HBVdb

Dataset for protein SHBs of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:.*****     ***.*   * *: .:*. ** **** . *  ** ****. *** ****  **********.******
MENITSGLLGPLLVLQAVCFLLTKILTIPqSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
 ks     prlrp   g fss i vrkm kr  l    rss ee  e    sx   t    qi          r      
                  s w    x   r                x                                 
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 * ** *** ** ** *:***************:*******.***: *** ** ** ** ***:***** *******: :
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
t s  t   g  s  g v               s       r   sx   p  y  w  i   e     x       lvn
                                                  n  v                        r 
                                                     l                        a 
                                                                                
                                                                                

       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
:** ***.** *****. *.******** .*  .:**:**** .*     *** ****   **. * 
YLWEWASARFSWLSLLVQFvQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
f  d   v  f     ap a        ia psam  m    ls yntwr   l    cfc  vy x
   g             h                           wx                    
                                             st                    
                                             hr                    
                                             fi                    
© 1998-2020Legal notice