HBVdb

Dataset for protein SHBs of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:.****      ***.*   * *: .:*. ** **** . *  ** ****. *** ***   **********.******
MENITSGLLGPLLVLQAVCFLLTKILTIPqSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
            p   g fss i  r   k         s   e  e    s    t    qi          r      
                             r                                                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 * ** *** ** :  *:***************:***.***.***: *** ** ** ** **:: **** *******: :
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
         g  s                    s            x      y                        v 
                                                                                

       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
:** ***.** *****. *.** .**** .*  .:**:**** .*     *** ****   **. * 
YLWEWASARFSWLSLLVQFvQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI-
   d            ap a            sam  m       ynt r        c c   y  
                                             w                     
© 1998-2020Legal notice