HBVdb

Dataset for protein Pol of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :   :   *:**     . ::: ** : :  *  :* .:*:      .** . *:* . *:**:    *:   :.  
MPLSYQHFRRiLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNVSIPWTHKVGNFTGLYSSTIPVFNPNWKTPS
     p  lsl    d        d   h             fhv d                 t l i  sh  p f
                                                                          s     
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
** **:: *:: :* ::*****::::*:*    *.:*:*  *:*    :* *.**     ****: ****  **  * **
FPDIHLHQDIINKCEQFVGPLTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYLHTLWKAGILY
  n        dr                k i        a   f  d        e l                   
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:*  :  **: *  *  *  : : .           :     :     *. **. .  :    *** :*: : *   : *
KRETTRSASFcGSPYSWEQeLHHGAFLDGPSRM-GEESFHHQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDrSQQG
    s   f     hd    t v         k v lk f           ve pq    s  h  s  gr   
    a     y                                            l                        
          w                                                                     

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *  :       .      : :.                   .     .    .*  . .        :.  *       
RSGSIRAgVHSPTRRPFGVEPSGSRHAkNIASRSASCLHQSAVRKAAYPNHSTFERHSSSGHAVEFHNiPPSSAGSQSKR
   c w way  a   s m s     vnyv nk    f    i      t       a p rtm lqsfs n tr   e-
       r    p              t s                           p                e    g
                           e                                                    

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     ** .**.    * .*:: : *  : *          :: * :**:. .* *   *** *: **** *:*   .**
PVfSCWWLQFRNSEPCSDYCLtHLVNLLEDWGPCTEHGkHHIRIPRTPARVTGGVFLVDKNPHNTAESRLVVDFSQFSRG
--sp         k       s i              r y         i   i                         
s -                                   e                                         
  v                                                                             

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   : ****. *:  ***.: .  *: :.** .:.:    ***. :*:** ******  :**: . .   .::      :
SSRVSWPKFAVPNLQSLTNLLSSNLSWLSLDVSAAFYHLPLHPAAMPHLLVGSSGLSRYVARLSSNSRIINHQYGTLPNL
i                      d a            i                          t   l       q  
n                                                                               
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*:  *: *    :* :::  :*   *.**:: ********:****** * ****:******. ****** *:******: 
HDSCSRNLYVSLMLLFKTFGRKLHLYSHPIIMGFRKIPMGVGLSPFLLAQFTSAICSVVRRAFPHCLAFSYMDDVVLGAK
     k   i                     l                                               r
                                                                                
                                                                                

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   ** :::*: ****::***::*. : : ***.  :**  *. :*:*** :*  **  *:*:** .* :***. * :.*
SVQHLESLYTsVTNFLLSLGIHLNPNKTKRWGYSLnFMGYVIGSWGSLPQEHIRmKIKDCFRKLPVNRPIDWKVCQRIVG
t     a   a             st         h    i         d  kt                      l  
                        a          q                 tl                         
                                                      s                         

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**.*.***** *:***:*:*:. :  :** *** *.:**  **  *:*  *:* .**********.**.*.:.  *  . 
LLGFAAPFTQCGYPALMPLYACIQSKQAFTFSPTYKAFLCkQYlNLYPVARQRPGLCQVFADATPTGWGLAiGHQRmRGT
                  i t th          t  yq  mt        s                 l      
                                        t   d                          m      
                                        n                                     

       730       740       750       760       770       780       790       800
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :*   : *:*:. *:* * :** ::**:********  :***:**  *.*:* ***: :* *.:  .***  *:**  
FVAPLPIHTAELLAACFARSRSGAKLIGTDNSVVLSRKYTSFPWLLGCAANWILRGTSFVYVPSALNPADDPSRGRLGiy
    m                   n                                                     vs
                        t                                                      f
                                                                               c

       810       820       830       840     
....:....|....:....|....:....|....:....|....:
:  : * : . * :* :*      .   . * .:.**  * * * 
RPLLRLPFqPTTGRTSLYAVSPSVPSHLPDRVHFASPLHVAWRPP
        r s              trp v            k  
        h                    g               
                             a               
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice