903_HBe_P-D of FT:mat_peptide JN792903_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 310000127). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN792907_HBe_P-D Product feature CHAIN JN792907_HBe_P-D of FT:mat_peptide JN792907_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000473). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN792909_HBe_P-D Product feature CHAIN JN792909_HBe_P-D of FT:mat_peptide JN792909_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 312000479). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JN792910_HBe_P-D Product feature CHAIN JN792910_HBe_P-D of FT:mat_peptide JN792910_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 109001205). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ038387_HBe_P-D Product feature CHAIN JQ038387_HBe_P-D of FT:mat_peptide JQ038387_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SM13). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ038389_HBe_P-D Product feature CHAIN JQ038389_HBe_P-D of FT:mat_peptide JQ038389_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SM15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ038394_HBe_P-D Product feature CHAIN JQ038394_HBe_P-D of FT:mat_peptide JQ038394_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SM20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ038407_HBe_P-D Product feature CHAIN JQ038407_HBe_P-D of FT:mat_peptide JQ038407_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SM33). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ038409_HBe_P-D Product feature CHAIN JQ038409_HBe_P-D of FT:mat_peptide JQ038409_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SM35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ038414_HBe_P-D Product feature CHAIN JQ038414_HBe_P-D of FT:mat_peptide JQ038414_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SM40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ403606_HBe_P-D Product feature CHAIN JQ403606_HBe_P-D of FT:mat_peptide JQ403606_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CE-55-1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=161 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDIVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
R
>gnl|hbvpro|JQ687530_HBe_P-D Product feature CHAIN JQ687530_HBe_P-D of FT:mat_peptide JQ687530_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Srb 200). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707476_HBe_P-D Product feature CHAIN JQ707476_HBe_P-D of FT:mat_peptide JQ707476_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707477_HBe_P-D Product feature CHAIN JQ707477_HBe_P-D of FT:mat_peptide JQ707477_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C11). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707478_HBe_P-D Product feature CHAIN JQ707478_HBe_P-D of FT:mat_peptide JQ707478_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707479_HBe_P-D Product feature CHAIN JQ707479_HBe_P-D of FT:mat_peptide JQ707479_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C13). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707480_HBe_P-D Product feature CHAIN JQ707480_HBe_P-D of FT:mat_peptide JQ707480_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C14). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707481_HBe_P-D Product feature CHAIN JQ707481_HBe_P-D of FT:mat_peptide JQ707481_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707482_HBe_P-D Product feature CHAIN JQ707482_HBe_P-D of FT:mat_peptide JQ707482_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C17-2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707483_HBe_P-D Product feature CHAIN JQ707483_HBe_P-D of FT:mat_peptide JQ707483_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C18). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707484_HBe_P-D Product feature CHAIN JQ707484_HBe_P-D of FT:mat_peptide JQ707484_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C19). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRKALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707485_HBe_P-D Product feature CHAIN JQ707485_HBe_P-D of FT:mat_peptide JQ707485_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C22). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707486_HBe_P-D Product feature CHAIN JQ707486_HBe_P-D of FT:mat_peptide JQ707486_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C24). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707487_HBe_P-D Product feature CHAIN JQ707487_HBe_P-D of FT:mat_peptide JQ707487_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C25). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707488_HBe_P-D Product feature CHAIN JQ707488_HBe_P-D of FT:mat_peptide JQ707488_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C26). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707489_HBe_P-D Product feature CHAIN JQ707489_HBe_P-D of FT:mat_peptide JQ707489_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707490_HBe_P-D Product feature CHAIN JQ707490_HBe_P-D of FT:mat_peptide JQ707490_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C29). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707491_HBe_P-D Product feature CHAIN JQ707491_HBe_P-D of FT:mat_peptide JQ707491_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C3). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|JQ707492_HBe_P-D Product feature CHAIN JQ707492_HBe_P-D of FT:mat_peptide JQ707492_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C30). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707493_HBe_P-D Product feature CHAIN JQ707493_HBe_P-D of FT:mat_peptide JQ707493_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C31). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707494_HBe_P-D Product feature CHAIN JQ707494_HBe_P-D of FT:mat_peptide JQ707494_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C32). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707495_HBe_P-D Product feature CHAIN JQ707495_HBe_P-D of FT:mat_peptide JQ707495_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C33). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707496_HBe_P-D Product feature CHAIN JQ707496_HBe_P-D of FT:mat_peptide JQ707496_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C34-2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707497_HBe_P-D Product feature CHAIN JQ707497_HBe_P-D of FT:mat_peptide JQ707497_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C36). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDRLDTTSALYREALESPEHCSPHHTALRQAILCWGELRTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTIPETTVVR
RRGR
>gnl|hbvpro|JQ707498_HBe_P-D Product feature CHAIN JQ707498_HBe_P-D of FT:mat_peptide JQ707498_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C37). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLTTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|JQ707499_HBe_P-D Product feature CHAIN JQ707499_HBe_P-D of FT:mat_peptide JQ707499_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C38). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707500_HBe_P-D Product feature CHAIN JQ707500_HBe_P-D of FT:mat_peptide JQ707500_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C40). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707501_HBe_P-D Product feature CHAIN JQ707501_HBe_P-D of FT:mat_peptide JQ707501_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C41). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETGIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707503_HBe_P-D Product feature CHAIN JQ707503_HBe_P-D of FT:mat_peptide JQ707503_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C43). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707504_HBe_P-D Product feature CHAIN JQ707504_HBe_P-D of FT:mat_peptide JQ707504_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C44). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGVNLEAPASRDLVVSYVNTDMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707505_HBe_P-D Product feature CHAIN JQ707505_HBe_P-D of FT:mat_peptide JQ707505_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C45). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707506_HBe_P-D Product feature CHAIN JQ707506_HBe_P-D of FT:mat_peptide JQ707506_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C46). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|JQ707507_HBe_P-D Product feature CHAIN JQ707507_HBe_P-D of FT:mat_peptide JQ707507_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C48). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707508_HBe_P-D Product feature CHAIN JQ707508_HBe_P-D of FT:mat_peptide JQ707508_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C6). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707509_HBe_P-D Product feature CHAIN JQ707509_HBe_P-D of FT:mat_peptide JQ707509_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C7). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLTTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPTYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|JQ707510_HBe_P-D Product feature CHAIN JQ707510_HBe_P-D of FT:mat_peptide JQ707510_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C8). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707511_HBe_P-D Product feature CHAIN JQ707511_HBe_P-D of FT:mat_peptide JQ707511_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC1_C9). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|JQ707512_HBe_P-D Product feature CHAIN JQ707512_HBe_P-D of FT:mat_peptide JQ707512_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C1-22). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707513_HBe_P-D Product feature CHAIN JQ707513_HBe_P-D of FT:mat_peptide JQ707513_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707514_HBe_P-D Product feature CHAIN JQ707514_HBe_P-D of FT:mat_peptide JQ707514_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707515_HBe_P-D Product feature CHAIN JQ707515_HBe_P-D of FT:mat_peptide JQ707515_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C13). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707516_HBe_P-D Product feature CHAIN JQ707516_HBe_P-D of FT:mat_peptide JQ707516_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707517_HBe_P-D Product feature CHAIN JQ707517_HBe_P-D of FT:mat_peptide JQ707517_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707518_HBe_P-D Product feature CHAIN JQ707518_HBe_P-D of FT:mat_peptide JQ707518_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C17-3). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707519_HBe_P-D Product feature CHAIN JQ707519_HBe_P-D of FT:mat_peptide JQ707519_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C22). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707520_HBe_P-D Product feature CHAIN JQ707520_HBe_P-D of FT:mat_peptide JQ707520_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C24). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707521_HBe_P-D Product feature CHAIN JQ707521_HBe_P-D of FT:mat_peptide JQ707521_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C32). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVSTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707522_HBe_P-D Product feature CHAIN JQ707522_HBe_P-D of FT:mat_peptide JQ707522_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C35). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707523_HBe_P-D Product feature CHAIN JQ707523_HBe_P-D of FT:mat_peptide JQ707523_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C36). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707524_HBe_P-D Product feature CHAIN JQ707524_HBe_P-D of FT:mat_peptide JQ707524_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707525_HBe_P-D Product feature CHAIN JQ707525_HBe_P-D of FT:mat_peptide JQ707525_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C40). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707526_HBe_P-D Product feature CHAIN JQ707526_HBe_P-D of FT:mat_peptide JQ707526_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C43). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707527_HBe_P-D Product feature CHAIN JQ707527_HBe_P-D of FT:mat_peptide JQ707527_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C44). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707528_HBe_P-D Product feature CHAIN JQ707528_HBe_P-D of FT:mat_peptide JQ707528_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C45). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707529_HBe_P-D Product feature CHAIN JQ707529_HBe_P-D of FT:mat_peptide JQ707529_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C46). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGINLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707530_HBe_P-D Product feature CHAIN JQ707530_HBe_P-D of FT:mat_peptide JQ707530_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PC3_C9). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707682_HBe_P-D Product feature CHAIN JQ707682_HBe_P-D of FT:mat_peptide JQ707682_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_1-10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707683_HBe_P-D Product feature CHAIN JQ707683_HBe_P-D of FT:mat_peptide JQ707683_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707684_HBe_P-D Product feature CHAIN JQ707684_HBe_P-D of FT:mat_peptide JQ707684_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707685_HBe_P-D Product feature CHAIN JQ707685_HBe_P-D of FT:mat_peptide JQ707685_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707686_HBe_P-D Product feature CHAIN JQ707686_HBe_P-D of FT:mat_peptide JQ707686_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_14). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707687_HBe_P-D Product feature CHAIN JQ707687_HBe_P-D of FT:mat_peptide JQ707687_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707688_HBe_P-D Product feature CHAIN JQ707688_HBe_P-D of FT:mat_peptide JQ707688_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707689_HBe_P-D Product feature CHAIN JQ707689_HBe_P-D of FT:mat_peptide JQ707689_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_17). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707690_HBe_P-D Product feature CHAIN JQ707690_HBe_P-D of FT:mat_peptide JQ707690_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_20). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707691_HBe_P-D Product feature CHAIN JQ707691_HBe_P-D of FT:mat_peptide JQ707691_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_25). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707692_HBe_P-D Product feature CHAIN JQ707692_HBe_P-D of FT:mat_peptide JQ707692_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_26). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707693_HBe_P-D Product feature CHAIN JQ707693_HBe_P-D of FT:mat_peptide JQ707693_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_27). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707694_HBe_P-D Product feature CHAIN JQ707694_HBe_P-D of FT:mat_peptide JQ707694_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707695_HBe_P-D Product feature CHAIN JQ707695_HBe_P-D of FT:mat_peptide JQ707695_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_29). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELVTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707696_HBe_P-D Product feature CHAIN JQ707696_HBe_P-D of FT:mat_peptide JQ707696_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_3). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707697_HBe_P-D Product feature CHAIN JQ707697_HBe_P-D of FT:mat_peptide JQ707697_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_30). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707698_HBe_P-D Product feature CHAIN JQ707698_HBe_P-D of FT:mat_peptide JQ707698_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_32). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707699_HBe_P-D Product feature CHAIN JQ707699_HBe_P-D of FT:mat_peptide JQ707699_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_35). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707700_HBe_P-D Product feature CHAIN JQ707700_HBe_P-D of FT:mat_peptide JQ707700_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_36-11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707701_HBe_P-D Product feature CHAIN JQ707701_HBe_P-D of FT:mat_peptide JQ707701_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_37). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707702_HBe_P-D Product feature CHAIN JQ707702_HBe_P-D of FT:mat_peptide JQ707702_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_43). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707703_HBe_P-D Product feature CHAIN JQ707703_HBe_P-D of FT:mat_peptide JQ707703_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_45). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707704_HBe_P-D Product feature CHAIN JQ707704_HBe_P-D of FT:mat_peptide JQ707704_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_5). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCFTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707705_HBe_P-D Product feature CHAIN JQ707705_HBe_P-D of FT:mat_peptide JQ707705_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JQ707706_HBe_P-D Product feature CHAIN JQ707706_HBe_P-D of FT:mat_peptide JQ707706_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S13_8-2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX079942_HBe_P-D Product feature CHAIN JX079942_HBe_P-D of FT:mat_peptide JX079942_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FF1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHSSCLTFGRDTVIEYLVSFGVWIRTPPAYRPVNAPILSTLPETAVVR
RRRR
>gnl|hbvpro|JX079943_HBe_P-D Product feature CHAIN JX079943_HBe_P-D of FT:mat_peptide JX079943_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CM1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVTYVNTNMGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX096954_HBe_P-D Product feature CHAIN JX096954_HBe_P-D of FT:mat_peptide JX096954_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1-3242). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX096955_HBe_P-D Product feature CHAIN JX096955_HBe_P-D of FT:mat_peptide JX096955_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2-3051). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMALAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX096956_HBe_P-D Product feature CHAIN JX096956_HBe_P-D of FT:mat_peptide JX096956_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5-6154). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX096957_HBe_P-D Product feature CHAIN JX096957_HBe_P-D of FT:mat_peptide JX096957_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 6-2646). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX096958_HBe_P-D Product feature CHAIN JX096958_HBe_P-D of FT:mat_peptide JX096958_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7-1276). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX310733_HBe_P-D Product feature CHAIN JX310733_HBe_P-D of FT:mat_peptide JX310733_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D23_1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX310734_HBe_P-D Product feature CHAIN JX310734_HBe_P-D of FT:mat_peptide JX310734_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D23_3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX470760_HBe_P-D Product feature CHAIN JX470760_HBe_P-D of FT:mat_peptide JX470760_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H-IDU6). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGGNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX847948_HBe_P-D Product feature CHAIN JX847948_HBe_P-D of FT:mat_peptide JX847948_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2095). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLINLST
WVGGNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX898689_HBe_P-D Product feature CHAIN JX898689_HBe_P-D of FT:mat_peptide JX898689_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P29). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX898691_HBe_P-D Product feature CHAIN JX898691_HBe_P-D of FT:mat_peptide JX898691_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P17). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX898692_HBe_P-D Product feature CHAIN JX898692_HBe_P-D of FT:mat_peptide JX898692_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P19). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX898694_HBe_P-D Product feature CHAIN JX898694_HBe_P-D of FT:mat_peptide JX898694_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P24). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|JX898697_HBe_P-D Product feature CHAIN JX898697_HBe_P-D of FT:mat_peptide JX898697_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P32). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC012652_HBe_P-D Product feature CHAIN KC012652_HBe_P-D of FT:mat_peptide KC012652_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGGNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC774444_HBe_P-D Product feature CHAIN KC774444_HBe_P-D of FT:mat_peptide KC774444_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1038). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC774445_HBe_P-D Product feature CHAIN KC774445_HBe_P-D of FT:mat_peptide KC774445_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1040). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC774460_HBe_P-D Product feature CHAIN KC774460_HBe_P-D of FT:mat_peptide KC774460_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dww1112). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC774462_HBe_P-D Product feature CHAIN KC774462_HBe_P-D of FT:mat_peptide KC774462_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dxa2047). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC774477_HBe_P-D Product feature CHAIN KC774477_HBe_P-D of FT:mat_peptide KC774477_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate dxn1031). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKKTVIEYLVSFGVWIPTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875275_HBe_P-D Product feature CHAIN KC875275_HBe_P-D of FT:mat_peptide KC875275_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV39). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875276_HBe_P-D Product feature CHAIN KC875276_HBe_P-D of FT:mat_peptide KC875276_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV6). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPESTVVR
RRGR
>gnl|hbvpro|KC875277_HBe_P-D Product feature CHAIN KC875277_HBe_P-D of FT:mat_peptide KC875277_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875278_HBe_P-D Product feature CHAIN KC875278_HBe_P-D of FT:mat_peptide KC875278_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV38). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQPLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875279_HBe_P-D Product feature CHAIN KC875279_HBe_P-D of FT:mat_peptide KC875279_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875280_HBe_P-D Product feature CHAIN KC875280_HBe_P-D of FT:mat_peptide KC875280_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV20). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875281_HBe_P-D Product feature CHAIN KC875281_HBe_P-D of FT:mat_peptide KC875281_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV32). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875282_HBe_P-D Product feature CHAIN KC875282_HBe_P-D of FT:mat_peptide KC875282_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV13). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875283_HBe_P-D Product feature CHAIN KC875283_HBe_P-D of FT:mat_peptide KC875283_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875284_HBe_P-D Product feature CHAIN KC875284_HBe_P-D of FT:mat_peptide KC875284_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875285_HBe_P-D Product feature CHAIN KC875285_HBe_P-D of FT:mat_peptide KC875285_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV29). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875286_HBe_P-D Product feature CHAIN KC875286_HBe_P-D of FT:mat_peptide KC875286_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV17). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875287_HBe_P-D Product feature CHAIN KC875287_HBe_P-D of FT:mat_peptide KC875287_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV18). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875288_HBe_P-D Product feature CHAIN KC875288_HBe_P-D of FT:mat_peptide KC875288_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV56). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875289_HBe_P-D Product feature CHAIN KC875289_HBe_P-D of FT:mat_peptide KC875289_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV55). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|KC875290_HBe_P-D Product feature CHAIN KC875290_HBe_P-D of FT:mat_peptide KC875290_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV57). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KC875291_HBe_P-D Product feature CHAIN KC875291_HBe_P-D of FT:mat_peptide KC875291_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV58). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875292_HBe_P-D Product feature CHAIN KC875292_HBe_P-D of FT:mat_peptide KC875292_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV21). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875293_HBe_P-D Product feature CHAIN KC875293_HBe_P-D of FT:mat_peptide KC875293_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV69). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875294_HBe_P-D Product feature CHAIN KC875294_HBe_P-D of FT:mat_peptide KC875294_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV70). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875295_HBe_P-D Product feature CHAIN KC875295_HBe_P-D of FT:mat_peptide KC875295_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV81). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875297_HBe_P-D Product feature CHAIN KC875297_HBe_P-D of FT:mat_peptide KC875297_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV84). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
QRGR
>gnl|hbvpro|KC875299_HBe_P-D Product feature CHAIN KC875299_HBe_P-D of FT:mat_peptide KC875299_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV85). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875300_HBe_P-D Product feature CHAIN KC875300_HBe_P-D of FT:mat_peptide KC875300_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV80). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KC875302_HBe_P-D Product feature CHAIN KC875302_HBe_P-D of FT:mat_peptide KC875302_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV86). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875303_HBe_P-D Product feature CHAIN KC875303_HBe_P-D of FT:mat_peptide KC875303_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV92). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875305_HBe_P-D Product feature CHAIN KC875305_HBe_P-D of FT:mat_peptide KC875305_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV41). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875306_HBe_P-D Product feature CHAIN KC875306_HBe_P-D of FT:mat_peptide KC875306_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV71). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875307_HBe_P-D Product feature CHAIN KC875307_HBe_P-D of FT:mat_peptide KC875307_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV74). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KC875308_HBe_P-D Product feature CHAIN KC875308_HBe_P-D of FT:mat_peptide KC875308_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV72). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875309_HBe_P-D Product feature CHAIN KC875309_HBe_P-D of FT:mat_peptide KC875309_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV43). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALSQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875310_HBe_P-D Product feature CHAIN KC875310_HBe_P-D of FT:mat_peptide KC875310_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV9). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875311_HBe_P-D Product feature CHAIN KC875311_HBe_P-D of FT:mat_peptide KC875311_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875312_HBe_P-D Product feature CHAIN KC875312_HBe_P-D of FT:mat_peptide KC875312_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV22). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|KC875313_HBe_P-D Product feature CHAIN KC875313_HBe_P-D of FT:mat_peptide KC875313_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV25). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875314_HBe_P-D Product feature CHAIN KC875314_HBe_P-D of FT:mat_peptide KC875314_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPPVRDLLDTASALYREALESPEHCSPHHTALRQANLCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875315_HBe_P-D Product feature CHAIN KC875315_HBe_P-D of FT:mat_peptide KC875315_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRHAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHITCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875316_HBe_P-D Product feature CHAIN KC875316_HBe_P-D of FT:mat_peptide KC875316_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLGFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875317_HBe_P-D Product feature CHAIN KC875317_HBe_P-D of FT:mat_peptide KC875317_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV48). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875318_HBe_P-D Product feature CHAIN KC875318_HBe_P-D of FT:mat_peptide KC875318_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV40). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KC875319_HBe_P-D Product feature CHAIN KC875319_HBe_P-D of FT:mat_peptide KC875319_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV30). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875320_HBe_P-D Product feature CHAIN KC875320_HBe_P-D of FT:mat_peptide KC875320_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV31). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KC875321_HBe_P-D Product feature CHAIN KC875321_HBe_P-D of FT:mat_peptide KC875321_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV19). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875322_HBe_P-D Product feature CHAIN KC875322_HBe_P-D of FT:mat_peptide KC875322_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV54). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KC875323_HBe_P-D Product feature CHAIN KC875323_HBe_P-D of FT:mat_peptide KC875323_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV53). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KC875324_HBe_P-D Product feature CHAIN KC875324_HBe_P-D of FT:mat_peptide KC875324_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV59). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|KC875325_HBe_P-D Product feature CHAIN KC875325_HBe_P-D of FT:mat_peptide KC875325_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV60). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875326_HBe_P-D Product feature CHAIN KC875326_HBe_P-D of FT:mat_peptide KC875326_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV37). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875329_HBe_P-D Product feature CHAIN KC875329_HBe_P-D of FT:mat_peptide KC875329_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV90). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFLSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|KC875330_HBe_P-D Product feature CHAIN KC875330_HBe_P-D of FT:mat_peptide KC875330_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV87). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875331_HBe_P-D Product feature CHAIN KC875331_HBe_P-D of FT:mat_peptide KC875331_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV88). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875332_HBe_P-D Product feature CHAIN KC875332_HBe_P-D of FT:mat_peptide KC875332_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV42). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875333_HBe_P-D Product feature CHAIN KC875333_HBe_P-D of FT:mat_peptide KC875333_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV75). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875334_HBe_P-D Product feature CHAIN KC875334_HBe_P-D of FT:mat_peptide KC875334_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV47). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|KC875335_HBe_P-D Product feature CHAIN KC875335_HBe_P-D of FT:mat_peptide KC875335_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV44). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875336_HBe_P-D Product feature CHAIN KC875336_HBe_P-D of FT:mat_peptide KC875336_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV45). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875337_HBe_P-D Product feature CHAIN KC875337_HBe_P-D of FT:mat_peptide KC875337_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV46). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KC875340_HBe_P-D Product feature CHAIN KC875340_HBe_P-D of FT:mat_peptide KC875340_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV34). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KC875342_HBe_P-D Product feature CHAIN KC875342_HBe_P-D of FT:mat_peptide KC875342_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV79). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLLFHISCLTFGRQTVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KC999421_HBe_P-D Product feature CHAIN KC999421_HBe_P-D of FT:mat_peptide KC999421_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CbaArg06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRG
>gnl|hbvpro|KF018180_HBe_P-D Product feature CHAIN KF018180_HBe_P-D of FT:mat_peptide KF018180_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF018184_HBe_P-D Product feature CHAIN KF018184_HBe_P-D of FT:mat_peptide KF018184_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF018187_HBe_P-D Product feature CHAIN KF018187_HBe_P-D of FT:mat_peptide KF018187_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF018190_HBe_P-D Product feature CHAIN KF018190_HBe_P-D of FT:mat_peptide KF018190_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF018191_HBe_P-D Product feature CHAIN KF018191_HBe_P-D of FT:mat_peptide KF018191_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF018194_HBe_P-D Product feature CHAIN KF018194_HBe_P-D of FT:mat_peptide KF018194_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF061167_HBe_P-D Product feature CHAIN KF061167_HBe_P-D of FT:mat_peptide KF061167_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_1a). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF061168_HBe_P-D Product feature CHAIN KF061168_HBe_P-D of FT:mat_peptide KF061168_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_3a). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREXLESPEHCSPHHTALRQAILCWGXLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF061169_HBe_P-D Product feature CHAIN KF061169_HBe_P-D of FT:mat_peptide KF061169_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_7a). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF061170_HBe_P-D Product feature CHAIN KF061170_HBe_P-D of FT:mat_peptide KF061170_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate RST_PAK_13a). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF192830_HBe_P-D Product feature CHAIN KF192830_HBe_P-D of FT:mat_peptide KF192830_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP71). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF192831_HBe_P-D Product feature CHAIN KF192831_HBe_P-D of FT:mat_peptide KF192831_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP59). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF192832_HBe_P-D Product feature CHAIN KF192832_HBe_P-D of FT:mat_peptide KF192832_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP67). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF192834_HBe_P-D Product feature CHAIN KF192834_HBe_P-D of FT:mat_peptide KF192834_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TP63). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF471640_HBe_P-D Product feature CHAIN KF471640_HBe_P-D of FT:mat_peptide KF471640_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-86). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVNLLSFLPADYFPSVRDLLDTASALYREALESSEHCTPHHTALRQAILCWGDLINLST
WVGSNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|KF471647_HBe_P-D Product feature CHAIN KF471647_HBe_P-D of FT:mat_peptide KF471647_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-35). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF471649_HBe_P-D Product feature CHAIN KF471649_HBe_P-D of FT:mat_peptide KF471649_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-31). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF471650_HBe_P-D Product feature CHAIN KF471650_HBe_P-D of FT:mat_peptide KF471650_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-25). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF471651_HBe_P-D Product feature CHAIN KF471651_HBe_P-D of FT:mat_peptide KF471651_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF471652_HBe_P-D Product feature CHAIN KF471652_HBe_P-D of FT:mat_peptide KF471652_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-20). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF471654_HBe_P-D Product feature CHAIN KF471654_HBe_P-D of FT:mat_peptide KF471654_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-14). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREPLESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF471655_HBe_P-D Product feature CHAIN KF471655_HBe_P-D of FT:mat_peptide KF471655_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLPYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF471656_HBe_P-D Product feature CHAIN KF471656_HBe_P-D of FT:mat_peptide KF471656_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRELLWFHISCLTFGRETGIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF471657_HBe_P-D Product feature CHAIN KF471657_HBe_P-D of FT:mat_peptide KF471657_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PG-7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF584076_HBe_P-D Product feature CHAIN KF584076_HBe_P-D of FT:mat_peptide KF584076_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M1_17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
PRGR
>gnl|hbvpro|KF584078_HBe_P-D Product feature CHAIN KF584078_HBe_P-D of FT:mat_peptide KF584078_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate M2_81). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLGTASALYREALESPEHCSPHHTALRQAILCWGDLMNLGT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRCR
>gnl|hbvpro|KF584129_HBe_P-D Product feature CHAIN KF584129_HBe_P-D of FT:mat_peptide KF584129_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2b_07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=162 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HR
>gnl|hbvpro|KF584130_HBe_P-D Product feature CHAIN KF584130_HBe_P-D of FT:mat_peptide KF584130_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2b_08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=161 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVXQYLVSFGVWIRXPPAYRPPNAPILSXLPETTVVR
H
>gnl|hbvpro|KF584161_HBe_P-D Product feature CHAIN KF584161_HBe_P-D of FT:mat_peptide KF584161_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1a). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYREALXSPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF584162_HBe_P-D Product feature CHAIN KF584162_HBe_P-D of FT:mat_peptide KF584162_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1b). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF584163_HBe_P-D Product feature CHAIN KF584163_HBe_P-D of FT:mat_peptide KF584163_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2a). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYREALXSPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF584164_HBe_P-D Product feature CHAIN KF584164_HBe_P-D of FT:mat_peptide KF584164_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2b). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF584165_HBe_P-D Product feature CHAIN KF584165_HBe_P-D of FT:mat_peptide KF584165_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Da). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYREALXSPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF584166_HBe_P-D Product feature CHAIN KF584166_HBe_P-D of FT:mat_peptide KF584166_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Db). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF679989_HBe_P-D Product feature CHAIN KF679989_HBe_P-D of FT:mat_peptide KF679989_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-49). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF679992_HBe_P-D Product feature CHAIN KF679992_HBe_P-D of FT:mat_peptide KF679992_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-75). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF679993_HBe_P-D Product feature CHAIN KF679993_HBe_P-D of FT:mat_peptide KF679993_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-76). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF679994_HBe_P-D Product feature CHAIN KF679994_HBe_P-D of FT:mat_peptide KF679994_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF679995_HBe_P-D Product feature CHAIN KF679995_HBe_P-D of FT:mat_peptide KF679995_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-37). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF679996_HBe_P-D Product feature CHAIN KF679996_HBe_P-D of FT:mat_peptide KF679996_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-51). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF679997_HBe_P-D Product feature CHAIN KF679997_HBe_P-D of FT:mat_peptide KF679997_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-56). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779209_HBe_P-D Product feature CHAIN KF779209_HBe_P-D of FT:mat_peptide KF779209_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5536). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779212_HBe_P-D Product feature CHAIN KF779212_HBe_P-D of FT:mat_peptide KF779212_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5739). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779214_HBe_P-D Product feature CHAIN KF779214_HBe_P-D of FT:mat_peptide KF779214_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5754). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779216_HBe_P-D Product feature CHAIN KF779216_HBe_P-D of FT:mat_peptide KF779216_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5770). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779217_HBe_P-D Product feature CHAIN KF779217_HBe_P-D of FT:mat_peptide KF779217_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5809). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779218_HBe_P-D Product feature CHAIN KF779218_HBe_P-D of FT:mat_peptide KF779218_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5876). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPIQSTLPETTVVR
GRGR
>gnl|hbvpro|KF779220_HBe_P-D Product feature CHAIN KF779220_HBe_P-D of FT:mat_peptide KF779220_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5910). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPDYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779222_HBe_P-D Product feature CHAIN KF779222_HBe_P-D of FT:mat_peptide KF779222_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN5978). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779223_HBe_P-D Product feature CHAIN KF779223_HBe_P-D of FT:mat_peptide KF779223_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6024). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779224_HBe_P-D Product feature CHAIN KF779224_HBe_P-D of FT:mat_peptide KF779224_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6026). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779225_HBe_P-D Product feature CHAIN KF779225_HBe_P-D of FT:mat_peptide KF779225_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6036). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779228_HBe_P-D Product feature CHAIN KF779228_HBe_P-D of FT:mat_peptide KF779228_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6067). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779230_HBe_P-D Product feature CHAIN KF779230_HBe_P-D of FT:mat_peptide KF779230_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DEN6078). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779285_HBe_P-D Product feature CHAIN KF779285_HBe_P-D of FT:mat_peptide KF779285_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0596). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779288_HBe_P-D Product feature CHAIN KF779288_HBe_P-D of FT:mat_peptide KF779288_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0643). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779289_HBe_P-D Product feature CHAIN KF779289_HBe_P-D of FT:mat_peptide KF779289_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0730). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779292_HBe_P-D Product feature CHAIN KF779292_HBe_P-D of FT:mat_peptide KF779292_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0767). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779296_HBe_P-D Product feature CHAIN KF779296_HBe_P-D of FT:mat_peptide KF779296_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT0869). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779301_HBe_P-D Product feature CHAIN KF779301_HBe_P-D of FT:mat_peptide KF779301_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT1003). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPASRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779302_HBe_P-D Product feature CHAIN KF779302_HBe_P-D of FT:mat_peptide KF779302_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT1009). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779303_HBe_P-D Product feature CHAIN KF779303_HBe_P-D of FT:mat_peptide KF779303_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MLT1018). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779318_HBe_P-D Product feature CHAIN KF779318_HBe_P-D of FT:mat_peptide KF779318_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PNF4312). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779340_HBe_P-D Product feature CHAIN KF779340_HBe_P-D of FT:mat_peptide KF779340_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PNF4854). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779341_HBe_P-D Product feature CHAIN KF779341_HBe_P-D of FT:mat_peptide KF779341_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PNF4864). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779376_HBe_P-D Product feature CHAIN KF779376_HBe_P-D of FT:mat_peptide KF779376_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PRC6029). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779377_HBe_P-D Product feature CHAIN KF779377_HBe_P-D of FT:mat_peptide KF779377_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PRC6034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779382_HBe_P-D Product feature CHAIN KF779382_HBe_P-D of FT:mat_peptide KF779382_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate PRC6295). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGTNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|KF798260_HBe_P-D Product feature CHAIN KF798260_HBe_P-D of FT:mat_peptide KF798260_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF798273_HBe_P-D Product feature CHAIN KF798273_HBe_P-D of FT:mat_peptide KF798273_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF798282_HBe_P-D Product feature CHAIN KF798282_HBe_P-D of FT:mat_peptide KF798282_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF798283_HBe_P-D Product feature CHAIN KF798283_HBe_P-D of FT:mat_peptide KF798283_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF798306_HBe_P-D Product feature CHAIN KF798306_HBe_P-D of FT:mat_peptide KF798306_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICIB-48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF896606_HBe_P-D Product feature CHAIN KF896606_HBe_P-D of FT:mat_peptide KF896606_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LAV01). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
PKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF922432_HBe_P-D Product feature CHAIN KF922432_HBe_P-D of FT:mat_peptide KF922432_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate N011). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KJ470889_HBe_P-D Product feature CHAIN KJ470889_HBe_P-D of FT:mat_peptide KJ470889_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8034). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KJ470894_HBe_P-D Product feature CHAIN KJ470894_HBe_P-D of FT:mat_peptide KJ470894_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 8066). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTHHHTAIRQAILCWGELMTLAT
WVGTNLEDPASRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KJ647340_HBe_P-D Product feature CHAIN KJ647340_HBe_P-D of FT:mat_peptide KJ647340_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV218). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=162 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSLRDLLDTASALYRDALESPEHCSAHHTALRQAILCWGDLMNLAT
WVGVNLEDPASRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
GR
>gnl|hbvpro|KJ647344_HBe_P-D Product feature CHAIN KJ647344_HBe_P-D of FT:mat_peptide KJ647344_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV234). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=162 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTISALYREALESPEHVSPHHTAIRQAILCWVEIMKLAT
WVGVNLEDPASRDQVVGYVNTNMGLKFRQLLWFHTSCITFGRDTVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RR
>gnl|hbvpro|KM519455_HBe_P-D Product feature CHAIN KM519455_HBe_P-D of FT:mat_peptide KM519455_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D3_WT_SA). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524338_HBe_P-D Product feature CHAIN KM524338_HBe_P-D of FT:mat_peptide KM524338_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV136_EP-CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524339_HBe_P-D Product feature CHAIN KM524339_HBe_P-D of FT:mat_peptide KM524339_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV064_EP-CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524341_HBe_P-D Product feature CHAIN KM524341_HBe_P-D of FT:mat_peptide KM524341_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV128_EP-CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524345_HBe_P-D Product feature CHAIN KM524345_HBe_P-D of FT:mat_peptide KM524345_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK082_EP-CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524346_HBe_P-D Product feature CHAIN KM524346_HBe_P-D of FT:mat_peptide KM524346_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK096_EP-CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RQGR
>gnl|hbvpro|KM524347_HBe_P-D Product feature CHAIN KM524347_HBe_P-D of FT:mat_peptide KM524347_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK102_EP-CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFRVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524348_HBe_P-D Product feature CHAIN KM524348_HBe_P-D of FT:mat_peptide KM524348_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MK129_EP-CHB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WGGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIPTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524349_HBe_P-D Product feature CHAIN KM524349_HBe_P-D of FT:mat_peptide KM524349_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-015_HIV-HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524350_HBe_P-D Product feature CHAIN KM524350_HBe_P-D of FT:mat_peptide KM524350_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-017_HIV-HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524351_HBe_P-D Product feature CHAIN KM524351_HBe_P-D of FT:mat_peptide KM524351_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-020_HIV-HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524352_HBe_P-D Product feature CHAIN KM524352_HBe_P-D of FT:mat_peptide KM524352_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-025_HIV-HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524353_HBe_P-D Product feature CHAIN KM524353_HBe_P-D of FT:mat_peptide KM524353_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-031_HIV-HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524354_HBe_P-D Product feature CHAIN KM524354_HBe_P-D of FT:mat_peptide KM524354_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-058_HIV-HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524355_HBe_P-D Product feature CHAIN KM524355_HBe_P-D of FT:mat_peptide KM524355_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-092_HIV-HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524356_HBe_P-D Product feature CHAIN KM524356_HBe_P-D of FT:mat_peptide KM524356_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV.I-123_HIV-HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM524358_HBe_P-D Product feature CHAIN KM524358_HBe_P-D of FT:mat_peptide KM524358_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV.I-057_HIV-HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREPLESPEHCSPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLSFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRVR
>gnl|hbvpro|KM524361_HBe_P-D Product feature CHAIN KM524361_HBe_P-D of FT:mat_peptide KM524361_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EHBV.I-112_HIV-HBV). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVMEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM606655_HBe_P-D Product feature CHAIN KM606655_HBe_P-D of FT:mat_peptide KM606655_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba25a). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESSEHCSPHHTALRQAVLCWGDLMTLAT
WVGTNLEDPTSRDLVVSYVNTNAGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIQSTLPETTVVR
RRGR
>gnl|hbvpro|KM606744_HBe_P-D Product feature CHAIN KM606744_HBe_P-D of FT:mat_peptide KM606744_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba9). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM606745_HBe_P-D Product feature CHAIN KM606745_HBe_P-D of FT:mat_peptide KM606745_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KM606752_HBe_P-D Product feature CHAIN KM606752_HBe_P-D of FT:mat_peptide KM606752_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Cuba100). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP090177_HBe_P-D Product feature CHAIN KP090177_HBe_P-D of FT:mat_peptide KP090177_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP090178_HBe_P-D Product feature CHAIN KP090178_HBe_P-D of FT:mat_peptide KP090178_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP090179_HBe_P-D Product feature CHAIN KP090179_HBe_P-D of FT:mat_peptide KP090179_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR6). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP090180_HBe_P-D Product feature CHAIN KP090180_HBe_P-D of FT:mat_peptide KP090180_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR14). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP090181_HBe_P-D Product feature CHAIN KP090181_HBe_P-D of FT:mat_peptide KP090181_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR40). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP322599_HBe_P-D Product feature CHAIN KP322599_HBe_P-D of FT:mat_peptide KP322599_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2811). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP322600_HBe_P-D Product feature CHAIN KP322600_HBe_P-D of FT:mat_peptide KP322600_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2812). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP322601_HBe_P-D Product feature CHAIN KP322601_HBe_P-D of FT:mat_peptide KP322601_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate H2813). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671684_HBe_P-D Product feature CHAIN KP671684_HBe_P-D of FT:mat_peptide KP671684_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-2PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671685_HBe_P-D Product feature CHAIN KP671685_HBe_P-D of FT:mat_peptide KP671685_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-4PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671686_HBe_P-D Product feature CHAIN KP671686_HBe_P-D of FT:mat_peptide KP671686_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-5PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671687_HBe_P-D Product feature CHAIN KP671687_HBe_P-D of FT:mat_peptide KP671687_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-6PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671688_HBe_P-D Product feature CHAIN KP671688_HBe_P-D of FT:mat_peptide KP671688_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-7PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671689_HBe_P-D Product feature CHAIN KP671689_HBe_P-D of FT:mat_peptide KP671689_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-8PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671690_HBe_P-D Product feature CHAIN KP671690_HBe_P-D of FT:mat_peptide KP671690_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-9PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671691_HBe_P-D Product feature CHAIN KP671691_HBe_P-D of FT:mat_peptide KP671691_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-10PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671692_HBe_P-D Product feature CHAIN KP671692_HBe_P-D of FT:mat_peptide KP671692_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-11PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRETLKSPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671693_HBe_P-D Product feature CHAIN KP671693_HBe_P-D of FT:mat_peptide KP671693_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-12PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671694_HBe_P-D Product feature CHAIN KP671694_HBe_P-D of FT:mat_peptide KP671694_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-13PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671695_HBe_P-D Product feature CHAIN KP671695_HBe_P-D of FT:mat_peptide KP671695_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-14PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671696_HBe_P-D Product feature CHAIN KP671696_HBe_P-D of FT:mat_peptide KP671696_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-15PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671697_HBe_P-D Product feature CHAIN KP671697_HBe_P-D of FT:mat_peptide KP671697_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-17PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671698_HBe_P-D Product feature CHAIN KP671698_HBe_P-D of FT:mat_peptide KP671698_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-18PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGGNLEDPISRDLVVSYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWLRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671699_HBe_P-D Product feature CHAIN KP671699_HBe_P-D of FT:mat_peptide KP671699_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-19PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP671700_HBe_P-D Product feature CHAIN KP671700_HBe_P-D of FT:mat_peptide KP671700_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate IRI-HBV-20PreC/C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSAHHTALRQAILCWGDLMSLAT
WVGSNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857094_HBe_P-D Product feature CHAIN KP857094_HBe_P-D of FT:mat_peptide KP857094_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857097_HBe_P-D Product feature CHAIN KP857097_HBe_P-D of FT:mat_peptide KP857097_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857099_HBe_P-D Product feature CHAIN KP857099_HBe_P-D of FT:mat_peptide KP857099_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857100_HBe_P-D Product feature CHAIN KP857100_HBe_P-D of FT:mat_peptide KP857100_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857104_HBe_P-D Product feature CHAIN KP857104_HBe_P-D of FT:mat_peptide KP857104_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857105_HBe_P-D Product feature CHAIN KP857105_HBe_P-D of FT:mat_peptide KP857105_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857106_HBe_P-D Product feature CHAIN KP857106_HBe_P-D of FT:mat_peptide KP857106_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857107_HBe_P-D Product feature CHAIN KP857107_HBe_P-D of FT:mat_peptide KP857107_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857109_HBe_P-D Product feature CHAIN KP857109_HBe_P-D of FT:mat_peptide KP857109_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPAHCSPHHTALRQATICWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRGR
>gnl|hbvpro|KP857110_HBe_P-D Product feature CHAIN KP857110_HBe_P-D of FT:mat_peptide KP857110_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRATVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857111_HBe_P-D Product feature CHAIN KP857111_HBe_P-D of FT:mat_peptide KP857111_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGANLEDPASRDLVVSYVNTNIALKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857114_HBe_P-D Product feature CHAIN KP857114_HBe_P-D of FT:mat_peptide KP857114_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALDSPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP857115_HBe_P-D Product feature CHAIN KP857115_HBe_P-D of FT:mat_peptide KP857115_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDYFPSVRDLLDTARALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|KP857116_HBe_P-D Product feature CHAIN KP857116_HBe_P-D of FT:mat_peptide KP857116_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
QRGR
>gnl|hbvpro|KP857117_HBe_P-D Product feature CHAIN KP857117_HBe_P-D of FT:mat_peptide KP857117_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KR905423_HBe_P-D Product feature CHAIN KR905423_HBe_P-D of FT:mat_peptide KR905423_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-36). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KR905424_HBe_P-D Product feature CHAIN KR905424_HBe_P-D of FT:mat_peptide KR905424_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate EICI-42). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT151620_HBe_P-D Product feature CHAIN KT151620_HBe_P-D of FT:mat_peptide KT151620_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT347090_HBe_P-D Product feature CHAIN KT347090_HBe_P-D of FT:mat_peptide KT347090_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ZADGMTMG). Complete genome. [Hepadnaviridae] (length=164 residues).
SRLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366491_HBe_P-D Product feature CHAIN KT366491_HBe_P-D of FT:mat_peptide KT366491_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.38). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366494_HBe_P-D Product feature CHAIN KT366494_HBe_P-D of FT:mat_peptide KT366494_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.42). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366495_HBe_P-D Product feature CHAIN KT366495_HBe_P-D of FT:mat_peptide KT366495_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.45). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366496_HBe_P-D Product feature CHAIN KT366496_HBe_P-D of FT:mat_peptide KT366496_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.46). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366497_HBe_P-D Product feature CHAIN KT366497_HBe_P-D of FT:mat_peptide KT366497_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.48). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366498_HBe_P-D Product feature CHAIN KT366498_HBe_P-D of FT:mat_peptide KT366498_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366499_HBe_P-D Product feature CHAIN KT366499_HBe_P-D of FT:mat_peptide KT366499_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
RRGR
>gnl|hbvpro|KT366500_HBe_P-D Product feature CHAIN KT366500_HBe_P-D of FT:mat_peptide KT366500_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.18). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366501_HBe_P-D Product feature CHAIN KT366501_HBe_P-D of FT:mat_peptide KT366501_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.23). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366502_HBe_P-D Product feature CHAIN KT366502_HBe_P-D of FT:mat_peptide KT366502_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate O-EICI.27). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366506_HBe_P-D Product feature CHAIN KT366506_HBe_P-D of FT:mat_peptide KT366506_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.18). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366507_HBe_P-D Product feature CHAIN KT366507_HBe_P-D of FT:mat_peptide KT366507_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.24). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366508_HBe_P-D Product feature CHAIN KT366508_HBe_P-D of FT:mat_peptide KT366508_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.25). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366509_HBe_P-D Product feature CHAIN KT366509_HBe_P-D of FT:mat_peptide KT366509_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.26). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366510_HBe_P-D Product feature CHAIN KT366510_HBe_P-D of FT:mat_peptide KT366510_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.36). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT366511_HBe_P-D Product feature CHAIN KT366511_HBe_P-D of FT:mat_peptide KT366511_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate C-EICI.37). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KT749827_HBe_P-D Product feature CHAIN KT749827_HBe_P-D of FT:mat_peptide KT749827_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FL14). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAFLCWGELMTLAT
WVGTNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668433_HBe_P-D Product feature CHAIN KU668433_HBe_P-D of FT:mat_peptide KU668433_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV071). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTFAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNALILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668434_HBe_P-D Product feature CHAIN KU668434_HBe_P-D of FT:mat_peptide KU668434_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV072). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668435_HBe_P-D Product feature CHAIN KU668435_HBe_P-D of FT:mat_peptide KU668435_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV102). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTFAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668436_HBe_P-D Product feature CHAIN KU668436_HBe_P-D of FT:mat_peptide KU668436_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV103). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668437_HBe_P-D Product feature CHAIN KU668437_HBe_P-D of FT:mat_peptide KU668437_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV108). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGRDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668438_HBe_P-D Product feature CHAIN KU668438_HBe_P-D of FT:mat_peptide KU668438_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV111). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668439_HBe_P-D Product feature CHAIN KU668439_HBe_P-D of FT:mat_peptide KU668439_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV124). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668441_HBe_P-D Product feature CHAIN KU668441_HBe_P-D of FT:mat_peptide KU668441_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV170). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668442_HBe_P-D Product feature CHAIN KU668442_HBe_P-D of FT:mat_peptide KU668442_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV175). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHAPLRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668444_HBe_P-D Product feature CHAIN KU668444_HBe_P-D of FT:mat_peptide KU668444_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV180). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLLVSYVNSNMGLKFRPLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668445_HBe_P-D Product feature CHAIN KU668445_HBe_P-D of FT:mat_peptide KU668445_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV181). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALQSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668446_HBe_P-D Product feature CHAIN KU668446_HBe_P-D of FT:mat_peptide KU668446_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV183). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668447_HBe_P-D Product feature CHAIN KU668447_HBe_P-D of FT:mat_peptide KU668447_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV191). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGVTVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668448_HBe_P-D Product feature CHAIN KU668448_HBe_P-D of FT:mat_peptide KU668448_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV192). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPATRDLLLNYVNTNMGLPVLPRLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU668449_HBe_P-D Product feature CHAIN KU668449_HBe_P-D of FT:mat_peptide KU668449_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HCV207). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU736924_HBe_P-D Product feature CHAIN KU736924_HBe_P-D of FT:mat_peptide KU736924_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_14). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU736925_HBe_P-D Product feature CHAIN KU736925_HBe_P-D of FT:mat_peptide KU736925_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KU736926_HBe_P-D Product feature CHAIN KU736926_HBe_P-D of FT:mat_peptide KU736926_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sudan_18). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESXEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRXLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196208_HBe_P-D Product feature CHAIN KX196208_HBe_P-D of FT:mat_peptide KX196208_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL093). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196209_HBe_P-D Product feature CHAIN KX196209_HBe_P-D of FT:mat_peptide KX196209_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL094). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KX196210_HBe_P-D Product feature CHAIN KX196210_HBe_P-D of FT:mat_peptide KX196210_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL095). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196211_HBe_P-D Product feature CHAIN KX196211_HBe_P-D of FT:mat_peptide KX196211_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL096). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196212_HBe_P-D Product feature CHAIN KX196212_HBe_P-D of FT:mat_peptide KX196212_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL097). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KX196213_HBe_P-D Product feature CHAIN KX196213_HBe_P-D of FT:mat_peptide KX196213_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL098). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196214_HBe_P-D Product feature CHAIN KX196214_HBe_P-D of FT:mat_peptide KX196214_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL099). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPESTVVR
RRGR
>gnl|hbvpro|KX196215_HBe_P-D Product feature CHAIN KX196215_HBe_P-D of FT:mat_peptide KX196215_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0100). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196216_HBe_P-D Product feature CHAIN KX196216_HBe_P-D of FT:mat_peptide KX196216_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0101). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196217_HBe_P-D Product feature CHAIN KX196217_HBe_P-D of FT:mat_peptide KX196217_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0102). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KX196218_HBe_P-D Product feature CHAIN KX196218_HBe_P-D of FT:mat_peptide KX196218_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0103). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196219_HBe_P-D Product feature CHAIN KX196219_HBe_P-D of FT:mat_peptide KX196219_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0104). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196220_HBe_P-D Product feature CHAIN KX196220_HBe_P-D of FT:mat_peptide KX196220_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0105). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KX196221_HBe_P-D Product feature CHAIN KX196221_HBe_P-D of FT:mat_peptide KX196221_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0106). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|KX196222_HBe_P-D Product feature CHAIN KX196222_HBe_P-D of FT:mat_peptide KX196222_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0107). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196224_HBe_P-D Product feature CHAIN KX196224_HBe_P-D of FT:mat_peptide KX196224_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0109). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KX196225_HBe_P-D Product feature CHAIN KX196225_HBe_P-D of FT:mat_peptide KX196225_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0110). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KX196226_HBe_P-D Product feature CHAIN KX196226_HBe_P-D of FT:mat_peptide KX196226_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0111). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KX196227_HBe_P-D Product feature CHAIN KX196227_HBe_P-D of FT:mat_peptide KX196227_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0112). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196229_HBe_P-D Product feature CHAIN KX196229_HBe_P-D of FT:mat_peptide KX196229_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0114). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLLFHISCLTFGRQTVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KX196230_HBe_P-D Product feature CHAIN KX196230_HBe_P-D of FT:mat_peptide KX196230_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0115). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196231_HBe_P-D Product feature CHAIN KX196231_HBe_P-D of FT:mat_peptide KX196231_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0116). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196232_HBe_P-D Product feature CHAIN KX196232_HBe_P-D of FT:mat_peptide KX196232_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0117). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|KX196233_HBe_P-D Product feature CHAIN KX196233_HBe_P-D of FT:mat_peptide KX196233_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0118). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|KX196234_HBe_P-D Product feature CHAIN KX196234_HBe_P-D of FT:mat_peptide KX196234_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0119). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX196235_HBe_P-D Product feature CHAIN KX196235_HBe_P-D of FT:mat_peptide KX196235_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0120). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFLSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|KX196236_HBe_P-D Product feature CHAIN KX196236_HBe_P-D of FT:mat_peptide KX196236_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBVFL0121). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
QRGR
>gnl|hbvpro|KX827290_HBe_P-D Product feature CHAIN KX827290_HBe_P-D of FT:mat_peptide KX827290_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno1.2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSGFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX827291_HBe_P-D Product feature CHAIN KX827291_HBe_P-D of FT:mat_peptide KX827291_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno2.2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX827292_HBe_P-D Product feature CHAIN KX827292_HBe_P-D of FT:mat_peptide KX827292_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno3.1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILPTLPETTVVR
RRGR
>gnl|hbvpro|KX827300_HBe_P-D Product feature CHAIN KX827300_HBe_P-D of FT:mat_peptide KX827300_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno21.2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KX827301_HBe_P-D Product feature CHAIN KX827301_HBe_P-D of FT:mat_peptide KX827301_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate geno30.4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KY382414_HBe_P-D Product feature CHAIN KY382414_HBe_P-D of FT:mat_peptide KY382414_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1_wt). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KY616076_HBe_P-D Product feature CHAIN KY616076_HBe_P-D of FT:mat_peptide KY616076_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 19HF). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=161 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVTYVNTNMGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
R
>gnl|hbvpro|KY629630_HBe_P-D Product feature CHAIN KY629630_HBe_P-D of FT:mat_peptide KY629630_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate TYM13097). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KY629634_HBe_P-D Product feature CHAIN KY629634_HBe_P-D of FT:mat_peptide KY629634_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KLMY16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDIVLEYLVSFGVWIRTPPAYRPANAPILSTLPETAVIR
RRGR
>gnl|hbvpro|LC365689_HBe_P-D Product feature CHAIN LC365689_HBe_P-D of FT:mat_peptide LC365689_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HB17-0791). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|LC705462_HBe_P-D Product feature CHAIN LC705462_HBe_P-D of FT:mat_peptide LC705462_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Eg333). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|LK995390_HBe_P-D Product feature CHAIN LK995390_HBe_P-D of FT:mat_peptide LK995390_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NAT2037627). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLEWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPIFRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPISSTLPETTVVR
RRGR
>gnl|hbvpro|LT992438_HBe_P-D Product feature CHAIN LT992438_HBe_P-D of FT:mat_peptide LT992438_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|LT992439_HBe_P-D Product feature CHAIN LT992439_HBe_P-D of FT:mat_peptide LT992439_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|LT992444_HBe_P-D Product feature CHAIN LT992444_HBe_P-D of FT:mat_peptide LT992444_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|LT992454_HBe_P-D Product feature CHAIN LT992454_HBe_P-D of FT:mat_peptide LT992454_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DA222). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MF488704_HBe_P-D Product feature CHAIN MF488704_HBe_P-D of FT:mat_peptide MF488704_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-PCP229). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHSALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MF618339_HBe_P-D Product feature CHAIN MF618339_HBe_P-D of FT:mat_peptide MF618339_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV006). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MF618341_HBe_P-D Product feature CHAIN MF618341_HBe_P-D of FT:mat_peptide MF618341_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV011). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MF618342_HBe_P-D Product feature CHAIN MF618342_HBe_P-D of FT:mat_peptide MF618342_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV053). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTFAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MF618343_HBe_P-D Product feature CHAIN MF618343_HBe_P-D of FT:mat_peptide MF618343_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV054). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MF618348_HBe_P-D Product feature CHAIN MF618348_HBe_P-D of FT:mat_peptide MF618348_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate OHBV-HIV137). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MF925358_HBe_P-D Product feature CHAIN MF925358_HBe_P-D of FT:mat_peptide MF925358_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV01). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MF925364_HBe_P-D Product feature CHAIN MF925364_HBe_P-D of FT:mat_peptide MF925364_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV08). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MF925391_HBe_P-D Product feature CHAIN MF925391_HBe_P-D of FT:mat_peptide MF925391_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV35). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVR
RRGR
>gnl|hbvpro|MF925393_HBe_P-D Product feature CHAIN MF925393_HBe_P-D of FT:mat_peptide MF925393_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BD-HBV38). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491124_HBe_P-D Product feature CHAIN MG491124_HBe_P-D of FT:mat_peptide MG491124_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan1HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNLGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491127_HBe_P-D Product feature CHAIN MG491127_HBe_P-D of FT:mat_peptide MG491127_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan5HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491129_HBe_P-D Product feature CHAIN MG491129_HBe_P-D of FT:mat_peptide MG491129_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan7HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVR
RRCR
>gnl|hbvpro|MG491130_HBe_P-D Product feature CHAIN MG491130_HBe_P-D of FT:mat_peptide MG491130_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan8HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MG491134_HBe_P-D Product feature CHAIN MG491134_HBe_P-D of FT:mat_peptide MG491134_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan12HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLASFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491136_HBe_P-D Product feature CHAIN MG491136_HBe_P-D of FT:mat_peptide MG491136_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan14HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491137_HBe_P-D Product feature CHAIN MG491137_HBe_P-D of FT:mat_peptide MG491137_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan15HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALCREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491138_HBe_P-D Product feature CHAIN MG491138_HBe_P-D of FT:mat_peptide MG491138_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan16HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALGQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491143_HBe_P-D Product feature CHAIN MG491143_HBe_P-D of FT:mat_peptide MG491143_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan21HC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLDDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491151_HBe_P-D Product feature CHAIN MG491151_HBe_P-D of FT:mat_peptide MG491151_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan29TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMNIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491157_HBe_P-D Product feature CHAIN MG491157_HBe_P-D of FT:mat_peptide MG491157_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan35TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491161_HBe_P-D Product feature CHAIN MG491161_HBe_P-D of FT:mat_peptide MG491161_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan39TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491165_HBe_P-D Product feature CHAIN MG491165_HBe_P-D of FT:mat_peptide MG491165_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan43TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491168_HBe_P-D Product feature CHAIN MG491168_HBe_P-D of FT:mat_peptide MG491168_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan46TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491169_HBe_P-D Product feature CHAIN MG491169_HBe_P-D of FT:mat_peptide MG491169_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan47TC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491175_HBe_P-D Product feature CHAIN MG491175_HBe_P-D of FT:mat_peptide MG491175_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan54CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491181_HBe_P-D Product feature CHAIN MG491181_HBe_P-D of FT:mat_peptide MG491181_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan60CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|MG491182_HBe_P-D Product feature CHAIN MG491182_HBe_P-D of FT:mat_peptide MG491182_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan61CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491186_HBe_P-D Product feature CHAIN MG491186_HBe_P-D of FT:mat_peptide MG491186_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan65CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLEDPVSRDLVVGYVNTTVGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MG491187_HBe_P-D Product feature CHAIN MG491187_HBe_P-D of FT:mat_peptide MG491187_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan66CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVIR
RRGR
>gnl|hbvpro|MG491190_HBe_P-D Product feature CHAIN MG491190_HBe_P-D of FT:mat_peptide MG491190_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan69CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MG491192_HBe_P-D Product feature CHAIN MG491192_HBe_P-D of FT:mat_peptide MG491192_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate ShrSan71CC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH464832_HBe_P-D Product feature CHAIN MH464832_HBe_P-D of FT:mat_peptide MH464832_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MA110). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
CLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLATWVG
VNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVRRRX
XXR
>gnl|hbvpro|MH724214_HBe_P-D Product feature CHAIN MH724214_HBe_P-D of FT:mat_peptide MH724214_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724216_HBe_P-D Product feature CHAIN MH724216_HBe_P-D of FT:mat_peptide MH724216_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR5). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724217_HBe_P-D Product feature CHAIN MH724217_HBe_P-D of FT:mat_peptide MH724217_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724218_HBe_P-D Product feature CHAIN MH724218_HBe_P-D of FT:mat_peptide MH724218_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724219_HBe_P-D Product feature CHAIN MH724219_HBe_P-D of FT:mat_peptide MH724219_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR9). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724221_HBe_P-D Product feature CHAIN MH724221_HBe_P-D of FT:mat_peptide MH724221_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724223_HBe_P-D Product feature CHAIN MH724223_HBe_P-D of FT:mat_peptide MH724223_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR13). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724224_HBe_P-D Product feature CHAIN MH724224_HBe_P-D of FT:mat_peptide MH724224_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIYPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLRFRQLWGFHFSGLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724225_HBe_P-D Product feature CHAIN MH724225_HBe_P-D of FT:mat_peptide MH724225_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGAXGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLRILAT
WVGVNLKDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724226_HBe_P-D Product feature CHAIN MH724226_HBe_P-D of FT:mat_peptide MH724226_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR17). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCLGELMTLAT
WVGVNLEDPASRDLVVSYFNINMGLKFRQLLWFHISCLTLGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|MH724227_HBe_P-D Product feature CHAIN MH724227_HBe_P-D of FT:mat_peptide MH724227_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR18). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELRTLAT
WVGVNLEDPASRDLEFSYVNPNMGLKFRQLLGFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724228_HBe_P-D Product feature CHAIN MH724228_HBe_P-D of FT:mat_peptide MH724228_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR19). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDSASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASKDQESSYVNTNMGLKFRQLLGFHISCLTFGKETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724229_HBe_P-D Product feature CHAIN MH724229_HBe_P-D of FT:mat_peptide MH724229_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR20). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEQCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLIFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724230_HBe_P-D Product feature CHAIN MH724230_HBe_P-D of FT:mat_peptide MH724230_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR21). Complete genome. [Hepadnaviridae] (length=164 residues).
FQLCLGWVWGMDLYPYKEIGASGEFLLFFPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELRTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724231_HBe_P-D Product feature CHAIN MH724231_HBe_P-D of FT:mat_peptide MH724231_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR22). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724234_HBe_P-D Product feature CHAIN MH724234_HBe_P-D of FT:mat_peptide MH724234_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR25). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREGLESPDHCTPHHTALRQAILCWGELMTLAT
WVGANLEDQPSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MH724237_HBe_P-D Product feature CHAIN MH724237_HBe_P-D of FT:mat_peptide MH724237_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGANLEDPASRELVVSYVNTNIALKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724244_HBe_P-D Product feature CHAIN MH724244_HBe_P-D of FT:mat_peptide MH724244_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR36). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHHSCLTFGKKTVIEHLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724247_HBe_P-D Product feature CHAIN MH724247_HBe_P-D of FT:mat_peptide MH724247_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR39). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHSALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLGFHISCLTFGRKTVXEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724248_HBe_P-D Product feature CHAIN MH724248_HBe_P-D of FT:mat_peptide MH724248_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDLDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELRTLAT
WVGVNLEDPPSKNLLFIYVNPNRGLKFRQLWGFPFSGPIFGRETVXEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724249_HBe_P-D Product feature CHAIN MH724249_HBe_P-D of FT:mat_peptide MH724249_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR42). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724250_HBe_P-D Product feature CHAIN MH724250_HBe_P-D of FT:mat_peptide MH724250_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR43). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724252_HBe_P-D Product feature CHAIN MH724252_HBe_P-D of FT:mat_peptide MH724252_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BR48). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEQCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724954_HBe_P-D Product feature CHAIN MH724954_HBe_P-D of FT:mat_peptide MH724954_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724955_HBe_P-D Product feature CHAIN MH724955_HBe_P-D of FT:mat_peptide MH724955_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724956_HBe_P-D Product feature CHAIN MH724956_HBe_P-D of FT:mat_peptide MH724956_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724958_HBe_P-D Product feature CHAIN MH724958_HBe_P-D of FT:mat_peptide MH724958_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724959_HBe_P-D Product feature CHAIN MH724959_HBe_P-D of FT:mat_peptide MH724959_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPLNAPILSTLPETSVVR
RRGR
>gnl|hbvpro|MH724960_HBe_P-D Product feature CHAIN MH724960_HBe_P-D of FT:mat_peptide MH724960_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724961_HBe_P-D Product feature CHAIN MH724961_HBe_P-D of FT:mat_peptide MH724961_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724962_HBe_P-D Product feature CHAIN MH724962_HBe_P-D of FT:mat_peptide MH724962_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVQLLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGGNLEDQPSRDLVVSYVNTNMGLKFRQLLWFHLSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724963_HBe_P-D Product feature CHAIN MH724963_HBe_P-D of FT:mat_peptide MH724963_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724964_HBe_P-D Product feature CHAIN MH724964_HBe_P-D of FT:mat_peptide MH724964_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724965_HBe_P-D Product feature CHAIN MH724965_HBe_P-D of FT:mat_peptide MH724965_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-39). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724966_HBe_P-D Product feature CHAIN MH724966_HBe_P-D of FT:mat_peptide MH724966_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724967_HBe_P-D Product feature CHAIN MH724967_HBe_P-D of FT:mat_peptide MH724967_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724968_HBe_P-D Product feature CHAIN MH724968_HBe_P-D of FT:mat_peptide MH724968_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-48). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESREHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724969_HBe_P-D Product feature CHAIN MH724969_HBe_P-D of FT:mat_peptide MH724969_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724970_HBe_P-D Product feature CHAIN MH724970_HBe_P-D of FT:mat_peptide MH724970_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-57). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDSYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724971_HBe_P-D Product feature CHAIN MH724971_HBe_P-D of FT:mat_peptide MH724971_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-62). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724972_HBe_P-D Product feature CHAIN MH724972_HBe_P-D of FT:mat_peptide MH724972_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-64). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MH724973_HBe_P-D Product feature CHAIN MH724973_HBe_P-D of FT:mat_peptide MH724973_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-65). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRGLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724974_HBe_P-D Product feature CHAIN MH724974_HBe_P-D of FT:mat_peptide MH724974_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-68). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724975_HBe_P-D Product feature CHAIN MH724975_HBe_P-D of FT:mat_peptide MH724975_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-102). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724976_HBe_P-D Product feature CHAIN MH724976_HBe_P-D of FT:mat_peptide MH724976_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-111). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLHTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724977_HBe_P-D Product feature CHAIN MH724977_HBe_P-D of FT:mat_peptide MH724977_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-119). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724978_HBe_P-D Product feature CHAIN MH724978_HBe_P-D of FT:mat_peptide MH724978_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-124). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPQDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDQQSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MH724979_HBe_P-D Product feature CHAIN MH724979_HBe_P-D of FT:mat_peptide MH724979_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-126). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724980_HBe_P-D Product feature CHAIN MH724980_HBe_P-D of FT:mat_peptide MH724980_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-128). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724981_HBe_P-D Product feature CHAIN MH724981_HBe_P-D of FT:mat_peptide MH724981_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-130). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724982_HBe_P-D Product feature CHAIN MH724982_HBe_P-D of FT:mat_peptide MH724982_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-134). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724983_HBe_P-D Product feature CHAIN MH724983_HBe_P-D of FT:mat_peptide MH724983_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-137). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724984_HBe_P-D Product feature CHAIN MH724984_HBe_P-D of FT:mat_peptide MH724984_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-138). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYREFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724985_HBe_P-D Product feature CHAIN MH724985_HBe_P-D of FT:mat_peptide MH724985_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-139). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724986_HBe_P-D Product feature CHAIN MH724986_HBe_P-D of FT:mat_peptide MH724986_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-140). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724987_HBe_P-D Product feature CHAIN MH724987_HBe_P-D of FT:mat_peptide MH724987_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-141). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724988_HBe_P-D Product feature CHAIN MH724988_HBe_P-D of FT:mat_peptide MH724988_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-142). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724989_HBe_P-D Product feature CHAIN MH724989_HBe_P-D of FT:mat_peptide MH724989_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-143). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724990_HBe_P-D Product feature CHAIN MH724990_HBe_P-D of FT:mat_peptide MH724990_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-145). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRGR
>gnl|hbvpro|MH724991_HBe_P-D Product feature CHAIN MH724991_HBe_P-D of FT:mat_peptide MH724991_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-149). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724992_HBe_P-D Product feature CHAIN MH724992_HBe_P-D of FT:mat_peptide MH724992_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-153). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLST
WVGSNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724993_HBe_P-D Product feature CHAIN MH724993_HBe_P-D of FT:mat_peptide MH724993_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-158). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724994_HBe_P-D Product feature CHAIN MH724994_HBe_P-D of FT:mat_peptide MH724994_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-160). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724995_HBe_P-D Product feature CHAIN MH724995_HBe_P-D of FT:mat_peptide MH724995_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-178). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724996_HBe_P-D Product feature CHAIN MH724996_HBe_P-D of FT:mat_peptide MH724996_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-182). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724997_HBe_P-D Product feature CHAIN MH724997_HBe_P-D of FT:mat_peptide MH724997_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-183). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724998_HBe_P-D Product feature CHAIN MH724998_HBe_P-D of FT:mat_peptide MH724998_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-186). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH724999_HBe_P-D Product feature CHAIN MH724999_HBe_P-D of FT:mat_peptide MH724999_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-187). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFVPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVAR
RRGR
>gnl|hbvpro|MH725001_HBe_P-D Product feature CHAIN MH725001_HBe_P-D of FT:mat_peptide MH725001_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-200). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFSPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725002_HBe_P-D Product feature CHAIN MH725002_HBe_P-D of FT:mat_peptide MH725002_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-215). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725003_HBe_P-D Product feature CHAIN MH725003_HBe_P-D of FT:mat_peptide MH725003_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-216). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725004_HBe_P-D Product feature CHAIN MH725004_HBe_P-D of FT:mat_peptide MH725004_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-220). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHIPCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725005_HBe_P-D Product feature CHAIN MH725005_HBe_P-D of FT:mat_peptide MH725005_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-224). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFSSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725006_HBe_P-D Product feature CHAIN MH725006_HBe_P-D of FT:mat_peptide MH725006_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-231). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725007_HBe_P-D Product feature CHAIN MH725007_HBe_P-D of FT:mat_peptide MH725007_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-250). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725008_HBe_P-D Product feature CHAIN MH725008_HBe_P-D of FT:mat_peptide MH725008_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-254). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASTLYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725009_HBe_P-D Product feature CHAIN MH725009_HBe_P-D of FT:mat_peptide MH725009_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-257). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725011_HBe_P-D Product feature CHAIN MH725011_HBe_P-D of FT:mat_peptide MH725011_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-264). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SQLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725012_HBe_P-D Product feature CHAIN MH725012_HBe_P-D of FT:mat_peptide MH725012_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-267). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725013_HBe_P-D Product feature CHAIN MH725013_HBe_P-D of FT:mat_peptide MH725013_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-273). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSLGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725014_HBe_P-D Product feature CHAIN MH725014_HBe_P-D of FT:mat_peptide MH725014_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-274). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725015_HBe_P-D Product feature CHAIN MH725015_HBe_P-D of FT:mat_peptide MH725015_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-276). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725016_HBe_P-D Product feature CHAIN MH725016_HBe_P-D of FT:mat_peptide MH725016_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-277). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725017_HBe_P-D Product feature CHAIN MH725017_HBe_P-D of FT:mat_peptide MH725017_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-288). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725018_HBe_P-D Product feature CHAIN MH725018_HBe_P-D of FT:mat_peptide MH725018_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-289). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725019_HBe_P-D Product feature CHAIN MH725019_HBe_P-D of FT:mat_peptide MH725019_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-297). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725022_HBe_P-D Product feature CHAIN MH725022_HBe_P-D of FT:mat_peptide MH725022_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Sa-314). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725023_HBe_P-D Product feature CHAIN MH725023_HBe_P-D of FT:mat_peptide MH725023_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-320). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725025_HBe_P-D Product feature CHAIN MH725025_HBe_P-D of FT:mat_peptide MH725025_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-336). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725026_HBe_P-D Product feature CHAIN MH725026_HBe_P-D of FT:mat_peptide MH725026_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-346). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725027_HBe_P-D Product feature CHAIN MH725027_HBe_P-D of FT:mat_peptide MH725027_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-348). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725028_HBe_P-D Product feature CHAIN MH725028_HBe_P-D of FT:mat_peptide MH725028_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-351). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGKLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725029_HBe_P-D Product feature CHAIN MH725029_HBe_P-D of FT:mat_peptide MH725029_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-354). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725030_HBe_P-D Product feature CHAIN MH725030_HBe_P-D of FT:mat_peptide MH725030_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-357). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725031_HBe_P-D Product feature CHAIN MH725031_HBe_P-D of FT:mat_peptide MH725031_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-359). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725032_HBe_P-D Product feature CHAIN MH725032_HBe_P-D of FT:mat_peptide MH725032_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-360). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725033_HBe_P-D Product feature CHAIN MH725033_HBe_P-D of FT:mat_peptide MH725033_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-365). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725034_HBe_P-D Product feature CHAIN MH725034_HBe_P-D of FT:mat_peptide MH725034_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-368). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725035_HBe_P-D Product feature CHAIN MH725035_HBe_P-D of FT:mat_peptide MH725035_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-372). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725036_HBe_P-D Product feature CHAIN MH725036_HBe_P-D of FT:mat_peptide MH725036_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-373). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725037_HBe_P-D Product feature CHAIN MH725037_HBe_P-D of FT:mat_peptide MH725037_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-374). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725039_HBe_P-D Product feature CHAIN MH725039_HBe_P-D of FT:mat_peptide MH725039_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-378). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725040_HBe_P-D Product feature CHAIN MH725040_HBe_P-D of FT:mat_peptide MH725040_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-380). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725041_HBe_P-D Product feature CHAIN MH725041_HBe_P-D of FT:mat_peptide MH725041_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-386). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725044_HBe_P-D Product feature CHAIN MH725044_HBe_P-D of FT:mat_peptide MH725044_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-400). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725045_HBe_P-D Product feature CHAIN MH725045_HBe_P-D of FT:mat_peptide MH725045_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-433). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLQDPVSRDLVVSYVNSHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725046_HBe_P-D Product feature CHAIN MH725046_HBe_P-D of FT:mat_peptide MH725046_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-436). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725047_HBe_P-D Product feature CHAIN MH725047_HBe_P-D of FT:mat_peptide MH725047_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-437). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725048_HBe_P-D Product feature CHAIN MH725048_HBe_P-D of FT:mat_peptide MH725048_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-462). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725049_HBe_P-D Product feature CHAIN MH725049_HBe_P-D of FT:mat_peptide MH725049_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-463). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725050_HBe_P-D Product feature CHAIN MH725050_HBe_P-D of FT:mat_peptide MH725050_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-465). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLEDPVSRDLVVSYVNSQVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725051_HBe_P-D Product feature CHAIN MH725051_HBe_P-D of FT:mat_peptide MH725051_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-467). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725052_HBe_P-D Product feature CHAIN MH725052_HBe_P-D of FT:mat_peptide MH725052_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-470). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725053_HBe_P-D Product feature CHAIN MH725053_HBe_P-D of FT:mat_peptide MH725053_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-474). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725054_HBe_P-D Product feature CHAIN MH725054_HBe_P-D of FT:mat_peptide MH725054_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-478). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNINMGLKFRQLLWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725055_HBe_P-D Product feature CHAIN MH725055_HBe_P-D of FT:mat_peptide MH725055_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-480). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725056_HBe_P-D Product feature CHAIN MH725056_HBe_P-D of FT:mat_peptide MH725056_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-481). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725057_HBe_P-D Product feature CHAIN MH725057_HBe_P-D of FT:mat_peptide MH725057_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-482). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725058_HBe_P-D Product feature CHAIN MH725058_HBe_P-D of FT:mat_peptide MH725058_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-485). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725059_HBe_P-D Product feature CHAIN MH725059_HBe_P-D of FT:mat_peptide MH725059_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-512). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725060_HBe_P-D Product feature CHAIN MH725060_HBe_P-D of FT:mat_peptide MH725060_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-516). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725061_HBe_P-D Product feature CHAIN MH725061_HBe_P-D of FT:mat_peptide MH725061_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-517). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725062_HBe_P-D Product feature CHAIN MH725062_HBe_P-D of FT:mat_peptide MH725062_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-518). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725063_HBe_P-D Product feature CHAIN MH725063_HBe_P-D of FT:mat_peptide MH725063_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-524). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725064_HBe_P-D Product feature CHAIN MH725064_HBe_P-D of FT:mat_peptide MH725064_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-527). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725065_HBe_P-D Product feature CHAIN MH725065_HBe_P-D of FT:mat_peptide MH725065_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-530). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725066_HBe_P-D Product feature CHAIN MH725066_HBe_P-D of FT:mat_peptide MH725066_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-535). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRNLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725067_HBe_P-D Product feature CHAIN MH725067_HBe_P-D of FT:mat_peptide MH725067_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-538). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRNLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725068_HBe_P-D Product feature CHAIN MH725068_HBe_P-D of FT:mat_peptide MH725068_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-541). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATAELLLFLPYDFFPSVRDFIDTASALYREASESPEHCSPHHTAIRQAIFSLGELMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725069_HBe_P-D Product feature CHAIN MH725069_HBe_P-D of FT:mat_peptide MH725069_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-544). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725070_HBe_P-D Product feature CHAIN MH725070_HBe_P-D of FT:mat_peptide MH725070_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-548). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSLGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725071_HBe_P-D Product feature CHAIN MH725071_HBe_P-D of FT:mat_peptide MH725071_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-549). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNANMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725072_HBe_P-D Product feature CHAIN MH725072_HBe_P-D of FT:mat_peptide MH725072_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-550). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVR
RRGR
>gnl|hbvpro|MH725073_HBe_P-D Product feature CHAIN MH725073_HBe_P-D of FT:mat_peptide MH725073_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-552). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725074_HBe_P-D Product feature CHAIN MH725074_HBe_P-D of FT:mat_peptide MH725074_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-554). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725075_HBe_P-D Product feature CHAIN MH725075_HBe_P-D of FT:mat_peptide MH725075_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-559). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725076_HBe_P-D Product feature CHAIN MH725076_HBe_P-D of FT:mat_peptide MH725076_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-560). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGKLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725077_HBe_P-D Product feature CHAIN MH725077_HBe_P-D of FT:mat_peptide MH725077_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-561). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725078_HBe_P-D Product feature CHAIN MH725078_HBe_P-D of FT:mat_peptide MH725078_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-568). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725079_HBe_P-D Product feature CHAIN MH725079_HBe_P-D of FT:mat_peptide MH725079_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-571). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725080_HBe_P-D Product feature CHAIN MH725080_HBe_P-D of FT:mat_peptide MH725080_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-572). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725081_HBe_P-D Product feature CHAIN MH725081_HBe_P-D of FT:mat_peptide MH725081_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-573). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725082_HBe_P-D Product feature CHAIN MH725082_HBe_P-D of FT:mat_peptide MH725082_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-574). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725083_HBe_P-D Product feature CHAIN MH725083_HBe_P-D of FT:mat_peptide MH725083_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-597). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725084_HBe_P-D Product feature CHAIN MH725084_HBe_P-D of FT:mat_peptide MH725084_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-606). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725085_HBe_P-D Product feature CHAIN MH725085_HBe_P-D of FT:mat_peptide MH725085_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-622). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725086_HBe_P-D Product feature CHAIN MH725086_HBe_P-D of FT:mat_peptide MH725086_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-624). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725087_HBe_P-D Product feature CHAIN MH725087_HBe_P-D of FT:mat_peptide MH725087_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-646). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725088_HBe_P-D Product feature CHAIN MH725088_HBe_P-D of FT:mat_peptide MH725088_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-652). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725089_HBe_P-D Product feature CHAIN MH725089_HBe_P-D of FT:mat_peptide MH725089_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-653). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKPCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725090_HBe_P-D Product feature CHAIN MH725090_HBe_P-D of FT:mat_peptide MH725090_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-683). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWLHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPTLSTLPETTVVR
RRGR
>gnl|hbvpro|MH725091_HBe_P-D Product feature CHAIN MH725091_HBe_P-D of FT:mat_peptide MH725091_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-685). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPFDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725092_HBe_P-D Product feature CHAIN MH725092_HBe_P-D of FT:mat_peptide MH725092_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-686). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPFDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725093_HBe_P-D Product feature CHAIN MH725093_HBe_P-D of FT:mat_peptide MH725093_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-699). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725094_HBe_P-D Product feature CHAIN MH725094_HBe_P-D of FT:mat_peptide MH725094_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-700). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLEDPVSRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725095_HBe_P-D Product feature CHAIN MH725095_HBe_P-D of FT:mat_peptide MH725095_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-707). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLHFDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLTT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725096_HBe_P-D Product feature CHAIN MH725096_HBe_P-D of FT:mat_peptide MH725096_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-708). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MH725097_HBe_P-D Product feature CHAIN MH725097_HBe_P-D of FT:mat_peptide MH725097_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-710). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MH725098_HBe_P-D Product feature CHAIN MH725098_HBe_P-D of FT:mat_peptide MH725098_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-712). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725099_HBe_P-D Product feature CHAIN MH725099_HBe_P-D of FT:mat_peptide MH725099_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-714). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725100_HBe_P-D Product feature CHAIN MH725100_HBe_P-D of FT:mat_peptide MH725100_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725101_HBe_P-D Product feature CHAIN MH725101_HBe_P-D of FT:mat_peptide MH725101_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-720). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMILAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYKPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725102_HBe_P-D Product feature CHAIN MH725102_HBe_P-D of FT:mat_peptide MH725102_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-722). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPVSRDLVVSYVNINMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725103_HBe_P-D Product feature CHAIN MH725103_HBe_P-D of FT:mat_peptide MH725103_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-725). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725104_HBe_P-D Product feature CHAIN MH725104_HBe_P-D of FT:mat_peptide MH725104_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-769). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725105_HBe_P-D Product feature CHAIN MH725105_HBe_P-D of FT:mat_peptide MH725105_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-774). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725106_HBe_P-D Product feature CHAIN MH725106_HBe_P-D of FT:mat_peptide MH725106_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-789). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725107_HBe_P-D Product feature CHAIN MH725107_HBe_P-D of FT:mat_peptide MH725107_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-804). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725108_HBe_P-D Product feature CHAIN MH725108_HBe_P-D of FT:mat_peptide MH725108_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-808). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISRLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725109_HBe_P-D Product feature CHAIN MH725109_HBe_P-D of FT:mat_peptide MH725109_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-809). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLEDPVSRDLVVSYVNSQVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725110_HBe_P-D Product feature CHAIN MH725110_HBe_P-D of FT:mat_peptide MH725110_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-830). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MH725111_HBe_P-D Product feature CHAIN MH725111_HBe_P-D of FT:mat_peptide MH725111_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-845). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725112_HBe_P-D Product feature CHAIN MH725112_HBe_P-D of FT:mat_peptide MH725112_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-848). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725113_HBe_P-D Product feature CHAIN MH725113_HBe_P-D of FT:mat_peptide MH725113_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-867). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725115_HBe_P-D Product feature CHAIN MH725115_HBe_P-D of FT:mat_peptide MH725115_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-869). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725116_HBe_P-D Product feature CHAIN MH725116_HBe_P-D of FT:mat_peptide MH725116_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-942). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725117_HBe_P-D Product feature CHAIN MH725117_HBe_P-D of FT:mat_peptide MH725117_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-947). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725118_HBe_P-D Product feature CHAIN MH725118_HBe_P-D of FT:mat_peptide MH725118_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-873). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MH725119_HBe_P-D Product feature CHAIN MH725119_HBe_P-D of FT:mat_peptide MH725119_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-956). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725120_HBe_P-D Product feature CHAIN MH725120_HBe_P-D of FT:mat_peptide MH725120_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-960). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725121_HBe_P-D Product feature CHAIN MH725121_HBe_P-D of FT:mat_peptide MH725121_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-961). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725122_HBe_P-D Product feature CHAIN MH725122_HBe_P-D of FT:mat_peptide MH725122_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-877). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725123_HBe_P-D Product feature CHAIN MH725123_HBe_P-D of FT:mat_peptide MH725123_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-982). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGKGIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725124_HBe_P-D Product feature CHAIN MH725124_HBe_P-D of FT:mat_peptide MH725124_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-977). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRKTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725125_HBe_P-D Product feature CHAIN MH725125_HBe_P-D of FT:mat_peptide MH725125_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-978). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTAIRQASFCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRGR
>gnl|hbvpro|MH725126_HBe_P-D Product feature CHAIN MH725126_HBe_P-D of FT:mat_peptide MH725126_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLEDPVSRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
GRGR
>gnl|hbvpro|MH725127_HBe_P-D Product feature CHAIN MH725127_HBe_P-D of FT:mat_peptide MH725127_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-980). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725128_HBe_P-D Product feature CHAIN MH725128_HBe_P-D of FT:mat_peptide MH725128_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-984). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725129_HBe_P-D Product feature CHAIN MH725129_HBe_P-D of FT:mat_peptide MH725129_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1000). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725130_HBe_P-D Product feature CHAIN MH725130_HBe_P-D of FT:mat_peptide MH725130_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1001). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725131_HBe_P-D Product feature CHAIN MH725131_HBe_P-D of FT:mat_peptide MH725131_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725132_HBe_P-D Product feature CHAIN MH725132_HBe_P-D of FT:mat_peptide MH725132_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1051). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725133_HBe_P-D Product feature CHAIN MH725133_HBe_P-D of FT:mat_peptide MH725133_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1054). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725134_HBe_P-D Product feature CHAIN MH725134_HBe_P-D of FT:mat_peptide MH725134_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1057). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725135_HBe_P-D Product feature CHAIN MH725135_HBe_P-D of FT:mat_peptide MH725135_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1084). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVGYVNSNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPLPYRPANAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MH725136_HBe_P-D Product feature CHAIN MH725136_HBe_P-D of FT:mat_peptide MH725136_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYWEALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725137_HBe_P-D Product feature CHAIN MH725137_HBe_P-D of FT:mat_peptide MH725137_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1112). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725138_HBe_P-D Product feature CHAIN MH725138_HBe_P-D of FT:mat_peptide MH725138_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1115). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725139_HBe_P-D Product feature CHAIN MH725139_HBe_P-D of FT:mat_peptide MH725139_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1201). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWYHVSCLTFGRETVGEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|MH725140_HBe_P-D Product feature CHAIN MH725140_HBe_P-D of FT:mat_peptide MH725140_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1210). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725142_HBe_P-D Product feature CHAIN MH725142_HBe_P-D of FT:mat_peptide MH725142_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1230). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYWEALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725143_HBe_P-D Product feature CHAIN MH725143_HBe_P-D of FT:mat_peptide MH725143_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1238). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725144_HBe_P-D Product feature CHAIN MH725144_HBe_P-D of FT:mat_peptide MH725144_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1266). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLNDPTSRDLVVSYVNNNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725145_HBe_P-D Product feature CHAIN MH725145_HBe_P-D of FT:mat_peptide MH725145_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1281). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725146_HBe_P-D Product feature CHAIN MH725146_HBe_P-D of FT:mat_peptide MH725146_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1330). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725147_HBe_P-D Product feature CHAIN MH725147_HBe_P-D of FT:mat_peptide MH725147_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1354). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725148_HBe_P-D Product feature CHAIN MH725148_HBe_P-D of FT:mat_peptide MH725148_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1356). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGVDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725149_HBe_P-D Product feature CHAIN MH725149_HBe_P-D of FT:mat_peptide MH725149_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1362). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725150_HBe_P-D Product feature CHAIN MH725150_HBe_P-D of FT:mat_peptide MH725150_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1367). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725151_HBe_P-D Product feature CHAIN MH725151_HBe_P-D of FT:mat_peptide MH725151_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1375). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725152_HBe_P-D Product feature CHAIN MH725152_HBe_P-D of FT:mat_peptide MH725152_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1396). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725153_HBe_P-D Product feature CHAIN MH725153_HBe_P-D of FT:mat_peptide MH725153_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1590). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLGLGWLWGMDIDPYKEFGASVELLSFLPEDFFPSVRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMSLAT
WVGGNLEDPISRDLVVGYVNTHKGLKFRQLLWFHISCLTFGKETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725154_HBe_P-D Product feature CHAIN MH725154_HBe_P-D of FT:mat_peptide MH725154_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1616). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725155_HBe_P-D Product feature CHAIN MH725155_HBe_P-D of FT:mat_peptide MH725155_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1626). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725156_HBe_P-D Product feature CHAIN MH725156_HBe_P-D of FT:mat_peptide MH725156_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1637). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725157_HBe_P-D Product feature CHAIN MH725157_HBe_P-D of FT:mat_peptide MH725157_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1659). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725158_HBe_P-D Product feature CHAIN MH725158_HBe_P-D of FT:mat_peptide MH725158_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1677). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725159_HBe_P-D Product feature CHAIN MH725159_HBe_P-D of FT:mat_peptide MH725159_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1714). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725160_HBe_P-D Product feature CHAIN MH725160_HBe_P-D of FT:mat_peptide MH725160_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1735). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725161_HBe_P-D Product feature CHAIN MH725161_HBe_P-D of FT:mat_peptide MH725161_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1737). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725162_HBe_P-D Product feature CHAIN MH725162_HBe_P-D of FT:mat_peptide MH725162_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1744). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725163_HBe_P-D Product feature CHAIN MH725163_HBe_P-D of FT:mat_peptide MH725163_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1751). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725164_HBe_P-D Product feature CHAIN MH725164_HBe_P-D of FT:mat_peptide MH725164_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1761). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGMWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725165_HBe_P-D Product feature CHAIN MH725165_HBe_P-D of FT:mat_peptide MH725165_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1778). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725166_HBe_P-D Product feature CHAIN MH725166_HBe_P-D of FT:mat_peptide MH725166_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1806). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725167_HBe_P-D Product feature CHAIN MH725167_HBe_P-D of FT:mat_peptide MH725167_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1808). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725168_HBe_P-D Product feature CHAIN MH725168_HBe_P-D of FT:mat_peptide MH725168_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1050). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIPCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725169_HBe_P-D Product feature CHAIN MH725169_HBe_P-D of FT:mat_peptide MH725169_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1052). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPYHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725170_HBe_P-D Product feature CHAIN MH725170_HBe_P-D of FT:mat_peptide MH725170_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1053). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725171_HBe_P-D Product feature CHAIN MH725171_HBe_P-D of FT:mat_peptide MH725171_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1066). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPQAYRPTNAPILSMLPETAVVR
SRCR
>gnl|hbvpro|MH725172_HBe_P-D Product feature CHAIN MH725172_HBe_P-D of FT:mat_peptide MH725172_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1075). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
FQLCLGWLWGMDLDPYKEFGGIVELLFFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLCFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725173_HBe_P-D Product feature CHAIN MH725173_HBe_P-D of FT:mat_peptide MH725173_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1077). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725174_HBe_P-D Product feature CHAIN MH725174_HBe_P-D of FT:mat_peptide MH725174_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1080). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASPLYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725175_HBe_P-D Product feature CHAIN MH725175_HBe_P-D of FT:mat_peptide MH725175_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1082). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725176_HBe_P-D Product feature CHAIN MH725176_HBe_P-D of FT:mat_peptide MH725176_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1104). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725177_HBe_P-D Product feature CHAIN MH725177_HBe_P-D of FT:mat_peptide MH725177_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1177). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725178_HBe_P-D Product feature CHAIN MH725178_HBe_P-D of FT:mat_peptide MH725178_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1206). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725179_HBe_P-D Product feature CHAIN MH725179_HBe_P-D of FT:mat_peptide MH725179_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1242). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725180_HBe_P-D Product feature CHAIN MH725180_HBe_P-D of FT:mat_peptide MH725180_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1264). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725181_HBe_P-D Product feature CHAIN MH725181_HBe_P-D of FT:mat_peptide MH725181_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1265). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725182_HBe_P-D Product feature CHAIN MH725182_HBe_P-D of FT:mat_peptide MH725182_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1315). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725183_HBe_P-D Product feature CHAIN MH725183_HBe_P-D of FT:mat_peptide MH725183_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1316). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725184_HBe_P-D Product feature CHAIN MH725184_HBe_P-D of FT:mat_peptide MH725184_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1327). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725185_HBe_P-D Product feature CHAIN MH725185_HBe_P-D of FT:mat_peptide MH725185_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1328). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|MH725186_HBe_P-D Product feature CHAIN MH725186_HBe_P-D of FT:mat_peptide MH725186_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1331). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WGGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725187_HBe_P-D Product feature CHAIN MH725187_HBe_P-D of FT:mat_peptide MH725187_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1334). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725188_HBe_P-D Product feature CHAIN MH725188_HBe_P-D of FT:mat_peptide MH725188_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1349). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725189_HBe_P-D Product feature CHAIN MH725189_HBe_P-D of FT:mat_peptide MH725189_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1389). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNDNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MH725190_HBe_P-D Product feature CHAIN MH725190_HBe_P-D of FT:mat_peptide MH725190_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1394). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725191_HBe_P-D Product feature CHAIN MH725191_HBe_P-D of FT:mat_peptide MH725191_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1430). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725193_HBe_P-D Product feature CHAIN MH725193_HBe_P-D of FT:mat_peptide MH725193_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1456). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725194_HBe_P-D Product feature CHAIN MH725194_HBe_P-D of FT:mat_peptide MH725194_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1457). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725195_HBe_P-D Product feature CHAIN MH725195_HBe_P-D of FT:mat_peptide MH725195_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1458). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725196_HBe_P-D Product feature CHAIN MH725196_HBe_P-D of FT:mat_peptide MH725196_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1483). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725197_HBe_P-D Product feature CHAIN MH725197_HBe_P-D of FT:mat_peptide MH725197_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1484). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725198_HBe_P-D Product feature CHAIN MH725198_HBe_P-D of FT:mat_peptide MH725198_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1489). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWFWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725199_HBe_P-D Product feature CHAIN MH725199_HBe_P-D of FT:mat_peptide MH725199_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1491). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMELDPYKEFGATVQLLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRHVILCWGDLMNLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
RRGR
>gnl|hbvpro|MH725201_HBe_P-D Product feature CHAIN MH725201_HBe_P-D of FT:mat_peptide MH725201_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1417). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725202_HBe_P-D Product feature CHAIN MH725202_HBe_P-D of FT:mat_peptide MH725202_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1552). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHLSCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MH725203_HBe_P-D Product feature CHAIN MH725203_HBe_P-D of FT:mat_peptide MH725203_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1553). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725204_HBe_P-D Product feature CHAIN MH725204_HBe_P-D of FT:mat_peptide MH725204_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1569). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725205_HBe_P-D Product feature CHAIN MH725205_HBe_P-D of FT:mat_peptide MH725205_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1620). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725206_HBe_P-D Product feature CHAIN MH725206_HBe_P-D of FT:mat_peptide MH725206_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1624). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725207_HBe_P-D Product feature CHAIN MH725207_HBe_P-D of FT:mat_peptide MH725207_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1638). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725208_HBe_P-D Product feature CHAIN MH725208_HBe_P-D of FT:mat_peptide MH725208_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1644). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725209_HBe_P-D Product feature CHAIN MH725209_HBe_P-D of FT:mat_peptide MH725209_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1646). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725210_HBe_P-D Product feature CHAIN MH725210_HBe_P-D of FT:mat_peptide MH725210_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1660). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH725211_HBe_P-D Product feature CHAIN MH725211_HBe_P-D of FT:mat_peptide MH725211_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate SA-1096). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MH932714_HBe_P-D Product feature CHAIN MH932714_HBe_P-D of FT:mat_peptide MH932714_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Hiroshima GtD CL2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK052963_HBe_P-D Product feature CHAIN MK052963_HBe_P-D of FT:mat_peptide MK052963_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGANLDPVSRDLVVSYVNTNMGLKFRQLLWFHYSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRG
RGR
>gnl|hbvpro|MK052966_HBe_P-D Product feature CHAIN MK052966_HBe_P-D of FT:mat_peptide MK052966_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGANLDPVSRDLVVSYVNTNMGLKFRQLLWFHYSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRG
RGR
>gnl|hbvpro|MK052971_HBe_P-D Product feature CHAIN MK052971_HBe_P-D of FT:mat_peptide MK052971_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGANLDPVSRDLVVSYVNTNMGLKFRQLLWFHYSCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRG
RGR
>gnl|hbvpro|MK052972_HBe_P-D Product feature CHAIN MK052972_HBe_P-D of FT:mat_peptide MK052972_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPTVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMSLAT
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLCFGRDTVVAYLVSFGVWIRTPPAYRPPNAPILSTLPEVTVVR
GRGR
>gnl|hbvpro|MK052973_HBe_P-D Product feature CHAIN MK052973_HBe_P-D of FT:mat_peptide MK052973_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-14). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGTNLEDPASRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEVTVVR
GRGR
>gnl|hbvpro|MK052974_HBe_P-D Product feature CHAIN MK052974_HBe_P-D of FT:mat_peptide MK052974_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGANLDPVSRDLVVSYVNTNMGLKFRQLLWFHFSCLTFERDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVRG
RGR
>gnl|hbvpro|MK052975_HBe_P-D Product feature CHAIN MK052975_HBe_P-D of FT:mat_peptide MK052975_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate NP137Q-17). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGTNLEDPASRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLNYLVSFGVWIRTPPAYRPPNAPILSTLPEVTVVR
GRGR
>gnl|hbvpro|MK355500_HBe_P-D Product feature CHAIN MK355500_HBe_P-D of FT:mat_peptide MK355500_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ahvaz30). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK507910_HBe_P-D Product feature CHAIN MK507910_HBe_P-D of FT:mat_peptide MK507910_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HEP/13/0051). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK507911_HBe_P-D Product feature CHAIN MK507911_HBe_P-D of FT:mat_peptide MK507911_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HEP-44). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK507912_HBe_P-D Product feature CHAIN MK507912_HBe_P-D of FT:mat_peptide MK507912_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 012/14/0562). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK507913_HBe_P-D Product feature CHAIN MK507913_HBe_P-D of FT:mat_peptide MK507913_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HEP/14/0134). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK507914_HBe_P-D Product feature CHAIN MK507914_HBe_P-D of FT:mat_peptide MK507914_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 12/16/1214). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK516278_HBe_P-D Product feature CHAIN MK516278_HBe_P-D of FT:mat_peptide MK516278_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HEP-108). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598636_HBe_P-D Product feature CHAIN MK598636_HBe_P-D of FT:mat_peptide MK598636_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598637_HBe_P-D Product feature CHAIN MK598637_HBe_P-D of FT:mat_peptide MK598637_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg22). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598638_HBe_P-D Product feature CHAIN MK598638_HBe_P-D of FT:mat_peptide MK598638_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg13). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598639_HBe_P-D Product feature CHAIN MK598639_HBe_P-D of FT:mat_peptide MK598639_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg47). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598640_HBe_P-D Product feature CHAIN MK598640_HBe_P-D of FT:mat_peptide MK598640_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg18). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598641_HBe_P-D Product feature CHAIN MK598641_HBe_P-D of FT:mat_peptide MK598641_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg26). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598642_HBe_P-D Product feature CHAIN MK598642_HBe_P-D of FT:mat_peptide MK598642_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg59). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598643_HBe_P-D Product feature CHAIN MK598643_HBe_P-D of FT:mat_peptide MK598643_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg34). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598644_HBe_P-D Product feature CHAIN MK598644_HBe_P-D of FT:mat_peptide MK598644_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg62). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598645_HBe_P-D Product feature CHAIN MK598645_HBe_P-D of FT:mat_peptide MK598645_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg46). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598646_HBe_P-D Product feature CHAIN MK598646_HBe_P-D of FT:mat_peptide MK598646_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg71). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPIAYRPPNAPILSTLPETCVVR
QRGR
>gnl|hbvpro|MK598647_HBe_P-D Product feature CHAIN MK598647_HBe_P-D of FT:mat_peptide MK598647_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg55). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598648_HBe_P-D Product feature CHAIN MK598648_HBe_P-D of FT:mat_peptide MK598648_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg58). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRRR
>gnl|hbvpro|MK598649_HBe_P-D Product feature CHAIN MK598649_HBe_P-D of FT:mat_peptide MK598649_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRRR
>gnl|hbvpro|MK598650_HBe_P-D Product feature CHAIN MK598650_HBe_P-D of FT:mat_peptide MK598650_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg69). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598651_HBe_P-D Product feature CHAIN MK598651_HBe_P-D of FT:mat_peptide MK598651_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg45). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598655_HBe_P-D Product feature CHAIN MK598655_HBe_P-D of FT:mat_peptide MK598655_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg39). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598657_HBe_P-D Product feature CHAIN MK598657_HBe_P-D of FT:mat_peptide MK598657_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg50). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598658_HBe_P-D Product feature CHAIN MK598658_HBe_P-D of FT:mat_peptide MK598658_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598659_HBe_P-D Product feature CHAIN MK598659_HBe_P-D of FT:mat_peptide MK598659_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg72). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598660_HBe_P-D Product feature CHAIN MK598660_HBe_P-D of FT:mat_peptide MK598660_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg27). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598661_HBe_P-D Product feature CHAIN MK598661_HBe_P-D of FT:mat_peptide MK598661_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg60). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598662_HBe_P-D Product feature CHAIN MK598662_HBe_P-D of FT:mat_peptide MK598662_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598663_HBe_P-D Product feature CHAIN MK598663_HBe_P-D of FT:mat_peptide MK598663_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg31). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598664_HBe_P-D Product feature CHAIN MK598664_HBe_P-D of FT:mat_peptide MK598664_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg20). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRSTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MK598665_HBe_P-D Product feature CHAIN MK598665_HBe_P-D of FT:mat_peptide MK598665_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg38). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598666_HBe_P-D Product feature CHAIN MK598666_HBe_P-D of FT:mat_peptide MK598666_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg37). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598667_HBe_P-D Product feature CHAIN MK598667_HBe_P-D of FT:mat_peptide MK598667_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg68). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598668_HBe_P-D Product feature CHAIN MK598668_HBe_P-D of FT:mat_peptide MK598668_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598669_HBe_P-D Product feature CHAIN MK598669_HBe_P-D of FT:mat_peptide MK598669_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg42). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598670_HBe_P-D Product feature CHAIN MK598670_HBe_P-D of FT:mat_peptide MK598670_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg36). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598671_HBe_P-D Product feature CHAIN MK598671_HBe_P-D of FT:mat_peptide MK598671_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg30). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598672_HBe_P-D Product feature CHAIN MK598672_HBe_P-D of FT:mat_peptide MK598672_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg53). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598673_HBe_P-D Product feature CHAIN MK598673_HBe_P-D of FT:mat_peptide MK598673_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMALAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598674_HBe_P-D Product feature CHAIN MK598674_HBe_P-D of FT:mat_peptide MK598674_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg66). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDLITLST
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598675_HBe_P-D Product feature CHAIN MK598675_HBe_P-D of FT:mat_peptide MK598675_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg75). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598676_HBe_P-D Product feature CHAIN MK598676_HBe_P-D of FT:mat_peptide MK598676_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVTYVNINMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598677_HBe_P-D Product feature CHAIN MK598677_HBe_P-D of FT:mat_peptide MK598677_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg41). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVQLLSFLPHDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGANLEDPASRELVVTYVNINMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598678_HBe_P-D Product feature CHAIN MK598678_HBe_P-D of FT:mat_peptide MK598678_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg14). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVQLLSFLPHDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLQDPASRELVVTYVNINMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK598679_HBe_P-D Product feature CHAIN MK598679_HBe_P-D of FT:mat_peptide MK598679_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_VNovg33). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLQDPASRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618418_HBe_P-D Product feature CHAIN MK618418_HBe_P-D of FT:mat_peptide MK618418_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618419_HBe_P-D Product feature CHAIN MK618419_HBe_P-D of FT:mat_peptide MK618419_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618420_HBe_P-D Product feature CHAIN MK618420_HBe_P-D of FT:mat_peptide MK618420_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618421_HBe_P-D Product feature CHAIN MK618421_HBe_P-D of FT:mat_peptide MK618421_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh43). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618422_HBe_P-D Product feature CHAIN MK618422_HBe_P-D of FT:mat_peptide MK618422_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh21). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618423_HBe_P-D Product feature CHAIN MK618423_HBe_P-D of FT:mat_peptide MK618423_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELRTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTIPETTVVR
RRGR
>gnl|hbvpro|MK618424_HBe_P-D Product feature CHAIN MK618424_HBe_P-D of FT:mat_peptide MK618424_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh54). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELRTLAT
WVGVNLEDPASRDLVVSYVNTNLGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTIPETTVVR
RRGR
>gnl|hbvpro|MK618425_HBe_P-D Product feature CHAIN MK618425_HBe_P-D of FT:mat_peptide MK618425_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh47). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELRTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTIPETTVVR
RRGR
>gnl|hbvpro|MK618426_HBe_P-D Product feature CHAIN MK618426_HBe_P-D of FT:mat_peptide MK618426_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh3). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618427_HBe_P-D Product feature CHAIN MK618427_HBe_P-D of FT:mat_peptide MK618427_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618428_HBe_P-D Product feature CHAIN MK618428_HBe_P-D of FT:mat_peptide MK618428_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh33). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618429_HBe_P-D Product feature CHAIN MK618429_HBe_P-D of FT:mat_peptide MK618429_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh46). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618430_HBe_P-D Product feature CHAIN MK618430_HBe_P-D of FT:mat_peptide MK618430_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh18). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618431_HBe_P-D Product feature CHAIN MK618431_HBe_P-D of FT:mat_peptide MK618431_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh36). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618432_HBe_P-D Product feature CHAIN MK618432_HBe_P-D of FT:mat_peptide MK618432_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh58). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618433_HBe_P-D Product feature CHAIN MK618433_HBe_P-D of FT:mat_peptide MK618433_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh23). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618434_HBe_P-D Product feature CHAIN MK618434_HBe_P-D of FT:mat_peptide MK618434_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh37). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618435_HBe_P-D Product feature CHAIN MK618435_HBe_P-D of FT:mat_peptide MK618435_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618436_HBe_P-D Product feature CHAIN MK618436_HBe_P-D of FT:mat_peptide MK618436_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh61). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618437_HBe_P-D Product feature CHAIN MK618437_HBe_P-D of FT:mat_peptide MK618437_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh50). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618441_HBe_P-D Product feature CHAIN MK618441_HBe_P-D of FT:mat_peptide MK618441_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh55). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK618443_HBe_P-D Product feature CHAIN MK618443_HBe_P-D of FT:mat_peptide MK618443_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_occult_Arkh44). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK693107_HBe_P-D Product feature CHAIN MK693107_HBe_P-D of FT:mat_peptide MK693107_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ahvaz8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVFSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK693108_HBe_P-D Product feature CHAIN MK693108_HBe_P-D of FT:mat_peptide MK693108_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ahvaz29). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MK693109_HBe_P-D Product feature CHAIN MK693109_HBe_P-D of FT:mat_peptide MK693109_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Ahvaz31). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN310705_HBe_P-D Product feature CHAIN MN310705_HBe_P-D of FT:mat_peptide MN310705_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BG_41_2010). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYREALXSPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN310706_HBe_P-D Product feature CHAIN MN310706_HBe_P-D of FT:mat_peptide MN310706_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BG_20_2010). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN310707_HBe_P-D Product feature CHAIN MN310707_HBe_P-D of FT:mat_peptide MN310707_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CAX_122_2015). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRELVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN310708_HBe_P-D Product feature CHAIN MN310708_HBe_P-D of FT:mat_peptide MN310708_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BG_67_2010). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN310709_HBe_P-D Product feature CHAIN MN310709_HBe_P-D of FT:mat_peptide MN310709_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BG_46_2010). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFYPSVRQLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPTYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN310710_HBe_P-D Product feature CHAIN MN310710_HBe_P-D of FT:mat_peptide MN310710_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CAX_185_2015). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLADPVSRDLVVGYVNTNMGLKFRQLLWFHISCLSFGRQTVIEYLVSFGVWIRTPPAYRPQDAPILSTLPETTVVR
PRGR
>gnl|hbvpro|MN310711_HBe_P-D Product feature CHAIN MN310711_HBe_P-D of FT:mat_peptide MN310711_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CAX_130_2015). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGVNLEDQASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN310712_HBe_P-D Product feature CHAIN MN310712_HBe_P-D of FT:mat_peptide MN310712_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BG_107_2010). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMDLAT
WVGGNLEDQGSRELVVSYVNTNMGLKFRQLLWFHVSCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN310713_HBe_P-D Product feature CHAIN MN310713_HBe_P-D of FT:mat_peptide MN310713_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BG_90_2010). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN310714_HBe_P-D Product feature CHAIN MN310714_HBe_P-D of FT:mat_peptide MN310714_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BG_99_2010). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN310715_HBe_P-D Product feature CHAIN MN310715_HBe_P-D of FT:mat_peptide MN310715_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate CAX_56_2014). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRXLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN507836_HBe_P-D Product feature CHAIN MN507836_HBe_P-D of FT:mat_peptide MN507836_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1037_ocHBVd_GC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLTT
WVGGNLEDPVSRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN507837_HBe_P-D Product feature CHAIN MN507837_HBe_P-D of FT:mat_peptide MN507837_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2505_ocHBVd_GC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFFPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN507838_HBe_P-D Product feature CHAIN MN507838_HBe_P-D of FT:mat_peptide MN507838_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1170_HBVd_GC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN507839_HBe_P-D Product feature CHAIN MN507839_HBe_P-D of FT:mat_peptide MN507839_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1976_ocHBVd_GC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN507851_HBe_P-D Product feature CHAIN MN507851_HBe_P-D of FT:mat_peptide MN507851_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2530_ocHBVd_GC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN507852_HBe_P-D Product feature CHAIN MN507852_HBe_P-D of FT:mat_peptide MN507852_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2562_ocHBVd_GC). Complete genome. [Hepadnaviridae] (length=164 residues).
SNLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN507853_HBe_P-D Product feature CHAIN MN507853_HBe_P-D of FT:mat_peptide MN507853_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2564_ocHBVd_GC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVKTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN585095_HBe_P-D Product feature CHAIN MN585095_HBe_P-D of FT:mat_peptide MN585095_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate MB-96). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MN844881_HBe_P-D Product feature CHAIN MN844881_HBe_P-D of FT:mat_peptide MN844881_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGVNLEDPASREQVVSYVNTNMGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSMLPETSVIR
RRGR
>gnl|hbvpro|MT114169_HBe_P-D Product feature CHAIN MT114169_HBe_P-D of FT:mat_peptide MT114169_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1745). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETCVVR
QRGR
>gnl|hbvpro|MT114173_HBe_P-D Product feature CHAIN MT114173_HBe_P-D of FT:mat_peptide MT114173_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 051). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGDLMNLAT
WVGANLDDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
SRGR
>gnl|hbvpro|MT448619_HBe_P-D Product feature CHAIN MT448619_HBe_P-D of FT:mat_peptide MT448619_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 204P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPASRDLVVGYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQPYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MT579898_HBe_P-D Product feature CHAIN MT579898_HBe_P-D of FT:mat_peptide MT579898_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Nsk-71402). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT579900_HBe_P-D Product feature CHAIN MT579900_HBe_P-D of FT:mat_peptide MT579900_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Nsk-71616). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT579902_HBe_P-D Product feature CHAIN MT579902_HBe_P-D of FT:mat_peptide MT579902_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Nsk-71957). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT579903_HBe_P-D Product feature CHAIN MT579903_HBe_P-D of FT:mat_peptide MT579903_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Nsk-71958). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MT591276_HBe_P-D Product feature CHAIN MT591276_HBe_P-D of FT:mat_peptide MT591276_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BM-1142). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT591278_HBe_P-D Product feature CHAIN MT591278_HBe_P-D of FT:mat_peptide MT591278_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BM-0293). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT591279_HBe_P-D Product feature CHAIN MT591279_HBe_P-D of FT:mat_peptide MT591279_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BM-1430). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT591281_HBe_P-D Product feature CHAIN MT591281_HBe_P-D of FT:mat_peptide MT591281_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BM-0463). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT603385_HBe_P-D Product feature CHAIN MT603385_HBe_P-D of FT:mat_peptide MT603385_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 1509). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT603394_HBe_P-D Product feature CHAIN MT603394_HBe_P-D of FT:mat_peptide MT603394_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2335). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRNDLESPEHCSPHHTALRQAILCWGELMSLAT
WVGVNLEDQGSRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT603396_HBe_P-D Product feature CHAIN MT603396_HBe_P-D of FT:mat_peptide MT603396_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 101161-498572). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGXLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPXXYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT603398_HBe_P-D Product feature CHAIN MT603398_HBe_P-D of FT:mat_peptide MT603398_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2132). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRNALESPEHCSAHHTALRQAILCWGELMTLAT
WVGVNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT603400_HBe_P-D Product feature CHAIN MT603400_HBe_P-D of FT:mat_peptide MT603400_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 417). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT603401_HBe_P-D Product feature CHAIN MT603401_HBe_P-D of FT:mat_peptide MT603401_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 302000479). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT603402_HBe_P-D Product feature CHAIN MT603402_HBe_P-D of FT:mat_peptide MT603402_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 437). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT603403_HBe_P-D Product feature CHAIN MT603403_HBe_P-D of FT:mat_peptide MT603403_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 5180). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MT731920_HBe_P-D Product feature CHAIN MT731920_HBe_P-D of FT:mat_peptide MT731920_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate B6692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTAQALFRQALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRG
>gnl|hbvpro|MW082640_HBe_P-D Product feature CHAIN MW082640_HBe_P-D of FT:mat_peptide MW082640_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate P3_D0). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW455166_HBe_P-D Product feature CHAIN MW455166_HBe_P-D of FT:mat_peptide MW455166_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 3962_ocHBVd_GC). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLTT
WVGGNLEDPVSRDLVVTYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601228_HBe_P-D Product feature CHAIN MW601228_HBe_P-D of FT:mat_peptide MW601228_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601252_HBe_P-D Product feature CHAIN MW601252_HBe_P-D of FT:mat_peptide MW601252_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601253_HBe_P-D Product feature CHAIN MW601253_HBe_P-D of FT:mat_peptide MW601253_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGANLDDPASRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601256_HBe_P-D Product feature CHAIN MW601256_HBe_P-D of FT:mat_peptide MW601256_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601261_HBe_P-D Product feature CHAIN MW601261_HBe_P-D of FT:mat_peptide MW601261_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601262_HBe_P-D Product feature CHAIN MW601262_HBe_P-D of FT:mat_peptide MW601262_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
QRGR
>gnl|hbvpro|MW601266_HBe_P-D Product feature CHAIN MW601266_HBe_P-D of FT:mat_peptide MW601266_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601269_HBe_P-D Product feature CHAIN MW601269_HBe_P-D of FT:mat_peptide MW601269_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601270_HBe_P-D Product feature CHAIN MW601270_HBe_P-D of FT:mat_peptide MW601270_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601274_HBe_P-D Product feature CHAIN MW601274_HBe_P-D of FT:mat_peptide MW601274_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDLDPYKEFGATVELLSFLPADFFPSVRALLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQILWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVIR
QRGR
>gnl|hbvpro|MW601275_HBe_P-D Product feature CHAIN MW601275_HBe_P-D of FT:mat_peptide MW601275_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601278_HBe_P-D Product feature CHAIN MW601278_HBe_P-D of FT:mat_peptide MW601278_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHGTPHHTALRQAILCWGELMTLAT
WVGGNLDDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLIFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601282_HBe_P-D Product feature CHAIN MW601282_HBe_P-D of FT:mat_peptide MW601282_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601286_HBe_P-D Product feature CHAIN MW601286_HBe_P-D of FT:mat_peptide MW601286_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
QRGR
>gnl|hbvpro|MW601288_HBe_P-D Product feature CHAIN MW601288_HBe_P-D of FT:mat_peptide MW601288_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQATLCWGNLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPXPYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MW601292_HBe_P-D Product feature CHAIN MW601292_HBe_P-D of FT:mat_peptide MW601292_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601297_HBe_P-D Product feature CHAIN MW601297_HBe_P-D of FT:mat_peptide MW601297_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVIR
RRGR
>gnl|hbvpro|MW601302_HBe_P-D Product feature CHAIN MW601302_HBe_P-D of FT:mat_peptide MW601302_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601304_HBe_P-D Product feature CHAIN MW601304_HBe_P-D of FT:mat_peptide MW601304_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLLDMDIDPYKEFGASVELLSFLPSDFFPSVRDLIDTASALYREALESSEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHLSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MW601309_HBe_P-D Product feature CHAIN MW601309_HBe_P-D of FT:mat_peptide MW601309_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601313_HBe_P-D Product feature CHAIN MW601313_HBe_P-D of FT:mat_peptide MW601313_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601319_HBe_P-D Product feature CHAIN MW601319_HBe_P-D of FT:mat_peptide MW601319_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601320_HBe_P-D Product feature CHAIN MW601320_HBe_P-D of FT:mat_peptide MW601320_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTVSALYRDALESPEHCTPHHTALRQAILCWGELMNLAT
WVGSNLEDPTSRDLVVAYVNSQMGLKFRQLLWFHLSCITFGRDTVVEYLVSFGVWIRTPAPYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MW601327_HBe_P-D Product feature CHAIN MW601327_HBe_P-D of FT:mat_peptide MW601327_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALKSPEHCSAHHTALRQAILCWGELMTLAT
WVGGNLDDPTSRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601334_HBe_P-D Product feature CHAIN MW601334_HBe_P-D of FT:mat_peptide MW601334_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601335_HBe_P-D Product feature CHAIN MW601335_HBe_P-D of FT:mat_peptide MW601335_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLITLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW601338_HBe_P-D Product feature CHAIN MW601338_HBe_P-D of FT:mat_peptide MW601338_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVQLLSFLPVDFFPSVRDLLDTASALFRDALESPEHCSPHHTAIRQVVLCWGDLMNLAT
WVGGNLEDPVSRDLVVSYVNSNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MW601339_HBe_P-D Product feature CHAIN MW601339_HBe_P-D of FT:mat_peptide MW601339_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGDLMTLST
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW675897_HBe_P-D Product feature CHAIN MW675897_HBe_P-D of FT:mat_peptide MW675897_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LRC47). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MW675898_HBe_P-D Product feature CHAIN MW675898_HBe_P-D of FT:mat_peptide MW675898_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LRC171). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097624_HBe_P-D Product feature CHAIN MZ097624_HBe_P-D of FT:mat_peptide MZ097624_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate BN_302). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQSSRDLVVTYVNTNMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
PRGR
>gnl|hbvpro|MZ097633_HBe_P-D Product feature CHAIN MZ097633_HBe_P-D of FT:mat_peptide MZ097633_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD13_15239). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097640_HBe_P-D Product feature CHAIN MZ097640_HBe_P-D of FT:mat_peptide MZ097640_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD13_24451). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097648_HBe_P-D Product feature CHAIN MZ097648_HBe_P-D of FT:mat_peptide MZ097648_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD13_29024). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097649_HBe_P-D Product feature CHAIN MZ097649_HBe_P-D of FT:mat_peptide MZ097649_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD13_29689). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097654_HBe_P-D Product feature CHAIN MZ097654_HBe_P-D of FT:mat_peptide MZ097654_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD13_41067). Complete genome. [Riboviria] (length=164 residues).
SKLCLRWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPVNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097661_HBe_P-D Product feature CHAIN MZ097661_HBe_P-D of FT:mat_peptide MZ097661_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD14_00715). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
QRGR
>gnl|hbvpro|MZ097666_HBe_P-D Product feature CHAIN MZ097666_HBe_P-D of FT:mat_peptide MZ097666_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD14_06133). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097672_HBe_P-D Product feature CHAIN MZ097672_HBe_P-D of FT:mat_peptide MZ097672_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD14_17735). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097675_HBe_P-D Product feature CHAIN MZ097675_HBe_P-D of FT:mat_peptide MZ097675_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD14_25309). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLINLST
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCITFGKETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MZ097676_HBe_P-D Product feature CHAIN MZ097676_HBe_P-D of FT:mat_peptide MZ097676_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD14_26000). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLQDPTSRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVXR
RRGR
>gnl|hbvpro|MZ097681_HBe_P-D Product feature CHAIN MZ097681_HBe_P-D of FT:mat_peptide MZ097681_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD14_38611). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPXSRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097684_HBe_P-D Product feature CHAIN MZ097684_HBe_P-D of FT:mat_peptide MZ097684_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD14_44291). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGSNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MZ097693_HBe_P-D Product feature CHAIN MZ097693_HBe_P-D of FT:mat_peptide MZ097693_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate DD17_12626). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMALAT
WVGGNLEDSTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|MZ097708_HBe_P-D Product feature CHAIN MZ097708_HBe_P-D of FT:mat_peptide MZ097708_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_16). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPADFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGVNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097709_HBe_P-D Product feature CHAIN MZ097709_HBe_P-D of FT:mat_peptide MZ097709_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_22). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALHREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTHMGLKFRQLLWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097713_HBe_P-D Product feature CHAIN MZ097713_HBe_P-D of FT:mat_peptide MZ097713_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_47). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTTSALCRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHLSCITFGRDTVVEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVXR
RRVR
>gnl|hbvpro|MZ097714_HBe_P-D Product feature CHAIN MZ097714_HBe_P-D of FT:mat_peptide MZ097714_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_65). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGANLDDPASRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097717_HBe_P-D Product feature CHAIN MZ097717_HBe_P-D of FT:mat_peptide MZ097717_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_103). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097736_HBe_P-D Product feature CHAIN MZ097736_HBe_P-D of FT:mat_peptide MZ097736_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_128). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097737_HBe_P-D Product feature CHAIN MZ097737_HBe_P-D of FT:mat_peptide MZ097737_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_129). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGANLDDPASRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097738_HBe_P-D Product feature CHAIN MZ097738_HBe_P-D of FT:mat_peptide MZ097738_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_132). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097741_HBe_P-D Product feature CHAIN MZ097741_HBe_P-D of FT:mat_peptide MZ097741_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_137). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097742_HBe_P-D Product feature CHAIN MZ097742_HBe_P-D of FT:mat_peptide MZ097742_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_138). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
QRGR
>gnl|hbvpro|MZ097743_HBe_P-D Product feature CHAIN MZ097743_HBe_P-D of FT:mat_peptide MZ097743_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_139). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097747_HBe_P-D Product feature CHAIN MZ097747_HBe_P-D of FT:mat_peptide MZ097747_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_143). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097750_HBe_P-D Product feature CHAIN MZ097750_HBe_P-D of FT:mat_peptide MZ097750_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_151). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDLDPYKEFGATVELLSFLPADFFPSVRALLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQILWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETXVXR
QRGR
>gnl|hbvpro|MZ097756_HBe_P-D Product feature CHAIN MZ097756_HBe_P-D of FT:mat_peptide MZ097756_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_160). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKXFGATVELLSFLPSDFFPSVXDLLDTASXLYREALXSPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097760_HBe_P-D Product feature CHAIN MZ097760_HBe_P-D of FT:mat_peptide MZ097760_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_164). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
QRGR
>gnl|hbvpro|MZ097764_HBe_P-D Product feature CHAIN MZ097764_HBe_P-D of FT:mat_peptide MZ097764_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_170). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097768_HBe_P-D Product feature CHAIN MZ097768_HBe_P-D of FT:mat_peptide MZ097768_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_175). Complete genome. [Riboviria] (length=164 residues).
SKLCLXWLWGMDIDPYKXFGATVZLLSFLPSDFFPSVRBLLDTASXLYREALESPEHCSPHHTALRXAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097774_HBe_P-D Product feature CHAIN MZ097774_HBe_P-D of FT:mat_peptide MZ097774_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_182). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097789_HBe_P-D Product feature CHAIN MZ097789_HBe_P-D of FT:mat_peptide MZ097789_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_210). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097792_HBe_P-D Product feature CHAIN MZ097792_HBe_P-D of FT:mat_peptide MZ097792_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_218). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097793_HBe_P-D Product feature CHAIN MZ097793_HBe_P-D of FT:mat_peptide MZ097793_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_219). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGAXVELLSFLPSDFFPSVRBLLBTASXLYREALKSPEHCSXHHTALRQAILCWGELMTLAT
WVGGNLDDPTSRDLVVSYVNTNMGLKFRQLLWFHVSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097796_HBe_P-D Product feature CHAIN MZ097796_HBe_P-D of FT:mat_peptide MZ097796_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_225). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLNTASALYREALKSPXHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097805_HBe_P-D Product feature CHAIN MZ097805_HBe_P-D of FT:mat_peptide MZ097805_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_238). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097809_HBe_P-D Product feature CHAIN MZ097809_HBe_P-D of FT:mat_peptide MZ097809_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_248). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGGNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097813_HBe_P-D Product feature CHAIN MZ097813_HBe_P-D of FT:mat_peptide MZ097813_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate FR_HBV_253). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097820_HBe_P-D Product feature CHAIN MZ097820_HBe_P-D of FT:mat_peptide MZ097820_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_207). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097821_HBe_P-D Product feature CHAIN MZ097821_HBe_P-D of FT:mat_peptide MZ097821_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_210). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097833_HBe_P-D Product feature CHAIN MZ097833_HBe_P-D of FT:mat_peptide MZ097833_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_297). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
QRGR
>gnl|hbvpro|MZ097839_HBe_P-D Product feature CHAIN MZ097839_HBe_P-D of FT:mat_peptide MZ097839_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_370). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097840_HBe_P-D Product feature CHAIN MZ097840_HBe_P-D of FT:mat_peptide MZ097840_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_379). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGGNLEDPVSRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVWMRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097841_HBe_P-D Product feature CHAIN MZ097841_HBe_P-D of FT:mat_peptide MZ097841_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_416). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097848_HBe_P-D Product feature CHAIN MZ097848_HBe_P-D of FT:mat_peptide MZ097848_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HN_HBV_16). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097849_HBe_P-D Product feature CHAIN MZ097849_HBe_P-D of FT:mat_peptide MZ097849_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HN_HBV_17). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097855_HBe_P-D Product feature CHAIN MZ097855_HBe_P-D of FT:mat_peptide MZ097855_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HN_HBV_39). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097858_HBe_P-D Product feature CHAIN MZ097858_HBe_P-D of FT:mat_peptide MZ097858_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HN_HBV_49). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGXLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|MZ097859_HBe_P-D Product feature CHAIN MZ097859_HBe_P-D of FT:mat_peptide MZ097859_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HN_HBV_50). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLZYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
PRGR
>gnl|hbvpro|OK106256_HBe_P-D Product feature CHAIN OK106256_HBe_P-D of FT:mat_peptide OK106256_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate D1). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK143476_HBe_P-D Product feature CHAIN OK143476_HBe_P-D of FT:mat_peptide OK143476_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 134_Moscow_2008). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTATALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRETVVEYLVSFGVWIRTPPAYRPVNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|OK143479_HBe_P-D Product feature CHAIN OK143479_HBe_P-D of FT:mat_peptide OK143479_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 2011_Moscow_2008). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRHLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK143487_HBe_P-D Product feature CHAIN OK143487_HBe_P-D of FT:mat_peptide OK143487_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 62_Moscow_2008). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK382075_HBe_P-D Product feature CHAIN OK382075_HBe_P-D of FT:mat_peptide OK382075_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Bushehr-DM-PC63). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPTNAPILSTLPETTVVR
PRGR
>gnl|hbvpro|OK382076_HBe_P-D Product feature CHAIN OK382076_HBe_P-D of FT:mat_peptide OK382076_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Bushehr-DM-PC65). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPTNAPILSTLPETTVVR
PRGR
>gnl|hbvpro|OK382077_HBe_P-D Product feature CHAIN OK382077_HBe_P-D of FT:mat_peptide OK382077_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Bushehr-DM-PC66). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPTNAPILSTLPETTVVR
PRGR
>gnl|hbvpro|OK382078_HBe_P-D Product feature CHAIN OK382078_HBe_P-D of FT:mat_peptide OK382078_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Bushehr-DM-PC69). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPTNAPILSTLPETTVVR
PRGR
>gnl|hbvpro|OK382079_HBe_P-D Product feature CHAIN OK382079_HBe_P-D of FT:mat_peptide OK382079_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Bushehr-DM-PC71). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPTNAPILSTLPETTVVR
PRGR
>gnl|hbvpro|OK382085_HBe_P-D Product feature CHAIN OK382085_HBe_P-D of FT:mat_peptide OK382085_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Bushehr-DM-PC86). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTTAGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPTNAPILSTLPETTVVR
PRGR
>gnl|hbvpro|OK490617_HBe_P-D Product feature CHAIN OK490617_HBe_P-D of FT:mat_peptide OK490617_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Bushehr-DM-PC63). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK998519_HBe_P-D Product feature CHAIN OK998519_HBe_P-D of FT:mat_peptide OK998519_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_HD_St.Pet2). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK998520_HBe_P-D Product feature CHAIN OK998520_HBe_P-D of FT:mat_peptide OK998520_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_HD_St.PetV17). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAMLCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK998521_HBe_P-D Product feature CHAIN OK998521_HBe_P-D of FT:mat_peptide OK998521_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_HD_OBI_St.PetV35). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK998522_HBe_P-D Product feature CHAIN OK998522_HBe_P-D of FT:mat_peptide OK998522_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_HD_OBI_St.PetV28). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLNFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSILPETTVVR
RRGG
>gnl|hbvpro|OK998523_HBe_P-D Product feature CHAIN OK998523_HBe_P-D of FT:mat_peptide OK998523_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_HD_OBI_St.PetV27). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK998524_HBe_P-D Product feature CHAIN OK998524_HBe_P-D of FT:mat_peptide OK998524_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_HD_Belgrade70). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELRTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTIPETTVVR
RRGR
>gnl|hbvpro|OK998525_HBe_P-D Product feature CHAIN OK998525_HBe_P-D of FT:mat_peptide OK998525_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_HD_OBI_Belgrade108). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|OK998527_HBe_P-D Product feature CHAIN OK998527_HBe_P-D of FT:mat_peptide OK998527_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV_HD_OBI_Belgrade34). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OL362107_HBe_P-D Product feature CHAIN OL362107_HBe_P-D of FT:mat_peptide OL362107_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate KL_130). Partial genome (Contains: HBe, HBc, HBx, LHBs, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OM025254_HBe_P-D Product feature CHAIN OM025254_HBe_P-D of FT:mat_peptide OM025254_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate Tuva_RU_2021). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPTVRDLLDTASALYREALESPEHCSPHHTALRQACLCWGELMNLAT
WVGGNLEDQASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OM304306_HBe_P-D Product feature CHAIN OM304306_HBe_P-D of FT:mat_peptide OM304306_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate 7_HBV_complete_genome_Tyva_RU_2021). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OM456942_HBe_P-D Product feature CHAIN OM456942_HBe_P-D of FT:mat_peptide OM456942_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate HBV353C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=162 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RR
>gnl|hbvpro|OM721310_HBe_P-D Product feature CHAIN OM721310_HBe_P-D of FT:mat_peptide OM721310_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S1). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OM721311_HBe_P-D Product feature CHAIN OM721311_HBe_P-D of FT:mat_peptide OM721311_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S2). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OM721312_HBe_P-D Product feature CHAIN OM721312_HBe_P-D of FT:mat_peptide OM721312_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S3). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OM721313_HBe_P-D Product feature CHAIN OM721313_HBe_P-D of FT:mat_peptide OM721313_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S4). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OM721314_HBe_P-D Product feature CHAIN OM721314_HBe_P-D of FT:mat_peptide OM721314_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S5). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OM721315_HBe_P-D Product feature CHAIN OM721315_HBe_P-D of FT:mat_peptide OM721315_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S6). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OM721316_HBe_P-D Product feature CHAIN OM721316_HBe_P-D of FT:mat_peptide OM721316_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate S7). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLQDPTSRDLVVSYVNTHMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|ON585703_HBe_P-D Product feature CHAIN ON585703_HBe_P-D of FT:mat_peptide ON585703_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate LMV_17). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAKALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPSSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRRR
>gnl|hbvpro|V01460_HBe_P-D Product feature CHAIN V01460_HBe_P-D of FT:mat_peptide V01460_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X02496_HBe_P-D Product feature CHAIN X02496_HBe_P-D of FT:mat_peptide X02496_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDNASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X65257_HBe_P-D Product feature CHAIN X65257_HBe_P-D of FT:mat_peptide X65257_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient C; HBsAg positiv;HBV subtype ayw). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLIFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X65258_HBe_P-D Product feature CHAIN X65258_HBe_P-D of FT:mat_peptide X65258_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient CI; HBV subtype ayw). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVAFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X72702_HBe_P-D Product feature CHAIN X72702_HBe_P-D of FT:mat_peptide X72702_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient C1005). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85259_HBe_P-D Product feature CHAIN X85259_HBe_P-D of FT:mat_peptide X85259_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Graziellac'92). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPQHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85273_HBe_P-D Product feature CHAIN X85273_HBe_P-D of FT:mat_peptide X85273_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Carboni'90). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|X85294_HBe_P-D Product feature CHAIN X85294_HBe_P-D of FT:mat_peptide X85294_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Chighine'82). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85295_HBe_P-D Product feature CHAIN X85295_HBe_P-D of FT:mat_peptide X85295_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Chighine-1'85). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGVNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85297_HBe_P-D Product feature CHAIN X85297_HBe_P-D of FT:mat_peptide X85297_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Dettori'85). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85298_HBe_P-D Product feature CHAIN X85298_HBe_P-D of FT:mat_peptide X85298_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Dettori-1'86). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRHAILCWGDLRTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85301_HBe_P-D Product feature CHAIN X85301_HBe_P-D of FT:mat_peptide X85301_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Sanna-2'90). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLEDPVSRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85302_HBe_P-D Product feature CHAIN X85302_HBe_P-D of FT:mat_peptide X85302_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Ferreli'84). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREAFECSEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85303_HBe_P-D Product feature CHAIN X85303_HBe_P-D of FT:mat_peptide X85303_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Ferreli-1'85). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85304_HBe_P-D Product feature CHAIN X85304_HBe_P-D of FT:mat_peptide X85304_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Ferreli-2'86). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85308_HBe_P-D Product feature CHAIN X85308_HBe_P-D of FT:mat_peptide X85308_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Mannoni'85). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X85318_HBe_P-D Product feature CHAIN X85318_HBe_P-D of FT:mat_peptide X85318_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient Galistru-2'87). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPRHCSPHHTALRQAILCWGELMTSAS
WVGVNLEDPASRDLVVSYVNTNMGLKPRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|X97848_HBe_P-D Product feature CHAIN X97848_HBe_P-D of FT:mat_peptide X97848_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate patient 2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLQDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|Y07587_HBe_P-D Product feature CHAIN Y07587_HBe_P-D of FT:mat_peptide Y07587_HBe_P-D of [Viruses] Hepatitis B Virus genotype D. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|Z35716_HBe_P-D Product feature CHAIN Z35716_HBe_P-D of FT:mat_peptide Z35716_HBe_P-D of [Viruses] Hepatitis B Virus genotype D (isolate hb321). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice