HBVdb

Dataset for protein HBe of genotype D

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        .    .    . .  *  .        .*:*   ::: *   .        : .:  : ..        :  
MQLFHLCLIISCSCPTVQASKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPH
          f     f           d    s      s        a     i        f d        t  
                                                                              
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*  :  .    *      :* * ::     .     :.    .           .   :       :*    :*: :*  
HTALRQAILCWGeLMTLATWVGgNLEDPiSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETViEYLVSFGVWIRTPpA
   i        d in s    v  q qa  e   t    hv                   d  l             qp
               s      t     t      g                         q  v              g
                      a     v                                                   

       170       180       190       200       210      
....:....|....:....|....:....|....:....|....:....|....:.
: * **   . :    : *               *   *   .  .          
YRPPNAPILSTLPETTVVRRR--GRSP-RRRTPSPRRRRSQSPRRRRSQSRESQC-
               c i q   c p   g                k k  gp-- 
                   g     t                         d    
                                                        
© 1998-2020Legal notice