HBVdb

Dataset for protein HBe of genotype D

[Download (right click)] [Sequences] [Repertoires]

1422 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


MH724976_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLHTASALYRE
MH464832_HBe_P-D      ---CLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB048701_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRD
AB078031_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYRE
AB090268_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRE
AB090269_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB104709_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB109476_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB110075_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB119253_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPQDFFPAVRDLLDTASALYRE
AB119255_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB119256_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB126581_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB188242_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB205127_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB205128_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB222710_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB267090_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYRE
AB270548_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB355452_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
AB555497_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB674403_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB674405_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB674416_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPDDFFPSARDLLDTATALYRE
AB674426_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB674427_HBe_P-D      SKLCLGWLWDMDXDPYKEFGAXVELLSFLPLDFYPSVRDLLDTASALYRE
AB674429_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB674430_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF043593_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRD
AF043594_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVQLLSFLPHDFFPSVRDLLDTASALFRD
AF151735_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AF419526_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AF419539_HBe_P-D      SKLCLGWLWVMDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AM422939_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYRE
AY090453_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYRE
AY161157_HBe_P-D      SKLCLGWLWGMDTDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY233292_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYRE
AY236162_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY373431_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY382510_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY603427_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY603433_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY603445_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFSPSDFFPSVRDLLDTASALYRE
AY721605_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY721607_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY721611_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY796031_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDNASALYRD
DQ178011_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYRE
DQ178012_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYRE
DQ178015_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYRE
DQ178016_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYRE
DQ178020_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYRE
DQ304547_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
DQ304548_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
DQ304550_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
DQ315776_HBe_P-D      SKLCLGWLWGIDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
DQ315778_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSFRDLLDTASALYRE
DQ336688_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFLPSVRDLLDTASALYRE
DQ336692_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFLPSVRDLLDTASALYRE
DQ399006_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ464168_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
DQ464170_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
DQ486021_HBe_P-D      SKLCLGWLRDMDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALFRE
DQ486023_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EF103281_HBe_P-D      SQLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU155893_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
EU185779_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU234070_HBe_P-D      SKLCXGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU414055_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU414056_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASXLYRD
EU414057_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU414059_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU414061_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594399_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594408_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594422_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYRE
EU594434_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
EU726844_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726845_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726855_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EU726860_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRE
EU726861_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726865_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726879_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRE
EU726894_HBe_P-D      SKLLLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726899_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726901_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRE
EU726958_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726959_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU787436_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU787439_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU919197_HBe_P-D      SKLCLGWLWGMDIDPCKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU939681_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
FJ349208_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRD
FJ349217_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ349234_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ692532_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
FJ867966_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867970_HBe_P-D      SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867998_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ868011_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPYDFFPSVRDLLDTASALYRE
FJ899792_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
FJ904402_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRD
FJ904432_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
FJ904433_HBe_C-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FJ904435_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPFDFFPSVRDFLDSALALYRD
FJ904446_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRQ
GQ183475_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183479_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183482_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ184322_HBe_P-D      SKLCLGWLKDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRD
GQ205380_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ205382_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ205385_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ477456_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPTVRDLLDTASALYRE
GQ477457_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ922001_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GU456636_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GU456650_HBe_P-D      SKLCLGWLWGMDLDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
GU456671_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GU456684_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRD
HM214720_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HM750155_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ236014_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ236016_HBe_P-D      SRLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ257269_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ641710_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700448_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700455_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRXLLDTASALYRE
HQ700467_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRE
HQ700468_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700470_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700473_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700474_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700477_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700489_HBe_P-D      SKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ833469_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439692_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439695_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRE
JF439700_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439704_HBe_P-D      SKLCLGWLWGMDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYRE
JF439712_HBe_P-D      SKLCLGWLWGMDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYRE
JF439718_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF754602_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYRE
JF754608_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF754625_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTAKALYRE
JF754629_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JF754635_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALFRQ
JN040752_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040758_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTALALYRE
JN040771_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
JN040780_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVQLLSFLPVDFFPSIRDLLDTASALYRE
JN040785_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040790_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040791_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040792_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040793_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040794_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040795_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALFRE
JN040796_HBe_P-D      SKLCLGWLWGMDIDPYKELGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040797_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALFRE
JN040806_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040808_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040813_HBe_P-D      SKLCLGGFWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040814_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYRE
JN040820_HBe_P-D      SKLCLGWLWDMDIDPYKEFGAAVELLSFLPSDFFPSVRDLLDTASALYRE
JN040821_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040822_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040824_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN132126_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN132131_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN132132_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257148_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257149_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRXLLDTASALYRE
JN257152_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257165_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN257186_HBe_P-D      SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257187_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257205_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
JN257209_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN558562_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN642129_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN642138_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN642166_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664909_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664910_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JN664914_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664919_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JN664920_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664921_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JN664922_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664926_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
JN664931_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRE
JN664932_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
JN664947_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRE
JN664948_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
JN687947_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN688678_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JN688685_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JN688713_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPXVRDLLDTASALYRE
JN792903_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ403606_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ687530_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707476_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707483_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707484_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRK
JQ707493_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707497_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDRLDTTSALYRE
JQ707498_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707501_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707504_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707509_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707510_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
JQ707511_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRE
JQ707518_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707521_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707529_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707682_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707695_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707704_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JX079942_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX096955_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX310733_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX310734_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX470760_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX847948_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC774460_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRE
KC774477_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875275_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875276_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875278_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875279_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875281_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875284_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875286_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875288_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875289_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRE
KC875290_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYRE
KC875295_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875297_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875299_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875300_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875303_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875305_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRE
KC875306_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875307_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875308_HBe_P-D      SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTATALYRE
KC875309_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875312_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875313_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875314_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPPVRDLLDTASALYRE
KC875315_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875316_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875318_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875320_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875322_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875324_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875326_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYRE
KC875329_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFLSVRDLLDTATALYRE
KC875330_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYRE
KC875331_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875333_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875334_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875335_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875337_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875340_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC875342_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KF061167_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF061168_HBe_P-D      SKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF061169_HBe_P-D      SKLCLGWLWXMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF192830_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF471640_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVNLLSFLPADYFPSVRDLLDTASALYRE
KF471650_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF471654_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRE
KF471655_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
KF471656_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF584076_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF584078_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLGTASALYRE
KF584129_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF584130_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF584161_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYRE
KF584163_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYRE
KF584164_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF679989_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KF779218_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779220_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779223_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF779225_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRE
KF779301_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779382_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRD
KF896606_HBe_P-D      PKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF922432_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KJ470894_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRD
KJ647340_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSLRDLLDTASALYRD
KJ647344_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTISALYRE
KM524338_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524346_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524347_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524348_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524356_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYRE
KM524358_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRE
KM524361_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRE
KM606655_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KM606745_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671690_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671692_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671695_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671698_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671700_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRE
KP857094_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP857109_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP857110_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYRE
KP857111_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP857114_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRE
KP857115_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDYFPSVRDLLDTARALYRD
KP857116_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALFRE
KP857117_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KT347090_HBe_P-D      SRLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366499_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT749827_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KU668433_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KU668434_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
KU668435_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU668437_HBe_P-D      SKLCLGWLWGRDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU668439_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYRE
KU668442_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU668444_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU668445_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU668447_HBe_P-D      SKLCLGWLWGMDIDPYKEFGVTVELLSFLPSDFFPSVRDLLDTASALYRE
KU668448_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU736926_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX827290_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSGFFPSVRDLLDTASALYRE
KX827292_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KY616076_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KY629634_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYRE
LK995390_HBe_P-D      SKLCLEWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
LT992444_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
LT992454_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF488704_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRE
MF618342_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF925391_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491124_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491127_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYRE
MG491129_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491130_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYRE
MG491134_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYRE
MG491137_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALCRE
MG491138_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYRE
MG491143_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491151_HBe_P-D      SKLCLGWLWGMNIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYRE
MG491175_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MG491181_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491186_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MG491187_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYRE
MH724216_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRE
MH724224_HBe_P-D      SKLCLGWLWGMDIYPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYRE
MH724225_HBe_P-D      SKLCLGWLWGMDIDPYKEFGAXGELLSFLPSDFFPSVRDLLDTASALYRE
MH724226_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724227_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724228_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDSASALYRE
MH724229_HBe_P-D      SKLCLGWLWGMDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYRE
MH724230_HBe_P-D      FQLCLGWVWGMDLYPYKEIGASGEFLLFFPSDFFPSVRDLLDTASALYRE
MH724234_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRE
MH724237_HBe_P-D      SKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRD
MH724244_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724247_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724248_HBe_P-D      SKLCLGWLWGMDLDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYRE
MH724252_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MH724959_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MH724960_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALFRE
MH724961_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYRE
MH724962_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVQLLSFLPSDFFPSARDLLDTASALYRE
MH724964_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
MH724965_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724968_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724970_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELISFLPSDFFPSVRDLLDTASALYRE
MH724971_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MH724972_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724973_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724977_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724978_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPQDFFPAVRDLLDTASALYRE
MH724984_HBe_P-D      SKLCLGWLWGMDIDPYREFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724990_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724992_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724999_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFVPSDFFPSVRDLLDTASALYRE
MH725001_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFSPSDFFPSVRDLLDTASALYRE
MH725004_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725005_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFSSVRDLLDTASALYRE
MH725006_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725008_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASTLYRE
MH725011_HBe_P-D      SQLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725012_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725013_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725014_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MH725022_HBe_P-D      SKLCLGWLWGMDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725028_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725031_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725036_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725037_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725045_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725047_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYRE
MH725050_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725054_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFFPSARDLLDTASALYRE
MH725061_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MH725063_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725066_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRNLLDTASALYRE
MH725068_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATAELLLFLPYDFFPSVRDFIDTASALYRE
MH725069_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRE
MH725071_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725072_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725077_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MH725079_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725086_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725087_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MH725088_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MH725089_HBe_P-D      SKPCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725090_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725091_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPFDFFPSVRDLLDTASALYRE
MH725094_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725095_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLHFDFFPSVRHLLDTASALYRE
MH725096_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYRE
MH725097_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALFRE
MH725098_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725101_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725102_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
MH725103_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALYRE
MH725108_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725111_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725115_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725120_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725123_HBe_P-D      SKLCLGWLWGKGIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725124_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725125_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725126_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALFRE
MH725135_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRD
MH725136_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYWE
MH725139_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MH725140_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MH725142_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYWE
MH725144_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRQ
MH725148_HBe_P-D      SKLCLGWLWGVDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725150_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725153_HBe_P-D      SKLGLGWLWGMDIDPYKEFGASVELLSFLPEDFFPSVRDLLDTASALYRE
MH725164_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725168_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725169_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725171_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRD
MH725172_HBe_P-D      FQLCLGWLWGMDLDPYKEFGGIVELLFFLPSDFFPSVRDLLDTASALYRE
MH725174_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASPLYRE
MH725177_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725185_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725186_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725189_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRD
MH725194_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725196_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
MH725198_HBe_P-D      SKLCLGWFWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725199_HBe_P-D      SKLCLGWLWGMELDPYKEFGATVQLLSFLPSDFFPSVRDLLDTATALYRE
MH725201_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725202_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRD
MH725204_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRE
MH725209_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRD
MK052963_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK052972_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPTVRDLLDTASALYRE
MK052973_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK052974_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK598646_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MK598648_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598655_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK598660_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK598661_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK598664_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MK598673_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598674_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRE
MK598676_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALFRD
MK598677_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVQLLSFLPHDFFPSVRDLLDTASALFRD
MK598678_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVQLLSFLPHDFFPSVRDLLDTASALYRE
MK598679_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALFRD
MK618423_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALYRE
MK618424_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALYRE
MK618441_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK693107_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN310706_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYRE
MN310707_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALYRE
MN310709_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFYPSVRQLLDTASALYRE
MN310710_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN310711_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MN310712_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRE
MN310715_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRXLLDTASALYRE
MN507836_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN507837_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFFPSDFFPSVRDLLDTASALYRE
MN507852_HBe_P-D      SNLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN507853_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN844881_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSIRDLLDTASALYRE
MT114169_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRD
MT114173_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPAVRDLLDTASALFRE
MT448619_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MT579903_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MT591278_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MT591279_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRQ
MT591281_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRD
MT603394_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFRN
MT603396_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT603398_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRN
MT731920_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTAQALFRQ
MW601228_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MW601253_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRD
MW601262_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRE
MW601274_HBe_P-D      SKLCLGWLWDMDLDPYKEFGATVELLSFLPADFFPSVRALLDTASALFRE
MW601278_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRE
MW601286_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601288_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601297_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601304_HBe_P-D      SKLCLGWLLDMDIDPYKEFGASVELLSFLPSDFFPSVRDLIDTASALYRE
MW601309_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601320_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTVSALYRD
MW601327_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MW601338_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVQLLSFLPVDFFPSVRDLLDTASALFRD
MW601339_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRD
MZ097624_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MZ097633_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRD
MZ097649_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRE
MZ097654_HBe_P-D      SKLCLRWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRD
MZ097661_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRD
MZ097675_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097676_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYRD
MZ097681_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097684_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRQ
MZ097693_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097708_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPADFFPSARDLLDTASALYRE
MZ097709_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALHRE
MZ097713_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTTSALCRD
MZ097714_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRD
MZ097717_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097750_HBe_P-D      SKLCLGWLWDMDLDPYKEFGATVELLSFLPADFFPSVRALLDTASALFRE
MZ097756_HBe_P-D      SKLCLGWLWGMDIDPYKXFGATVELLSFLPSDFFPSVXDLLDTASXLYRE
MZ097768_HBe_P-D      SKLCLXWLWGMDIDPYKXFGATVZLLSFLPSDFFPSVRBLLDTASXLYRE
MZ097792_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ097793_HBe_P-D      SKLCLGWLWDMDIDPYKEFGAXVELLSFLPSDFFPSVRBLLBTASXLYRE
MZ097796_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLNTASALYRE
MZ097809_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097840_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097858_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097859_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OK143476_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTATALYRD
OK143479_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRHLLDTASALYRD
OK382075_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
OK382077_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRE
OK998520_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
OK998522_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OK998523_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OK998524_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALYRE
OK998525_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OK998527_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
OM025254_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPTVRDLLDTASALYRE
OM456942_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OM721311_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRE
OM721316_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
ON585703_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAKALYRD
X02496_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDNASALYRE
X65257_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
X65258_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85259_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85273_HBe_P-D        SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALYRE
X85295_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85298_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85301_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85302_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85318_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X97848_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB078032_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYRE
AB078033_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRDLLDTASALYRE
AB090270_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB109475_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB116266_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB205126_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB210821_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB210822_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB330369_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB330370_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB471856_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB471857_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB493846_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AJ131956_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AJ627220_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AJ627223_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY230112_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY230114_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY233291_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY603428_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY603437_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY603440_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY603443_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
DQ464169_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU414058_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU414060_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU414140_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594400_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594401_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594402_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594403_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594405_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594407_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594409_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594410_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594411_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594412_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594415_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594416_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594421_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594423_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594424_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594425_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594427_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594428_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594430_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594431_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594432_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594433_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ040872_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ349232_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ692506_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ692507_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183471_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183473_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183474_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183476_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183477_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183484_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ205388_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ922002_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700511_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700512_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700513_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700514_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257181_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664911_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664912_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664913_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664917_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664927_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664930_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664937_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664938_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707477_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707492_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707495_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX096954_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX096956_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX096957_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX096958_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898689_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898691_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898692_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898694_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898697_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875310_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875311_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875317_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875319_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875321_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875332_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875336_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF679994_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF679995_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF679996_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF679997_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779209_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779212_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779216_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779217_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779222_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779224_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779228_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779285_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779288_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779289_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779292_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779296_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779302_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779303_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779318_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779340_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779341_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779376_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779377_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF798273_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM519455_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524341_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524349_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524350_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524351_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524352_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524353_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524354_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524355_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP090177_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP090178_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP090179_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP090180_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP090181_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP322601_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KR905423_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT151620_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366494_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366495_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366496_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366509_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366510_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366511_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU668436_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU668438_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU668441_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU668446_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU668449_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU736924_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KU736925_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196216_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196219_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196222_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196231_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196234_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX827301_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
LC705462_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
LT992438_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF618339_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF618341_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF618343_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF618348_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF925358_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF925364_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF925393_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724214_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724217_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724218_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724219_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724221_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724223_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724231_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK516278_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598662_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598663_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598665_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598666_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598667_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598668_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598669_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598671_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598672_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598675_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618419_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618420_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618421_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618422_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618426_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618443_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN310708_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN310713_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN310714_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN507839_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MT579898_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MT579900_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MT579902_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW082640_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601266_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601275_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW675898_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097747_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097789_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
V01460_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
Z35716_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB104711_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB104712_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB188244_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB222711_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB222712_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB222713_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB246347_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB246348_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB270543_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB583680_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB674407_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AF121240_HBe_C-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AF121241_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AF280817_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY350614_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY371901_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY371902_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY371905_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY371907_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY371912_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY371914_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY371920_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY371921_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY371922_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY661792_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY661793_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY721606_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY721609_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY721610_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY721612_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY741797_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY945307_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EF103275_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EF103277_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EF103279_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EF103280_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU414136_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594396_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594397_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726854_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726862_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726869_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726874_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726878_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726887_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726888_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726895_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726898_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726900_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726902_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726907_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726909_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726914_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726918_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726919_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726923_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726924_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726930_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726931_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726935_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726940_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726962_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726964_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726967_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726971_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726972_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU726976_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU787437_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU787440_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU787441_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU787442_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU787445_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU787446_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU787447_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ349228_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ349229_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ386590_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ904443_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183480_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ377589_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ477459_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GU357846_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HM750153_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HM750154_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HM750156_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700440_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700441_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700442_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700443_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700445_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700446_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700447_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700449_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700450_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700451_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700454_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700459_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700464_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700466_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700469_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700471_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700479_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700480_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700482_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700484_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700487_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700488_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ833465_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ833467_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ833470_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ833471_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF754591_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF754601_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF754618_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF754624_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF754628_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040759_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040786_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040805_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040807_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040826_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN132130_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257151_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257155_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257171_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257182_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257185_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257193_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257194_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257196_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257199_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN558561_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN642131_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ038394_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ038414_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC774444_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC774445_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC774462_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875277_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875280_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875282_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875285_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875293_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875294_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF018180_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF018184_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF018191_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF061170_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF471647_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF471651_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF471652_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF584162_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF798260_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF798283_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524339_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP322599_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671684_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671685_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671686_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671687_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671688_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671689_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671691_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671693_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671694_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671696_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671697_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP671699_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP857099_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP857100_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP857104_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP857105_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP857106_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366498_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366500_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366502_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366508_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196215_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX827300_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KY382414_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
LC365689_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491136_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491157_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491161_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491165_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491190_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MG491192_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724954_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724955_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724956_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724958_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724963_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724975_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724981_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724982_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724983_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724986_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724987_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724989_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724991_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724998_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725002_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725003_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725007_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725009_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725015_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725016_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725017_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725023_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725026_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725027_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725034_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725039_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725041_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725044_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725046_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725048_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725049_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725051_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725052_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725053_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725055_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725056_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725057_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725058_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725059_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725060_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725062_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725073_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725074_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725078_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725083_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725085_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725093_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725104_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725105_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725116_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725117_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725121_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725122_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725127_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725128_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725129_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725131_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725132_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725133_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725137_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725138_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725143_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725145_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725146_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725149_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725154_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725155_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725156_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725157_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725158_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725160_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725162_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725163_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725165_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725166_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725170_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725173_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725175_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725176_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725178_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725179_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725180_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725181_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725182_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725184_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725187_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725188_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725190_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725193_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725195_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725205_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725206_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725207_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725208_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725211_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK355500_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK507910_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK507911_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK507913_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK507914_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598636_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598637_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598638_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598639_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598640_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598641_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598642_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598643_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598644_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598645_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618429_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618430_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618431_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618432_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618437_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK693108_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK693109_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN507838_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN507851_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN585095_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601252_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601282_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601292_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601313_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097640_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097648_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097666_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097736_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097764_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097813_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097820_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097821_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097839_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097841_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097848_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097849_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OK106256_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OL362107_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OM304306_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OM721310_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OM721312_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OM721313_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OM721314_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OM721315_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85294_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85297_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
Y07587_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366501_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB120308_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EF103276_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU414054_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU414135_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HM750152_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040756_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040788_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257203_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP322600_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP857097_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KP857107_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724974_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725018_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725159_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601319_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU594382_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FJ349205_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FJ349218_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ183478_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
HM750151_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JN792907_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JN792909_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JN792910_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF679992_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF679993_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF779214_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF798282_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF798306_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT366491_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT366497_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT366507_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK507912_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK598651_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK598659_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK598670_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT603385_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT603400_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT603401_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT603402_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT603403_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MW601334_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ097672_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ097805_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
OK998519_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
OK998521_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
X72702_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU726960_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ349216_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700444_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040815_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX827291_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724988_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724993_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725112_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097743_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85303_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85304_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875325_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KF779230_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MK598658_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
JN040816_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY233294_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYRE
AY233296_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYRE
EU726876_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867964_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867973_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867974_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867975_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867981_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867999_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GU456649_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN642155_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875292_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF471657_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601335_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC999421_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY721608_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
HQ700483_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257179_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KY629630_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
DQ178018_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYRE
DQ178019_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVQDLLDTASALYRE
DQ304549_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
DQ304551_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU414142_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU414141_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASXLYRD
EU414143_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU414139_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU414138_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618418_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OK143487_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664918_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYRE
FJ692533_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
GQ205384_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KJ470889_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KM524345_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KM606744_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KM606752_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
MW675897_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
FJ867984_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867996_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ868004_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867979_HBe_P-D      SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ867983_HBe_P-D      SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
FJ868009_HBe_P-D      SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183481_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097855_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ183483_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ038389_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ038409_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KR905424_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366506_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724249_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724250_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601270_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257150_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ038387_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ038407_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ205389_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
LT992439_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707491_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707506_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724985_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN132127_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN132128_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN040817_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF471649_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439696_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439699_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439703_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439701_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439705_HBe_P-D      SKLCLGWLWGMDIDPYKEFGAIVELLSFLPSDFFPSVRDLLDTASALYRE
MH724994_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725064_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725065_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725080_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725081_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725167_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF018194_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725025_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725029_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725030_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725032_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725035_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725082_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725106_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725161_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598650_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724996_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OK490617_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN558563_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN558564_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF018187_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF018190_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X85308_HBe_P-D        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257166_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN257188_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN697591_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX079943_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707478_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707479_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707480_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707481_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707482_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707485_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707487_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707488_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707489_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707490_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707494_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707496_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707499_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707500_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707503_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707505_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707507_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707508_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH932714_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707486_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707512_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707513_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707514_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707515_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707516_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707517_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707519_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707520_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707522_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707523_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707524_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707525_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707526_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707527_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707528_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ707530_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK618436_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK618434_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618435_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JQ707683_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707684_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707685_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707686_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707687_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707688_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707689_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707690_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707691_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707692_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707693_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707694_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707696_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707697_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707698_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707699_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707700_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707701_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707702_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707703_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707705_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
JQ707706_HBe_P-D      SKLCLGWLWDMDIDSYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
MW601261_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097741_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MT591276_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601256_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097738_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC012652_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196214_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598647_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MK618427_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MK618428_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MK618433_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875283_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875291_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KX196210_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KX196213_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875287_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC875302_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KX196208_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196211_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196209_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYRE
KX196212_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYRE
KX196227_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196236_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KX196226_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196217_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KC875323_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196224_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196225_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196235_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFLSVRDLLDTATALYRE
KX196221_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196233_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196218_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KX196230_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KX196220_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196232_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KX196229_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MH725152_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601302_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097774_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF192831_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF192832_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF192834_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF584165_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYRE
MN310705_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVXBLLBTASALYRE
KF584166_HBe_P-D      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724997_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725191_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097833_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALFRE
MG491168_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYRE
MG491169_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYRE
MG491182_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFTSVRDLLDTASALYRE
MH724969_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALFRE
MH724967_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYRE
MH724979_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
MH725019_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
MH725119_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
MH725134_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
MH725183_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
MH725203_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
MH724966_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724980_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MH724995_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MH725070_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725076_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725033_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725075_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725084_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725107_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725040_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725109_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725067_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSLRNLLDTASALYRE
MH725092_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPFDFFPSVRDLLDTASALYRE
MH725110_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYRE
MH725118_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTASALYRE
MH725099_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725100_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725113_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725130_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725147_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725151_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601269_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH725197_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRE
MH725210_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK052966_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK052971_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK052975_HBe_P-D      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK598649_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK598657_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK618425_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALYRE
MW455166_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097737_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRD
MZ097742_HBe_P-D      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRE
MZ097760_HBe_P-D      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
OK382076_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
OK382078_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
OK382079_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
OK382085_HBe_P-D      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
                             .        : :*    :: *   .        : .   *  .

MH724976_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH464832_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB048701_HBe_P-D      ALESPEHCTPHHTALRHVCLCWGDLMNLATWVGTNLEDQASRDLVVSYVN
AB078031_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB090268_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AB090269_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB104709_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB109476_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
AB110075_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVN
AB119253_HBe_P-D      ALESPEHCTYHHTALRQAILCWGELMSLATWVGVNLEDQASRDLVVSYVN
AB119255_HBe_P-D      ALESPEHCSPHHTAIRQAILCWGDLMSLATWVGGNLEDPASRDLVVSYVN
AB119256_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWGGVNLEDPASRDLVVSYVN
AB126581_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
AB188242_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDQPSRDLVVSYVN
AB205127_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB205128_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRGLVVSYVN
AB222710_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
AB267090_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB270548_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
AB355452_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB555497_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
AB674403_HBe_P-D      ALESPEHCTPHHTALRQAILCWGDLTTLATWVGGNLEDPTSRDLVVSYVN
AB674405_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
AB674416_HBe_P-D      ALESQEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDQRSRDLVVTYVN
AB674426_HBe_P-D      ALQSPEHCSPHHTALRQAILCWGDLMXLATWVGGNLEDPISRDLVVSYVN
AB674427_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGSNLEDPVSRDLVVSYVN
AB674429_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLQDPVSRDLVVRYVN
AB674430_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
AF043593_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVN
AF043594_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGANLQDPASRELVVTYVN
AF151735_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
AF419526_HBe_P-D      ALESPEHCSPHHTRLRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AF419539_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLQDQASRELVVNYVN
AM422939_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY090453_HBe_P-D      ALESPEHCSAHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY161157_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY233292_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY236162_HBe_P-D      ALESPEHCSPHHTALKQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVN
AY373431_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
AY382510_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY603427_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY603433_HBe_P-D      ALESPEHCSPHHIALRQAILWWGDLMTLATWVGVNLEDPASRDLVVSYVN
AY603445_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY721605_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSHVN
AY721607_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
AY721611_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLIVSYVN
AY796031_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
DQ178011_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVFSYVN
DQ178012_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVISYVN
DQ178015_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
DQ178016_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
DQ178020_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVT
DQ304547_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVN
DQ304548_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVN
DQ304550_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVN
DQ315776_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ315778_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLINLSTWVGSNLEDPASRDLVVSYVN
DQ336688_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ336692_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVN
DQ399006_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
DQ464168_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ464170_HBe_P-D      ALESPEHCSPHHTALRQAILCRGGLKTLATWVGVNLEAPASRDLVVSYVN
DQ486021_HBe_P-D      ALDAPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVN
DQ486023_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLLNLSTWVGGNLQDQTSRDLVVTYVN
EF103281_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU155893_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU185779_HBe_P-D      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPASRDLVVGYVN
EU234070_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU414055_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWXGGNLEDPVSRDLVVSYVN
EU414056_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU414057_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU414059_HBe_P-D      ALXSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU414061_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWXGVNLEDPASRDLVVSYVN
EU594399_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594408_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594422_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594434_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVN
EU726844_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVN
EU726845_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLENPISRDLVVSYVN
EU726855_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLEDQTSRDLIVNYVN
EU726860_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPISRDLVVSYVN
EU726861_HBe_P-D      ALESPEHCSPHHTALRQAILWWGELMTLATWVGDNLEDPISRDLVVSYVN
EU726865_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
EU726879_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVN
EU726894_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726899_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
EU726901_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVN
EU726958_HBe_P-D      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPTSRDLVVSYVN
EU726959_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPASRDLVVSYVN
EU787436_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGSNLEDPISRDLVVSYVN
EU787439_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWGGGNLEDPISRDLIVSYVN
EU919197_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU939681_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
FJ349208_HBe_P-D      ALESPEHCSPHHTALRQACLCWGELMTLATWVGANLEDQASRDLVVSYVN
FJ349217_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
FJ349234_HBe_P-D      ALESPEHCSPHHTALRQAIICWGELMTLATWVGGNLEDPISRDLVVSYVN
FJ692532_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
FJ867966_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
FJ867970_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
FJ867998_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
FJ868011_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
FJ899792_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNMEDPVSRDLVVSYVN
FJ904402_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
FJ904432_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVN
FJ904433_HBe_C-D      ALESPEHCTPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVNYVN
FJ904435_HBe_P-D      SLEFPEPCSPPHXALRPTLFCWGDLMTLATWVGVNLEDPASRDLVVSYVN
FJ904446_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPVSRDLVVSYVN
GQ183475_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVH
GQ183479_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ183482_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ184322_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVN
GQ205380_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
GQ205382_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
GQ205385_HBe_P-D      ALESPEHCSPHHTAFRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
GQ477456_HBe_P-D      ALESPEHVSAHHTALRQAILCWGDLMTLATWVGANLDDPQSRDLVVSYVN
GQ477457_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GQ922001_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
GU456636_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
GU456650_HBe_P-D      ALESPEHCSPHHTALRQAFLCWGELMNLATWVGGNLEDPTSRDLIVSYVN
GU456671_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVNYVN
GU456684_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMSLATWVGGNLEDPTSRDLVVSYVN
HM214720_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
HM750155_HBe_P-D      ALESPEHCSPHHTALRQAILCLGELMTLATWVGGNLEDPISRDLVVSYVN
HQ236014_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVN
HQ236016_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
HQ257269_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVGYVN
HQ641710_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700448_HBe_P-D      ALESPEHCSPHHTALRQAILCWGXLMTLATWVGGNLEDPXSRDLVVSYVN
HQ700455_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700467_HBe_P-D      ALESPEHCSAHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
HQ700468_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
HQ700470_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVN
HQ700473_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700474_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700477_HBe_P-D      ALESPEHCSPHHTALRQAILCWGXLMTLATWVGGNLEDPISRDLVVSYVN
HQ700489_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
HQ833469_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVN
JF439692_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF439695_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF439700_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF439704_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF439712_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF439718_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVS
JF754602_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JF754608_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
JF754625_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLDDQGSREQVVSYVN
JF754629_HBe_P-D      ALESHEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVNYVN
JF754635_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JN040752_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JN040758_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040771_HBe_P-D      ALESPEHCSPHHTAIRQAVLCWGELMSLATWVGGNLEDPTSRDLVVSYVN
JN040780_HBe_P-D      ALESPEHCSPHHTAIRQAIICWGELMNLATWVGGNLEDPISRDLVVSYVN
JN040785_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
JN040790_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040791_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040792_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGKLEDPISRDLVVSYVN
JN040793_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040794_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040795_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JN040796_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JN040797_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JN040806_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040808_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040813_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
JN040814_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
JN040820_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVN
JN040821_HBe_P-D      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLQDPVSRDLVVSYVN
JN040822_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPISRDLVVSYVN
JN040824_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JN132126_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
JN132131_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN132132_HBe_P-D      ALESPEHCSPHHTALRQATLCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN257148_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
JN257149_HBe_P-D      ALESPEHCSPHHTALRQAILCWGXLMTLATWVGGNLEDPISRDLVVSYVN
JN257152_HBe_P-D      ALESPEHCSPHHTALRQAILCWGXLXTLXTWVGGNLEDPISRDLVVSYVN
JN257165_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVN
JN257186_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JN257187_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JN257205_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVN
JN257209_HBe_P-D      ALESPEHCSPHHTALRQAILCWGXLXXLXTWVGGNLEDPISRDLVVSYVN
JN558562_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN642129_HBe_P-D      ALESPEHCSAHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JN642138_HBe_P-D      ALESPEHCSYHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN642166_HBe_P-D      ALESPDHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
JN664909_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
JN664910_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPASRDLVVSYVN
JN664914_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPSSRDLVVSYVN
JN664919_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JN664920_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPASRELVVSYVN
JN664921_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JN664922_HBe_P-D      ALESPEHCSPHHTALRQAILCWGEVTNLATWVGSNLEDQASRELVVSYVN
JN664926_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
JN664931_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664932_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGSNLEDPASRDLVVSYVN
JN664947_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664948_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JN687947_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVGYVN
JN688678_HBe_P-D      ALESPEHCSPHHTAIRQAILCWGELMTLATWVGVNLEDPGSRDQVVSYVN
JN688685_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVTYVN
JN688713_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDQSSRDLVVSYVN
JN792903_HBe_P-D      ALKSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ403606_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDIVVSYVN
JQ687530_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
JQ707476_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
JQ707483_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVN
JQ707484_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
JQ707493_HBe_P-D      ALESPEHCSPHHTALRQAILCWGKLMTLATWVGVNLEDPASRDLVVSYVN
JQ707497_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELRTLATWVGVNLEDPASRDLVVSYVN
JQ707498_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLTTLATWVGVNLEDPASRDLVVSYVN
JQ707501_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ707504_HBe_P-D      ALESPEHCSSHHTALRQAILCWGELMTLATWVGVNLEAPASRDLVVSYVN
JQ707509_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLTTLATWVGVNLEDPASRDLVVSYVN
JQ707510_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ707511_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ707518_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVN
JQ707521_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVS
JQ707529_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGINLEDQASRDLVVSYVN
JQ707682_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ707695_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELVTLATWVGVNLEDPASRDLVVSYVN
JQ707704_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX079942_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX096955_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMALATWVGVNLEDPASRDLVVSYVN
JX310733_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JX310734_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
JX470760_HBe_P-D      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGGNLEDPASRDLVVGYVN
JX847948_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLQDPTSRDLVVSYVN
KC774460_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KC774477_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875275_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875276_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875278_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875279_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875281_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVN
KC875284_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVN
KC875286_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVN
KC875288_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVN
KC875289_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875290_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVN
KC875295_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875297_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875299_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVN
KC875300_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875303_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVN
KC875305_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPISRDLVVSYVN
KC875306_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875307_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875308_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875309_HBe_P-D      ALESPEHCSPHHTALSQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875312_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
KC875313_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875314_HBe_P-D      ALESPEHCSPHHTALRQANLCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875315_HBe_P-D      ALESPEHCSPHHTALRHAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875316_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875318_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875320_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875322_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875324_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875326_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875329_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875330_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
KC875331_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875333_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
KC875334_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875335_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
KC875337_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
KC875340_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPASRDLVVSYVN
KC875342_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPASRDLVVSYVN
KF061167_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
KF061168_HBe_P-D      XLESPEHCSPHHTALRQAILCWGXLMTLATWVGGNLEDPISRDLVVSYVN
KF061169_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
KF192830_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
KF471640_HBe_P-D      ALESSEHCTPHHTALRQAILCWGDLINLSTWVGSNLEDPTSRDLVVSYVN
KF471650_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
KF471654_HBe_P-D      PLESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
KF471655_HBe_P-D      ALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF471656_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF584076_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF584078_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLGTWVGGNLEDPISRDLVVSYVN
KF584129_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF584130_HBe_P-D      ALESPEHCSPHHTALRQATLCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF584161_HBe_P-D      ALXSPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF584163_HBe_P-D      ALXSPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF584164_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF679989_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779218_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779220_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779223_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
KF779225_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779301_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779382_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGTNLEDQASRDLVVSYVN
KF896606_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF922432_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KJ470894_HBe_P-D      ALESPEHCTHHHTAIRQAILCWGELMTLATWVGTNLEDPASRDLIVSYVN
KJ647340_HBe_P-D      ALESPEHCSAHHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVTYVN
KJ647344_HBe_P-D      ALESPEHVSPHHTAIRQAILCWVEIMKLATWVGVNLEDPASRDQVVGYVN
KM524338_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
KM524346_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524347_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524348_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWGGGNLEDPISRDLVVSYVN
KM524356_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
KM524358_HBe_P-D      PLESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVN
KM524361_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM606655_HBe_P-D      ALESSEHCSPHHTALRQAVLCWGDLMTLATWVGTNLEDPTSRDLVVSYVN
KM606745_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
KP671690_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671692_HBe_P-D      TLKSPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671695_HBe_P-D      ALESPEHCSSHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671698_HBe_P-D      ALESPEHCSPHHTALRQAILCWGKLMTLATWVGGNLEDPISRDLVVSYVN
KP671700_HBe_P-D      ALESPEHCSAHHTALRQAILCWGDLMSLATWVGSNLQDPTSRDLVVSYVN
KP857094_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
KP857109_HBe_P-D      ALESPAHCSPHHTALRQATICWGELMTLATWVGGNLEDPTSRDLVVSYVN
KP857110_HBe_P-D      ALESPEHCTPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
KP857111_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVN
KP857114_HBe_P-D      ALDSPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVN
KP857115_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
KP857116_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
KP857117_HBe_P-D      ALESSEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVN
KT347090_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT366499_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KT749827_HBe_P-D      ALESPEHCSPHHTALRQAFLCWGELMTLATWVGTNLEDQASRDLVVSYVN
KU668433_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVN
KU668434_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668435_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVN
KU668437_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668439_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668442_HBe_P-D      ALESPEHCSPHHAPLRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668444_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLLVSYVN
KU668445_HBe_P-D      ALQSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668447_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668448_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPATRDLLLNYVN
KU736926_HBe_P-D      ALESXEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX827290_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX827292_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KY616076_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVTYVN
KY629634_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
LK995390_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPIFRDLVVSYVN
LT992444_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
LT992454_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
MF488704_HBe_P-D      ALESPEHCSPHHSALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF618342_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVN
MF925391_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MG491124_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491127_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491129_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
MG491130_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVSYVN
MG491134_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491137_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491138_HBe_P-D      ALESPEHCSPHHTALGQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491143_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLDDPTSRDLVVSYVN
MG491151_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491175_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MG491181_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MG491186_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVN
MG491187_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
MH724216_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724224_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724225_HBe_P-D      ALESPEHCSPHHTALRQAILCWGKLRILATWVGVNLKDPASRDLVVSYVN
MH724226_HBe_P-D      ALESPEHCSPHHTALRQAILCLGELMTLATWVGVNLEDPASRDLVVSYFN
MH724227_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELRTLATWVGVNLEDPASRDLEFSYVN
MH724228_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASKDQESSYVN
MH724229_HBe_P-D      ALESPEQCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724230_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELRTLATWVGVNLEDPASRDLVVSYVN
MH724234_HBe_P-D      GLESPDHCTPHHTALRQAILCWGELMTLATWVGANLEDQPSRDLVVSYVN
MH724237_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPASRELVVSYVN
MH724244_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724247_HBe_P-D      ALESPEHCSPHHSALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724248_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELRTLATWVGVNLEDPPSKNLLFIYVN
MH724252_HBe_P-D      ALESPEQCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724959_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
MH724960_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVN
MH724961_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724962_HBe_P-D      ALESPEHCSPHHTAIRQAILCWGELMTLATWVGGNLEDQPSRDLVVSYVN
MH724964_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724965_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
MH724968_HBe_P-D      ALESREHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724970_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVN
MH724971_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724972_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
MH724973_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRGLVVSYVN
MH724977_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
MH724978_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDQQSRDLVVSYVN
MH724984_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724990_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVN
MH724992_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLSTWVGSNLEDPASRDLVVSYVN
MH724999_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
MH725001_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725004_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
MH725005_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725006_HBe_P-D      ALESPEHCSPHHTALRQAILCWGKLMTLATWVGGNLEDPISRDLVVSYVN
MH725008_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725011_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725012_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRELVVSYVN
MH725013_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725014_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MH725022_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725028_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGKLEDPISRDLVVSYVN
MH725031_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVTYVN
MH725036_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
MH725037_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725045_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLQDPVSRDLVVSYVN
MH725047_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725050_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVN
MH725054_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MH725061_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MH725063_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
MH725066_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
MH725068_HBe_P-D      ASESPEHCSPHHTAIRQAIFSLGELMTLATWVGGNLEDPVSRDLVVSYVN
MH725069_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725071_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725072_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725077_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MH725079_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVN
MH725086_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVGYVN
MH725087_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVSYVN
MH725088_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MH725089_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
MH725090_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725091_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725094_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPVSRDLVVGYVN
MH725095_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLTTWVGGNLEDPISRDLVVSYVN
MH725096_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVN
MH725097_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRELVVSYVN
MH725098_HBe_P-D      PLESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725101_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMILATWVGGNLEDPISRDLVVSYVN
MH725102_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVN
MH725103_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725108_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVN
MH725111_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPISRDLVVSYVN
MH725115_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVGYVN
MH725120_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725123_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
MH725124_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
MH725125_HBe_P-D      SLESPEHCSPHHTAIRQASFCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725126_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVN
MH725135_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVGYVN
MH725136_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725139_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MH725140_HBe_P-D      ALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MH725142_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725144_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLNDPTSRDLVVSYVN
MH725148_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725150_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPISRDLVVSYVN
MH725153_HBe_P-D      ALESPEHCTPHHTAIRQAILCWGELMSLATWVGGNLEDPISRDLVVGYVN
MH725164_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725168_HBe_P-D      ALESPEHCSPHHTALRQAIPCWGDLMTLATWVGGNLEDPISRDLVVSYVN
MH725169_HBe_P-D      ALESPEHCSPYHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725171_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVN
MH725172_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725174_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725177_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVSYVN
MH725185_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725186_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMSLATWGGGNLEDPISRDLVVSYVN
MH725189_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVN
MH725194_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVN
MH725196_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725198_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725199_HBe_P-D      ALESPEHCSPHHTALRHVILCWGDLMNLATWVGGNLEDPISRDLVVSYVN
MH725201_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725202_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
MH725204_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPISRDLVVSYVN
MH725209_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK052963_HBe_P-D      ALESPEHCTPHHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVN
MK052972_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMSLATWVGANLEDPASRDLVVSYVN
MK052973_HBe_P-D      ALESPEHCTPHHTAIRQAILCWGELMTLATWVGTNLEDPASRDLIVSYVN
MK052974_HBe_P-D      ALESPEHCTPHHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVN
MK598646_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK598648_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK598655_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MK598660_HBe_P-D      ALKSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598661_HBe_P-D      ALKSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598664_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MK598673_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMALATWVGVNLEDPASRDLVVSYVN
MK598674_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGANLEDPASRDLVVSYVN
MK598676_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVTYVN
MK598677_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPASRELVVTYVN
MK598678_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLQDPASRELVVTYVN
MK598679_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLQDPASRELVVSYVN
MK618423_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELRTLATWVGVNLEDPASRDLVVSYVN
MK618424_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELRTLATWVGVNLEDPASRDLVVSYVN
MK618441_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVGYVN
MK693107_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVFSYVN
MN310706_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRELVVSYVN
MN310707_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRELVVSYVN
MN310709_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN310710_HBe_P-D      ALESHEHCSPHHTALRQAILCWGDLMSLATWVGGNLADPVSRDLVVGYVN
MN310711_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDVMTLATWVGVNLEDQASRDLVVGYVN
MN310712_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMDLATWVGGNLEDQGSRELVVSYVN
MN310715_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507836_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLTTWVGGNLEDPVSRDLVVTYVN
MN507837_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507852_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPVSRDLVVSYVN
MN507853_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVK
MN844881_HBe_P-D      ALESPEHCSPHHTAIRQAILCWGELMTLATWVGVNLEDPASREQVVSYVN
MT114169_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVN
MT114173_HBe_P-D      ALESPEHCTPHHTALRQAILCWGDLMNLATWVGANLDDPASRDLVVSYVN
MT448619_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPASRDLVVGYVN
MT579903_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT591278_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVN
MT591279_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MT591281_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT603394_HBe_P-D      DLESPEHCSPHHTALRQAILCWGELMSLATWVGVNLEDQGSRDQVVSYVN
MT603396_HBe_P-D      ALESPEHCSPHHTALRQAILCWGXLMTLATWVGVNLEDPASRDLVVSYVN
MT603398_HBe_P-D      ALESPEHCSAHHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVN
MT731920_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MW601228_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVSYVN
MW601253_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGANLDDPASRDLVVSYVN
MW601262_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MW601274_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MW601278_HBe_P-D      ALESPEHGTPHHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVN
MW601286_HBe_P-D      ALESPEHCSSHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MW601288_HBe_P-D      ALESPEHCSSHHTALRQATLCWGNLMTLATWVGGNLEDPISRDLVVSYVN
MW601297_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MW601304_HBe_P-D      ALESSEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MW601309_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MW601320_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPTSRDLVVAYVN
MW601327_HBe_P-D      ALKSPEHCSAHHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVN
MW601338_HBe_P-D      ALESPEHCSPHHTAIRQVVLCWGDLMNLATWVGGNLEDPVSRDLVVSYVN
MW601339_HBe_P-D      ALESPEHCTPHHTALRQAILCWGDLMTLSTWVGGNLEDPISRDLVVSYVN
MZ097624_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQSSRDLVVTYVN
MZ097633_HBe_P-D      ALESPEHCTPHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
MZ097649_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
MZ097654_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ097661_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MZ097675_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLINLSTWVGGNLEDPTSRDLVVSYVN
MZ097676_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVN
MZ097681_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPXSRDLVVSYVN
MZ097684_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGSNLEDPVSRDLVVSYVN
MZ097693_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMALATWVGGNLEDSTSRDLVVSYVN
MZ097708_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDVMNLATWVGVNLEDQASRDLVVSYVN
MZ097709_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MZ097713_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MZ097714_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGANLDDPASRDLVVSYVN
MZ097717_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MZ097750_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ097756_HBe_P-D      ALXSPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MZ097768_HBe_P-D      ALESPEHCSPHHTALRXAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MZ097792_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MZ097793_HBe_P-D      ALKSPEHCSXHHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVN
MZ097796_HBe_P-D      ALKSPXHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MZ097809_HBe_P-D      ALESPEHCSPHHTALRQAILCWGKLMTLATWVGGNLEDPVSRDLVVSYVN
MZ097840_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGGNLEDPVSRDLVVGYVN
MZ097858_HBe_P-D      ALESPEHCSPHHTALRQAILCWGXLMTLATWVGGNLEDPISRDLVVSYVN
MZ097859_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVN
OK143476_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
OK143479_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
OK382075_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
OK382077_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
OK998520_HBe_P-D      ALESPEHCSPHHTALRQAMLCWGELMTLATWVGVNLEDPASRDLVVSYVN
OK998522_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
OK998523_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
OK998524_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELRTLATWVGVNLEDPASRDLVVSYVN
OK998525_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
OK998527_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
OM025254_HBe_P-D      ALESPEHCSPHHTALRQACLCWGELMNLATWVGGNLEDQASRDLVVSYVN
OM456942_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVSYVN
OM721311_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
OM721316_HBe_P-D      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLQDPTSRDLVVSYVN
ON585703_HBe_P-D      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVN
X02496_HBe_P-D        ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
X65257_HBe_P-D        ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
X65258_HBe_P-D        ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
X85259_HBe_P-D        ALESPEHCSPQHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
X85273_HBe_P-D        ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
X85295_HBe_P-D        ALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPISRDLVVSYVN
X85298_HBe_P-D        ALESPEHCSPHHTALRHAILCWGDLRTLATWVGGNLEDPISRDLVVSYVN
X85301_HBe_P-D        ALESPEHCSPHHTALRQAILCWGDLMNLATWVGGNLEDPVSRDLVVGYVN
X85302_HBe_P-D        AFECSEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
X85318_HBe_P-D        ALESPRHCSPHHTALRQAILCWGELMTSASWVGVNLEDPASRDLVVSYVN
X97848_HBe_P-D        ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLQDPASRDLVVSYVN
AB078032_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB078033_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB090270_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB109475_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB116266_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB205126_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB210821_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB210822_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB330369_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB330370_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB471856_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB471857_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB493846_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AJ131956_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AJ627220_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AJ627223_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY230112_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY230114_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY233291_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY603428_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY603437_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY603440_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY603443_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ464169_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU414058_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU414060_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU414140_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594400_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594401_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594402_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594403_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594405_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594407_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594409_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594410_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594411_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594412_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594415_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594416_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594421_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594423_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594424_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594425_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594427_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594428_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594430_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594431_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594432_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594433_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FJ040872_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FJ349232_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FJ692506_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FJ692507_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ183471_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ183473_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ183474_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ183476_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ183477_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ183484_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ205388_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ922002_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HQ700511_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HQ700512_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HQ700513_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HQ700514_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN257181_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664911_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664912_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664913_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664917_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664927_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664930_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664937_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664938_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ707477_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ707492_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ707495_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX096954_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX096956_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX096957_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX096958_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898689_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898691_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898692_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898694_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898697_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875310_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875311_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875317_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875319_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875321_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875332_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KC875336_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF679994_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF679995_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF679996_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF679997_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779209_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779212_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779216_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779217_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779222_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779224_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779228_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779285_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779288_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779289_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779292_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779296_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779302_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779303_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779318_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779340_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779341_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779376_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF779377_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF798273_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM519455_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524341_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524349_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524350_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524351_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524352_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524353_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524354_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524355_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP090177_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP090178_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP090179_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP090180_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP090181_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP322601_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KR905423_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT151620_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT366494_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT366495_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT366496_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT366509_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT366510_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT366511_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668436_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668438_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668441_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668446_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU668449_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736924_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736925_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX196216_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX196219_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX196222_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX196231_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX196234_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX827301_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
LC705462_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
LT992438_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF618339_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF618341_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF618343_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF618348_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF925358_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF925364_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF925393_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724214_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724217_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724218_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724219_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724221_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724223_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724231_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK516278_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598662_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598663_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598665_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598666_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598667_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598668_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598669_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598671_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598672_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598675_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618419_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618420_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618421_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618422_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618426_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618443_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN310708_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN310713_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN310714_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507839_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT579898_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT579900_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT579902_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MW082640_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MW601266_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MW601275_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MW675898_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ097747_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ097789_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
V01460_HBe_P-D        ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
Z35716_HBe_P-D        ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB104711_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB104712_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB188244_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB222711_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB222712_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB222713_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB246347_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB246348_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB270543_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB583680_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AB674407_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AF121240_HBe_C-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AF121241_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AF280817_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY350614_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY371901_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY371902_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY371905_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY371907_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY371912_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY371914_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY371920_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY371921_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY371922_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY661792_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY661793_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY721606_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY721609_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY721610_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY721612_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY741797_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY945307_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EF103275_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EF103277_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EF103279_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EF103280_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU414136_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU594396_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU594397_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726854_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726862_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726869_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726874_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726878_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726887_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726888_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726895_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726898_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726900_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726902_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726907_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726909_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726914_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726918_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726919_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726923_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726924_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726930_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726931_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726935_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726940_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726962_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726964_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726967_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726971_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726972_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU726976_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU787437_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU787440_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU787441_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU787442_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU787445_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU787446_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU787447_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
FJ349228_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
FJ349229_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
FJ386590_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
FJ904443_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
GQ183480_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
GQ377589_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
GQ477459_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
GU357846_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HM750153_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HM750154_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HM750156_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700440_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700441_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700442_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700443_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700445_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700446_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700447_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700449_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700450_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700451_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700454_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700459_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700464_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700466_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700469_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700471_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700479_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700480_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700482_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700484_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700487_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ700488_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ833465_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ833467_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ833470_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
HQ833471_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JF754591_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JF754601_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JF754618_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JF754624_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JF754628_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040759_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040786_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040805_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040807_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN040826_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN132130_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN257151_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN257155_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN257171_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN257182_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN257185_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN257193_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN257194_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN257196_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN257199_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN558561_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN642131_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JQ038394_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JQ038414_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC774444_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC774445_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC774462_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875277_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875280_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875282_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875285_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875293_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KC875294_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF018180_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF018184_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF018191_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF061170_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF471647_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF471651_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF471652_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF584162_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF798260_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KF798283_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KM524339_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP322599_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671684_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671685_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671686_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671687_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671688_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671689_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671691_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671693_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671694_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671696_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671697_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP671699_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP857099_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP857100_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP857104_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP857105_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KP857106_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KT366498_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KT366500_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KT366502_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KT366508_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KX196215_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KX827300_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
KY382414_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
LC365689_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491136_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491157_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491161_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491165_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491190_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MG491192_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724954_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724955_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724956_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724958_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724963_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724975_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724981_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724982_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724983_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724986_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724987_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724989_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724991_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH724998_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725002_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725003_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725007_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725009_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725015_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725016_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725017_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725023_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725026_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725027_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725034_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725039_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725041_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725044_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725046_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725048_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725049_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725051_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725052_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725053_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725055_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725056_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725057_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725058_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725059_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725060_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725062_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725073_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725074_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725078_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725083_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725085_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725093_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725104_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725105_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725116_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725117_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725121_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725122_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725127_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725128_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725129_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725131_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725132_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725133_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725137_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725138_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725143_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725145_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725146_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725149_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725154_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725155_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725156_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725157_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725158_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725160_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725162_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725163_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725165_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725166_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725170_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725173_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725175_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725176_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725178_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725179_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725180_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725181_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725182_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725184_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725187_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725188_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725190_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725193_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725195_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725205_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725206_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725207_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725208_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MH725211_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK355500_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK507910_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK507911_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK507913_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK507914_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK598636_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK598637_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MK598638_HBe_P-D      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSY