HBVdb

Dataset for protein SHBs of genotype H

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:.****      ***.*   * *: .:*: ** **** . *  .* ****. *** ***   **********  *****
MENITSGLLGPLLVLQAVCFLLTKILTIPqSLDSWWTSLNFLGVPPGCPGQNSQSPISNHLPTSCPPTCPGYRWMCLRRF
            p   g fss i  r   k         s   e  e    s    t    qi               
                  y          r                                                  

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 * ** *** ** :  *:***************:***.***:***: *:* ** ** ** **:: **** *******: :
IIFLFILLLCLIFLLVLLDYQGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFGK
         g  s                    s            x h    y                        v 
                                                                                

       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
:** ***.** *****. *.** .**** .*  .:**:**** .*     *** ****   **. *
YLWEWASARFSWLSLLVQFvQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWASI
   d            ap a            sam  m       yntwr        c c   y 
                                             wx                   
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice