HBVdb

Dataset for protein SHBs of genotype H

[Download (right click)] [Edit] [Sequences] [Repertoires]

129 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JN604202_SHBs_P-H      MKNITSGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MK568527_SHBs_P-H      MENITSGLPGLRLVLQAVCFWLTKIRTMPKRLDSWWTSLNFLGVPPGCPG
MN818836_SHBs_P-H      MENITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MK568533_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKIRKIPQSLDSWWTSLNSLGVPPGCPG
DQ236129_SHBs_P-H      MENITSGLLGPLPVLQAVCSLLIKILTIPQSLDSWWTSLSFLGVPPGCPG
MT820155_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVTPGCPG
FJ356715_SHBs_P-H      MENITSGLLGPLLVLQAVFFLLTKVLTIPKSLDSWWTSLNFLGVPPGCPG
AB059659_SHBs_P-H      MENITSGLLGPLPVLQGVFFSLTKILTIPQSLDSWWTSLNFLEVPPGCPG
DQ236127_SHBs_P-H      MENITSGLLGPLLVLQGVFFSLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236126_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDLWWTSLNFLGVPPGCPG
MN818837_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MF150691_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGVPPECPG
DQ236109_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT820162_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT832840_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT820161_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT832839_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT832842_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT832843_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT832844_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT832846_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MN818841_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGVPPGCPG
MN818839_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MF150692_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGVPPECPG
KM998723_SHBs_P-H      MESITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM606937_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGEPPGCPG
KC836829_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
GQ486268_SHBs_P-H      MENITSGLLGPLLVLQAVSFLLTKILTIPRSLDSWWTSLSFLGVPPGCPG
DQ236132_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGVPPGCPG
KM606705_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGEPPGCPG
DQ236113_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236112_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236111_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369543_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369540_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236106_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369536_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSRNFLGVPPGCPG
AB353764_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB353766_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
HM117850_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MN818838_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT820157_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT832841_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB275308_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB375163_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236118_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT820158_SHBs_P-H      MENITSGLLGPLLVLQAVYFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT832845_SHBs_P-H      MENITSGLLGPLLVLQAVYFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT820156_SHBs_P-H      MENITSGLLGPLLVLQAVYFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT820159_SHBs_P-H      MENITSGLLGPLLVLQAVYFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB064315_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGVPPGCPG
MF150695_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KX372218_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998717_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
GQ486375_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLSFLGVPPXCPG
AB059660_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB059661_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB179747_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB205010_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB266536_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB353765_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AB375159_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB375161_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB375162_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB375164_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB818694_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
AF369531_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369535_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369537_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369538_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369539_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369541_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AF369542_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AY090454_SHBs_C-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AY090457_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AY090460_SHBs_P-H      MENITSGLLRPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236101_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236102_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236114_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236120_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236121_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236122_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236123_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236124_SHBs_P-H      MENITSGLLGPLLVLQAVCSLLTKIRTIPKSLDSWWTSLNFLGVPPGCPG
DQ236125_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236130_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236131_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
EF157291_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
EU159675_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
EU498228_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
FJ356716_SHBs_C-H      MENITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGVPPGCPG
GQ486592_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
HM066946_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
HM117851_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
HQ285946_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
JN604203_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKIXTIPKSLDSWWTSLNFLGVPPGCPG
JN604310_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998718_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998719_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998720_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998721_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KM998722_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KP997512_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGVPPGCPG
KX264501_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KY458059_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
KY458060_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MF150696_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MK568522_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MK568523_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MK568524_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MK568526_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MK568532_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MN818829_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MN818831_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MN818832_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MN818833_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MN818834_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MK568534_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MN818835_SHBs_P-H      MENITSGSLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLSFLGVPPGCPG
MN818840_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MN818842_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT622523_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT820154_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT820160_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
MT832847_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
U91819_SHBs_P-H        MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
U91827_SHBs_P-H        MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
AB375160_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
DQ236115_SHBs_P-H      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGVPPGCPG
                       *:.****      ***.*   * *: .:*. ** **** . *  .* ***

JN604202_SHBs_P-H      QNXQSPISNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK568527_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFTIFLFILLLCLIFLLVLLDY
MN818836_SHBs_P-H      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK568533_SHBs_P-H      QNSQSPTSNHLQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236129_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT820155_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWTCLRRFIIFLFILLLCLIFLLVLLDY
FJ356715_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB059659_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236127_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
DQ236126_SHBs_P-H      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MN818837_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLISVSVLLDY
MF150691_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
DQ236109_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT820162_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT832840_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT820161_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT832839_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT832842_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT832843_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT832844_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT832846_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818841_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818839_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150692_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998723_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606937_SHBs_P-H      QNSQSPISNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC836829_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486268_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236132_SHBs_P-H      QNSQSPISNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606705_SHBs_P-H      QNSQSPISNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236113_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236112_SHBs_P-H      QSSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236111_SHBs_P-H      QSSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369543_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369540_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236106_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369536_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB353764_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB353766_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM117850_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818838_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT820157_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT832841_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB275308_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375163_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236118_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT820158_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT832845_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT820156_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT820159_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB064315_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150695_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372218_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998717_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486375_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB059660_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB059661_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB179747_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205010_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB266536_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB353765_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375159_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375161_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375162_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375164_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB818694_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369531_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369535_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369537_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369538_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369539_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369541_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369542_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090454_SHBs_C-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090457_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090460_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236101_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236102_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236114_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236120_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236121_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236122_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236123_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236124_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236125_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236130_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236131_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF157291_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU159675_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU498228_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ356716_SHBs_C-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486592_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM066946_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM117851_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ285946_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604203_SHBs_P-H      QNSQSPISNHLQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604310_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998718_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998719_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998720_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998721_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998722_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KP997512_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX264501_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY458059_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY458060_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150696_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK568522_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK568523_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK568524_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK568526_SHBs_P-H      QSSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK568532_SHBs_P-H      QSSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818829_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818831_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818832_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818833_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818834_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK568534_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLISLLVLLDY
MN818835_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818840_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN818842_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT622523_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT820154_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT820160_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT832847_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91819_SHBs_P-H        QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91827_SHBs_P-H        QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB375160_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRRMCLRRFIIFLFILLLGLIFLLVLLDY
DQ236115_SHBs_P-H      QNSQSPISNHLPTSCPPTCPGYRRMCLRRFIIFLFILLLGLIFLLVLLDY
                       *. *** ***   **********. ***** * ** *** ** :  *:**

JN604202_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MK568527_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818836_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MK568533_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236129_SHBs_P-H      QGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMVPSCCCTKPSDGNCTCI
MT820155_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
FJ356715_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB059659_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236127_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236126_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818837_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDRNCTCI
MF150691_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236109_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSWCCTKPSDGNCTCI
MT820162_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAHGTSMFPSCCCTKPSDGNCTCI
MT832840_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAHGTSMFPSCCCTKPSDGNCTCI
MT820161_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAHGTSMFPSCCCTKPSDGNCTCI
MT832839_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAHGTSMFPSCCCTKPSDGNCTCI
MT832842_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAHGTSMFPSCCCTKPSDGNCTCI
MT832843_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAHGTSMFPSCCCTKPSDGNCTCI
MT832844_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAHGTSMFPSCCCTKPSDGNCTCI
MT832846_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAHGTSMFPSCCCTKPSDGNCTCI
MN818841_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818839_SHBs_P-H      QGMLPVCPLLPGSTTTSKGPCKTCTTLAQGTSMFPSCCCTKPTDGNCTCI
MF150692_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998723_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM606937_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KC836829_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
GQ486268_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236132_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM606705_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236113_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236112_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGNSMFPSCCCTKPSDGNCTCI
DQ236111_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369543_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369540_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236106_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369536_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB353764_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB353766_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
HM117850_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818838_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MT820157_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MT832841_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB275308_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGPSMFPSCCCTKPSDGNCTCI
AB375163_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCTKPSDGNCTCI
DQ236118_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCTKPSDGNCTCI
MT820158_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MT832845_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MT820156_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MT820159_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB064315_SHBs_P-H      QGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MF150695_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KX372218_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998717_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCX
GQ486375_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB059660_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB059661_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB179747_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB205010_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB266536_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB353765_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB375159_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB375161_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB375162_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB375164_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB818694_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369531_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369535_SHBs_P-H      QGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMYPSCCCTKPSDGNCTCI
AF369537_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369538_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369539_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369541_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AF369542_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AY090454_SHBs_C-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AY090457_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AY090460_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236101_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236102_SHBs_P-H      QGMLPVCPLLPGSSTTSTGPCKTCTTLAQGTSMYPSCCCTKPSDGNCTCI
DQ236114_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMLPSCCCTKPSDGNCTCI
DQ236120_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236121_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236122_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236123_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236124_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236125_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236130_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTSLAQGTSMFPSCCCTKPSDGNCTCI
DQ236131_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
EF157291_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
EU159675_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
EU498228_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
FJ356716_SHBs_C-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
GQ486592_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
HM066946_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
HM117851_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCIKPSDGNCTCI
HQ285946_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
JN604203_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
JN604310_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998718_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998719_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998720_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998721_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KM998722_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCTKPSEGNCTCI
KP997512_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KX264501_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KY458059_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KY458060_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MF150696_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MK568522_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MK568523_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MK568524_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MK568526_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MK568532_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818829_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818831_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818832_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818833_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818834_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MK568534_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818835_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MN818840_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCT
MN818842_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MT622523_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MT820154_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MT820160_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MT832847_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
U91819_SHBs_P-H        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
U91827_SHBs_P-H        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB375160_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ236115_SHBs_P-H      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
                       *************:***.***.***: *:* ** ** ** **:: **** 

JN604202_SHBs_P-H      PIPSSWALGNYLWEWASARFSWLSLLVQFVQWCVGLSPIVWPLVIWMIWY
MK568527_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MN818836_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWFVGLSPTVWLLVIWMIWY
MK568533_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236129_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT820155_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ356715_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB059659_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236127_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236126_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTAWLSVIWMIWY
MN818837_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MF150691_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236109_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLAIWMMWY
MT820162_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
MT832840_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
MT820161_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT832839_SHBs_P-H      PIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT832842_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT832843_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT832844_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT832846_SHBs_P-H      PIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MN818841_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCAGLSPTVWLLVIWMIWY
MN818839_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
MF150692_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998723_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM606937_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KC836829_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
GQ486268_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236132_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM606705_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236113_SHBs_P-H      PIPSSWAFRKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236112_SHBs_P-H      PIPSSWAFVKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236111_SHBs_P-H      PIPSSWAFVKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369543_SHBs_P-H      PIPSSWAFGKFLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
AF369540_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236106_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369536_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB353764_SHBs_P-H      PIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
AB353766_SHBs_P-H      PIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
HM117850_SHBs_P-H      PIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
MN818838_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
MT820157_SHBs_P-H      PIPSSWAFGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
MT832841_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
AB275308_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB375163_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVPFVQWCVGLSPTVWLSAIWMMWY
DQ236118_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVPFVQWCVGLSPTVWLSAIWMMWY
MT820158_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
MT832845_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT820156_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT820159_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB064315_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MF150695_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KX372218_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998717_SHBs_P-H      PIPSSWAFGKYLWGWASARFFWLSLLVPFVQWCVGLSPTVWLLVIWMIWY
GQ486375_SHBs_P-H      PIPSSWAFAKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB059660_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB059661_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB179747_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB205010_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB266536_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB353765_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB375159_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
AB375161_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB375162_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
AB375164_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB818694_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369531_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369535_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369537_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369538_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369539_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF369541_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
AF369542_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
AY090454_SHBs_C-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY090457_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY090460_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236101_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236102_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236114_SHBs_P-H      PIPSSWAFGKYLWEWASVRFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236120_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
DQ236121_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236122_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236123_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236124_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236125_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236130_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ236131_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF157291_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EU159675_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EU498228_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ356716_SHBs_C-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
GQ486592_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM066946_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM117851_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HQ285946_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN604203_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN604310_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998718_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998719_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998720_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVHFVQWCVGLSPTVWLLVIWMIWY
KM998721_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998722_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP997512_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KX264501_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY458059_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY458060_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MF150696_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
MK568522_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MK568523_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MK568524_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MK568526_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MK568532_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MN818829_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
MN818831_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
MN818832_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
MN818833_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
MN818834_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
MK568534_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MN818835_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MN818840_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
MN818842_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT622523_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFAQWCVGLSPTVWLLVIWMIWY
MT820154_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT820160_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MT832847_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
U91819_SHBs_P-H        PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
U91827_SHBs_P-H        PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB375160_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLAQFAQWCVGLSPTVWLLVIWMIWY
DQ236115_SHBs_P-H      PIPSSWAFGKYLWEWASARFSWLSLLAQFAQWCVGLSPTVWLLVIWMIWY
                       *******: ::** ***.** *****. *.** .**** .*  .:**:**

JN604202_SHBs_P-H      WGPNLCNILSPFIPLLPIFCYLWASI
MK568527_SHBs_P-H      WGPNLYIILSPFIPLLPIFCYLWASI
MN818836_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MK568533_SHBs_P-H      WGPNLYNILSPFIPLLPIFCYLWASI
DQ236129_SHBs_P-H      WGPNLCNIWSPFIPLLPIFCYLWASI
MT820155_SHBs_P-H      WGPNLCNTWSPFIPLLPIFCYLWASI
FJ356715_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB059659_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236127_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236126_SHBs_P-H      WGPNLHTILSPFIPLLPIFCYLWASI
MN818837_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MF150691_SHBs_P-H      WGPNLCSTLRPFIPLLPIFCYLWASI
DQ236109_SHBs_P-H      WGPSLCSILSPFIPLLPIFCCLWAYI
MT820162_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT832840_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT820161_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT832839_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT832842_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT832843_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT832844_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT832846_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818841_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818839_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MF150692_SHBs_P-H      WGLNLWSTLRPFIPLLPIFCYLWASI
KM998723_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KM606937_SHBs_P-H      WGPNLCSILRPFIPLLPICCYLWASI
KC836829_SHBs_P-H      WGPNLCSILSPFIPLLPIFFCLWVYI
GQ486268_SHBs_P-H      WGPNLYSTLSPFIPLLPIFCYLWASI
DQ236132_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KM606705_SHBs_P-H      WGPNLCSILRPFIPLLPIFCYLWASI
DQ236113_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236112_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236111_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AF369543_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AF369540_SHBs_P-H      WGPNLCSILSPFIPLLPICCYLWASI
DQ236106_SHBs_P-H      WGPNLCSILSPFIPLLPICCYLWASI
AF369536_SHBs_P-H      WGPNLCSILSPFILLLPIFCYLWASI
AB353764_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB353766_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
HM117850_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818838_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT820157_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT832841_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB275308_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB375163_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236118_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT820158_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT832845_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT820156_SHBs_P-H      WGPNLCXXXSPFIPLLPIFCYLWASI
MT820159_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB064315_SHBs_P-H      WGPNLCNILSPFIPLLPIFCYLWASI
MF150695_SHBs_P-H      WGPNLSNTLSPFIPLLPIFCYLWASI
KX372218_SHBs_P-H      WGPNLWRILSPFIPLLPIFCYLWASI
KM998717_SHBs_P-H      WGPNLCSILRPFIPLLPIFCYLWASI
GQ486375_SHBs_P-H      WGPNLCXILSPFIPLLPIFCYLWASI
AB059660_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB059661_SHBs_P-H      WGPNLCSILRPFIPLLPIFCYLWASI
AB179747_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB205010_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB266536_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB353765_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB375159_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB375161_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB375162_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB375164_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AB818694_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AF369531_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AF369535_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AF369537_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AF369538_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AF369539_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AF369541_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AF369542_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AY090454_SHBs_C-H      WGPNLCSILSPFIPLLPIFCYLWASI
AY090457_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
AY090460_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236101_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236102_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236114_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236120_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236121_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236122_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236123_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236124_SHBs_P-H      WGPNLFSILSPFIPLLPIFCYLWASI
DQ236125_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236130_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236131_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
EF157291_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
EU159675_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
EU498228_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
FJ356716_SHBs_C-H      WGPNLCSILSPFIPLLPIFCYLWASI
GQ486592_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
HM066946_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
HM117851_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
HQ285946_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
JN604203_SHBs_P-H      WGPNLYSILSPFIPLLPIFCYLWASI
JN604310_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KM998718_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KM998719_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KM998720_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KM998721_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KM998722_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KP997512_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KX264501_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KY458059_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
KY458060_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MF150696_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MK568522_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MK568523_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MK568524_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MK568526_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MK568532_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818829_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818831_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818832_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818833_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818834_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MK568534_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818835_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818840_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MN818842_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT622523_SHBs_P-H      WGPNLYSILSPFIPLLPIFCYLWASI
MT820154_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT820160_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
MT832847_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
U91819_SHBs_P-H        WGPNLCSILSPFIPLLPIFCYLWASI
U91827_SHBs_P-H        WGPNLCSILSPFIPLLPIFCYLWASI
AB375160_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
DQ236115_SHBs_P-H      WGPNLCSILSPFIPLLPIFCYLWASI
                       ** .*     *** ****   **. *

© 1998-2022Legal notice