HBVdb

Dataset for protein Pol of genotype E

[Download (right click)] [Edit] [Sequences] [Repertoires]

333 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


FN594765_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPDV
HM363611_Pol_P-E      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLHLPNV
AB106564_Pol_C-E      MPLSYQHFRRILLLDEE--AGPLEDELPRLADEDLNRRVAEDLNLQLPNV
AB205190_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MF772358_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MF772356_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLHLPNV
GQ161760_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN594760_Pol_P-E      MPLSCQRFRRILLLDEE--AGPLEEELPHLADADLNRRVAEDLNLQLPNV
FN594758_Pol_P-E      MPLSCQRFRRILLLDEE--AGPLEEELPHLADADLNRRVAEDLNLQLPNV
FN594759_Pol_P-E      MPLSCQRFRRILLLDEE--AGPLEEELPHLADADLNRRVAEDLNLQLPNV
FN594751_Pol_P-E      MPLSYQHFRSILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MF772357_Pol_P-E      MPLSYPHFRKLLLLDEE--SGPLEEELPRLADEDLNRRVAEDLNLQLPDV
HM363602_Pol_P-E      MPLSYQHFRRLLLLDED--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
EU239220_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN594766_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPHLADEDLNRRVAEDLNLQLPNV
EU239219_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEDELPRLADEDLNRRVAEDLNLQLPNV
EU239223_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEDELPRLADEDLNRRVAEDLNLQLPNV
AY738147_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPLLADEDLNRRVAEDLNLQLPNV
AY738146_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPLLADEDLNRRVAEDLNLQLPNV
AY738144_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPLLADEDLNRRVAEDLNLQLPNV
AY738145_Pol_C-E      MPLSYQHFRRILLLDEE--AGPLEEELPLLADEDLNRRVAEDLNLQLPNV
KF849717_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN594762_Pol_P-E      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF170741_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNPNPPPW
FN594748_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEDELPRLADEDLNRRVAEDLNLQLPNV
DQ060822_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849714_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN594749_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849726_Pol_P-E      MPLSYHHFRSVLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB219533_Pol_P-E      MPLSYQHFRRILLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849715_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ060825_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ060828_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ060829_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KM606738_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN594750_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AY935700_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ060824_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ060827_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
JQ000008_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ060823_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849725_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MF772354_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849721_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849718_Pol_P-E      MPLSYQHFRSVLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
JQ000009_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB201290_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849713_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849719_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849722_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ060826_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF922439_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPHV
KT192626_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPHV
KF922438_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN594763_Pol_P-E      MPLSYQHFRSILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB915175_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB201289_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN594752_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363565_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEDELPRLADEDLNRRVAEDLNLQLPIV
HM363599_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MF772355_Pol_P-E      MPLSYQHFLKLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB274984_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPDV
HM363566_Pol_P-E      MPLSYPHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161758_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161766_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161774_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
LT623844_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLBRRVAEDLNLQLPNV
HM363607_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADADLNRRVAEDLNLHLPTV
HM363605_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQVPNV
FN594761_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEDELPRLADEDLNRRVAEDLNLQLPNV
AB915180_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAKDLNLEVPNV
HM363603_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPTV
EU239222_Pol_P-E      MPLSYQHFLRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494689_Pol_P-E      MPLSYLHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AY739674_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AY739675_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
LT623851_Pol_P-E      MPLSYQHFRRLLLLDXE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363572_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN594756_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
LT623846_Pol_P-E      MPLSYQHFRRILLLDEE--AGHLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363598_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB915178_Pol_P-E      MPLSYQHFLRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB274979_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736913_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPXV
HM363584_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363574_Pol_P-E      MPLSYPHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN545822_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494699_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363580_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363581_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363579_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580640_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580641_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161762_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB205129_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736911_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB205192_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB205191_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB205189_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEGLPRLADEDLNRRVAEDLNLQLPNV
EU239221_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849723_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363606_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNLRVAEDLNLQLPNV
HM363582_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN545823_Pol_P-E      MPLSYQHFRRXLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN545821_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494691_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
X75657_Pol_P-E        MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580638_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
LT623850_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494705_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB201287_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MF772362_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736901_Pol_P-E      MPLSYQHFRRILLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736893_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADXDLNRRVAEDLNLQLPNV
HM363609_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363583_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363578_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPTV
DQ060830_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADDDLNRRVAEDLNLQLPNV
AB274970_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPHLADEDLNRRVAEDLNLQLPNV
KU736891_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736892_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736910_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736909_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736903_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363569_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161811_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494703_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLKEELPRLADEDLNRRVAEDLNLHLPNV
AM494695_Pol_P-E      MPLSYQHFRRLLLLDTE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580617_Pol_P-E      MPLSYQHFRRILLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580628_Pol_P-E      MPLSYQHFRRILLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580644_Pol_P-E      MPLSYQHFRRILLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494707_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736902_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736900_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363570_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
EU239218_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF170742_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLHNV
HM363575_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQVPNV
HM363576_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQVPNV
HM363585_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736904_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEELNRRVAEDLNLQLPNV
AM494690_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494693_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494701_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494702_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494704_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494708_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494713_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494717_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736905_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MK720632_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MK720631_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MK321264_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736912_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736908_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736906_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736907_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH918655_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KX186584_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494715_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161780_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEDLPRLADEDLNRRVAEDLNLQLPNV
MN507842_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEDELPRLADEDLNRRVAEDLNLQLPNV
MN507841_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363610_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363604_Pol_P-E      MPLSYPHFRRMLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580648_Pol_P-E      MPLSYQHFLRLLLLDEE--AGPLEEELPRLADEDLNRRVADDLNLHLPNV
GQ161757_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB274980_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580626_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FJ349240_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363591_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363597_Pol_P-E      MPLSYPHFRKLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363601_Pol_P-E      MPLSYQHFLRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363590_Pol_P-E      MPLSYQHFLRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363588_Pol_P-E      MPLSYQHFLRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363589_Pol_P-E      MPLSYQHFLRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
LT623847_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KT749841_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HQ700550_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADDDLNRRVAEDLNLQLPNV
HQ700552_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADDDLNRRVAEDLNLQLPNV
HM363596_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161815_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161797_Pol_P-E      MPLSYQHFRKLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN545842_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FJ349226_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494692_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494714_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLHLPNV
MH580650_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494710_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494697_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494709_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KM606739_Pol_P-E      MPLSYQHFRRILLLDEE--AGPIEEELPRLADEDLNRRVAEDLNLQLPNV
FJ349239_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MN507846_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN545827_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FN545841_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MF772360_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB201288_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB091256_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161768_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736894_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161807_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161761_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161830_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494706_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161778_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161810_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161790_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161805_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161799_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNFQLPNV
GQ161818_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNFQLPNV
GQ161821_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNFQLPNV
GQ161783_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAENLNLQLPNV
GQ161824_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAENLNLQLPNV
LT623848_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVADDLNLQLPNV
LT623843_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MN507848_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363571_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161808_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161773_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161802_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
LT623845_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MN507840_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADVDLNRRVAEDLNLQLPDV
HM363567_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB194948_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
LT623849_Pol_P-E      MPLSYQHFRRXLLLDEE--AGPLEEELPXLXDEDLNRRVXEDLNLXLPNV
AB274978_Pol_P-E      MPLSYQHFRRLLLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
EU239217_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB274975_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
EU239226_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB274969_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB274981_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLHNV
HM363600_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRHVAEDLNLQLPDV
HM363593_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MN507845_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580645_Pol_P-E      MPLSYQHFRRLLLLDQE--AGPLEEELPRLADEDLNRRVAEDLNLQLPDV
HM363587_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363586_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161775_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPDV
MH580621_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580622_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580625_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580637_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363573_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580634_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580635_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580636_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580647_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB194947_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNLRVAEDLNLQLPNV
MH580629_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580646_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580649_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580624_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363608_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161785_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB274977_Pol_P-E      MPLSYQHFRRLLFLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MN507844_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KF849724_Pol_P-E      MPLSYQHFRRLLLLDEG--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363592_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MN507847_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580631_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580632_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580652_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363594_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363568_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
EU239224_Pol_P-E      MPLSYQHFRRILLLDGE--AGPLEEELPRLADEELNRRVAEDLNLQLPNV
AB274976_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB274974_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736897_Pol_P-E      MPLSYQHFRRILLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736898_Pol_P-E      MPLSYQHFRRILLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161834_Pol_P-E      MPLSYQLFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161803_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRHVAEDLNLQLPNV
GQ161763_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736895_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736896_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161794_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161786_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEGLNRRVAEDLNLQLPNV
GQ161769_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161779_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM363595_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161771_Pol_P-E      MPLSYQHFRRILLLDDE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161765_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161759_Pol_P-E      MPLSYQHFLRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FJ349237_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB274971_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161817_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161784_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161776_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161789_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161828_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB274982_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLHNV
GQ161793_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161777_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
LT623842_Pol_P-E      MPLSYQXFRRXLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161816_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161804_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161787_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161772_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161770_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FJ349238_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161832_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161827_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161755_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB091255_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MN507843_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161835_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161833_Pol_P-E      MPLSYQQLRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161836_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH580630_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KU736899_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161820_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161829_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161819_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161801_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161800_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161798_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161791_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161781_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161764_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494700_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494694_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AM494696_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161814_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLANEDLNRRVAEDLNLQLPNV
GQ161812_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161782_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161792_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161822_Pol_P-E      ---SYQQLRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161825_Pol_P-E      MPLSYQHFRRLLLLD-Q--AGPIEEELPHLADEDLNRRVAEDLNLQLPNV
MH464855_Pol_P-E      MPLSYQHFRRILLLDEEXXAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MH464856_Pol_P-E      MPLSYQHFRRILLLDEEXXAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161756_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
GQ161795_Pol_P-E      MPLSYQHFRRLLLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HQ700551_Pol_P-E      MPLSYQHFRRILLLDEE--AGPLEEELPRLADEDLNRRVAEDLNLQLPNV
                         *   :   *:**    :* ::: ** * :  *  .* .:**      

FN594765_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363611_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWQTPSFPDIHLHQDIVNKCEQFVGP
AB106564_Pol_C-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB205190_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MF772358_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MF772356_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161760_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594760_Pol_P-E      NIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594758_Pol_P-E      NIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594759_Pol_P-E      NIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594751_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MF772357_Pol_P-E      SIPWTHKVGNFTGLYSSTIPIFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363602_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
EU239220_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594766_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
EU239219_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNSNWKTPSFPDIHLHQDIINKCEQFVGP
EU239223_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNSNWKTPSFPDIHLHQDIINKCEQFVGP
AY738147_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AY738146_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AY738144_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AY738145_Pol_C-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849717_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594762_Pol_P-E      SIPWTHKVGNFTGLYSSAIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF170741_Pol_P-E      SIPSTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594748_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
DQ060822_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849714_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594749_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849726_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB219533_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849715_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
DQ060825_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
DQ060828_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
DQ060829_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KM606738_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594750_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AY935700_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
DQ060824_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
DQ060827_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
JQ000008_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
DQ060823_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849725_Pol_P-E      SIPWTHKVGNFTGLYSSSIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MF772354_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849721_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849718_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
JQ000009_Pol_P-E      SIPWPHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB201290_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849713_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849719_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849722_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
DQ060826_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTLSFPDIHLHQDIINKCEQFVGP
KF922439_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KT192626_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF922438_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594763_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB915175_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB201289_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594752_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363565_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPDIHLHQDIINKCEQFVGP
HM363599_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MF772355_Pol_P-E      SIPWTHKVGNFTGLYSSSIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB274984_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363566_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPDIHLHQDIIDKCEQFVGP
GQ161758_Pol_P-E      SIPWTHKVGNFTGLYSSTIPIFNPNWKTPFFPDIHLHQDIINRCEQFVGP
GQ161766_Pol_P-E      SIPWTHKVGNFTGLYSSTIPIFNPNWKTPFFPDIHLHQDIINRCEQFVGP
GQ161774_Pol_P-E      SIPWTHKVGNFTGLYSSTIPIFNPNWKTPFFPDIHLHQDIINRCEQFVGP
LT623844_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPNIHLHQDIINKCEQFVGP
HM363607_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363605_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594761_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB915180_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363603_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPHWKTPSFPDIHLHQDIINKCEQFVGP
EU239222_Pol_P-E      SIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFPDIHLHQDIINKCVQFVGP
AM494689_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIIDKCEQFVGP
AY739674_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPSWKTPSFPDIHLHQDIINKCEQFVGP
AY739675_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPSWKTPSFPDIHLHQDIINKCEQFVGP
LT623851_Pol_P-E      SIPWTHKVGNFTGIYSSTIPTFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363572_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN594756_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPSWKTPSFPDIHLHQDIINKCEQFVGP
LT623846_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPSWKTPSFPNIHLHQDIINKCEQFVGP
HM363598_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB915178_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB274979_Pol_P-E      SIPWTHKVGNFAGLYSSTIPVFNPHWKTPSFPDIHLHQDIINKCEQFVGP
KU736913_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363584_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKPPSFPDIHLHQDIINKCEQFVGP
HM363574_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN545822_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494699_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363580_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363581_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363579_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580640_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580641_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161762_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPSWKTPSFPDIHLHQDIINKCEQFVGP
AB205129_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736911_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB205192_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB205191_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB205189_Pol_P-E      SIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
EU239221_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849723_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363606_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363582_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN545823_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN545821_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494691_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
X75657_Pol_P-E        SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580638_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIIHKCEQFVGP
LT623850_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPHWKPPSFPDIHLHQDLINKCEQFVGP
AM494705_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB201287_Pol_P-E      SIPWTPKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MF772362_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736901_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736893_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIIDKCEQFVGP
HM363609_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNLNLKTPSFPDIHLHQDIINKCEQFVGP
HM363583_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363578_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
DQ060830_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB274970_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736891_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIITKCEQFVGP
KU736892_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIITKCEQFVGP
KU736910_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736909_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736903_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363569_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNSNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161811_Pol_P-E      SIPWTHKVGNFTGLYSSTIPIFNPNWKTPSFPDIHLHQDIIKKCEQFVGP
AM494703_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494695_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580617_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580628_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580644_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494707_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736902_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736900_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363570_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNSNWKTPSFPDIHLHQDIINKCEQFVGP
EU239218_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF170742_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363575_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363576_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363585_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736904_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNSNWKTPSFPDIHLHQDIINKCEQFVGP
AM494690_Pol_P-E      SIPWTHKVGNFTGLYSSNIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494693_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494701_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494702_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494704_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494708_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494713_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494717_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736905_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MK720632_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPFFPDIHLHQDIINKCEQFVGP
MK720631_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPFFPDIHLHQDIINKCEQFVGP
MK321264_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPFFPDIHLHQDIINKCEQFVGP
KU736912_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736908_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736906_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736907_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH918655_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KX186584_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494715_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161780_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MN507842_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MN507841_Pol_P-E      SIPWPHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363610_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363604_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580648_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161757_Pol_P-E      SIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB274980_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPNIHLHQDIVNKCEQFVGP
MH580626_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FJ349240_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPEIHLHQDIINKCEQFVGP
HM363591_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363597_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363601_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363590_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363588_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363589_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
LT623847_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPEIHLHQDIINKCEQFVGP
KT749841_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HQ700550_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HQ700552_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363596_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161815_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161797_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN545842_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FJ349226_Pol_P-E      SIPWTHKVGNFTGLYSSTVPVFNPNWKTPSFPDIHLHQDIINKCEQLVGP
AM494692_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494714_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580650_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494710_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494697_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494709_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KM606739_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FJ349239_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MN507846_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN545827_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FN545841_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MF772360_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB201288_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB091256_Pol_P-E      SIPWTHKVGNFSGLYSSTIPVFNPHWKTPSFPDIHLHQDIINKCEQFVGP
GQ161768_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736894_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161807_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161761_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161830_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494706_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161778_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161810_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161790_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161805_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161799_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161818_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161821_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161783_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161824_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
LT623848_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
LT623843_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHXDIINKCEQFVGP
MN507848_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363571_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161808_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161773_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161802_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
LT623845_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MN507840_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363567_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB194948_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
LT623849_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPXIHLHQDIINKCEQFVGP
AB274978_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
EU239217_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB274975_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
EU239226_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB274969_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLYQDIINKCEQFVGP
AB274981_Pol_P-E      SIPWTHKVGNFAGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363600_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363593_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MN507845_Pol_P-E      SIPWTHKVGNFTGLYSTTIPVFNPHWKTPSFPDIHLHQDIINKCEQFVGP
MH580645_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363587_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363586_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161775_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580621_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580622_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580625_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580637_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363573_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580634_Pol_P-E      SIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580635_Pol_P-E      SIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580636_Pol_P-E      SIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580647_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB194947_Pol_P-E      SIPWTHKVGNFTGLYSSTIPTFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580629_Pol_P-E      SIPWTHKVGNFTGLYSSTIPIFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580646_Pol_P-E      SIPWTHKVGNFTGLYSSTIPIFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580649_Pol_P-E      SIPWTHKVGNFTGLYSSTIPIFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580624_Pol_P-E      SIPWTHKVGNFTGLYSSTTPIFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363608_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161785_Pol_P-E      SIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB274977_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKPPSFPDIHLHQDIINKCEQFVGP
MN507844_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KF849724_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363592_Pol_P-E      SIPWTHKVGNFTGLYSSTLPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MN507847_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580631_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580632_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580652_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HM363594_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIIKKCEQFVGP
HM363568_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
EU239224_Pol_P-E      SIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB274976_Pol_P-E      SIPWTHKVGNFSGLYSTTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB274974_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPNIHLHQDIINKCEQFVGP
KU736897_Pol_P-E      SIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736898_Pol_P-E      SIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161834_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKPPSFPDIHLHQDIINKCEQFVGP
GQ161803_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161763_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736895_Pol_P-E      SIPWTHKVGNFTGLYSTTIPVFNPHWKTPSFPDIHLHQDIINKCEQFVGP
KU736896_Pol_P-E      SIPWTHKVGNFTGLYSTTIPVFNPHWKTPSFPDIHLHQDIINKCEQFVGP
GQ161794_Pol_P-E      SIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161786_Pol_P-E      SIPWTHKVGVHTGLYSSTIPVFNPNWKPPSFPDIHLHQDIIYKCEQFVGP
GQ161769_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPFFPDIHLHQDIINKCEQFVGP
GQ161779_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPFFPDIHLHQDIINKCEQFVGP
HM363595_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161771_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161765_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161759_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FJ349237_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINRCEQFVGP
AB274971_Pol_P-E      SIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161817_Pol_P-E      SIPWTHKVGNFTGLYSTTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161784_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161776_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161789_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161828_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB274982_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEEFVGP
GQ161793_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161777_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
LT623842_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161816_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161804_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161787_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161772_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFKPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161770_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
FJ349238_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161832_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIIIKCEQFVGP
GQ161827_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161755_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AB091255_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MN507843_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161835_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161833_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161836_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH580630_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
KU736899_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161820_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161829_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161819_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161801_Pol_P-E      SIPWTHKVGNFTGLYSSTIHVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161800_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161798_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161791_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161781_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161764_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
AM494700_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPYFPDIHLHQDIINKCEQFVGP
AM494694_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPYFPDIHLHQDIINKCEQFVGP
AM494696_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPYFPDIHLHQDIINKCEQFVGP
GQ161814_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161812_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161782_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161792_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161822_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161825_Pol_P-E      SIPWTHKVGNFTGLYSSSIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH464855_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
MH464856_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161756_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
GQ161795_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPSFPDIHLHQDIINKCEQFVGP
HQ700551_Pol_P-E      SIPWTHKVGNFTGLYSSTIPVFNPNWKTPTFPDIHLHQDIINKCEQFVGP
                      .** . *** .:*:**:    *:   :.  ** ***: *:: .* ::***

FN594765_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363611_Pol_P-E      LTVNEKRRLNLVMPARFFPNSTKYLPLDKGIKPYYPDNVVNHYFQTRHYL
AB106564_Pol_C-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYL
AB205190_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MF772358_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MF772356_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
GQ161760_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594760_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594758_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594759_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594751_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MF772357_Pol_P-E      LTVNEKRRLNLVMPARFFPSSTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363602_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
EU239220_Pol_P-E      LTVNEKRRLTLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594766_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
EU239219_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYL
EU239223_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYL
AY738147_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AY738146_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AY738144_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AY738145_Pol_C-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849717_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594762_Pol_P-E      LTVNEKRRLNLILPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYL
KF170741_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594748_Pol_P-E      LTVNEKRRLNLVMPAKFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYL
DQ060822_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849714_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594749_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849726_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB219533_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849715_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGKKPYYPDNVXNHYFQTRHYL
DQ060825_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
DQ060828_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLENGIKPYYPDNVVNHYFQTRHYL
DQ060829_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLENGIKPYYPDNVVNHYFQTRHYL
KM606738_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594750_Pol_P-E      LTVNERRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AY935700_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
DQ060824_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
DQ060827_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
JQ000008_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
DQ060823_Pol_P-E      LTVNEKRRLNLIMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849725_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MF772354_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849721_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849718_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
JQ000009_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB201290_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849713_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849719_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849722_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
DQ060826_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF922439_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KT192626_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF922438_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594763_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB915175_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB201289_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN594752_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363565_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363599_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MF772355_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB274984_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363566_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161758_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161766_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161774_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
LT623844_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363607_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363605_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
FN594761_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYL
AB915180_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363603_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
EU239222_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494689_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
AY739674_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AY739675_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
LT623851_Pol_P-E      LTVNEKRRLKLXXPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363572_Pol_P-E      LTVNEKRRLNLVMPARFFPISTNYLPLDKGIKPYYPDNVVNHYFQTRHYL
FN594756_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
LT623846_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363598_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB915178_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB274979_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDHVVNHYFQTRHYL
KU736913_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363584_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
HM363574_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN545822_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQVRHYL
AM494699_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363580_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363581_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363579_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580640_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580641_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161762_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB205129_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736911_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB205192_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB205191_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB205189_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
EU239221_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849723_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363606_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363582_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN545823_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN545821_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPDNVVNHYFQTRHYL
AM494691_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
X75657_Pol_P-E        LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580638_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
LT623850_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494705_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB201287_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQARHYL
MF772362_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736901_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736893_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363609_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYSPLEKGIKPYYPDNVVNHYFQTRHYL
HM363583_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
HM363578_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
DQ060830_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB274970_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736891_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYWPLEKGIKPYYPDNVVNHYFQTRHYL
KU736892_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYWPLEKGIKPYYPDNVVNHYFQTRHYL
KU736910_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736909_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736903_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363569_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161811_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494703_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494695_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580617_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580628_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580644_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494707_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736902_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736900_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
HM363570_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
EU239218_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF170742_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363575_Pol_P-E      LTVNEKRRLNLIMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363576_Pol_P-E      LTVNEKRRLNLIMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363585_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736904_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494690_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494693_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494701_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494702_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494704_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494708_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494713_Pol_P-E      LTVNEKRRLNLIMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494717_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736905_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MK720632_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MK720631_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MK321264_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736912_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736908_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736906_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736907_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH918655_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KX186584_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494715_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYXPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161780_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MN507842_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNLVNHYFQTRHYL
MN507841_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363610_Pol_P-E      LTVNEKRRLNLIMPARFYPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
HM363604_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580648_Pol_P-E      LTVNEKRRLKLVLPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161757_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPENVVNHYFQTRHYL
AB274980_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580626_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FJ349240_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYQDNVVNHYFQTRHYL
HM363591_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
HM363597_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
HM363601_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
HM363590_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
HM363588_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
HM363589_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
LT623847_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDQVVNHYFQTRHYL
KT749841_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HQ700550_Pol_P-E      LTVNQKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HQ700552_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363596_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161815_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161797_Pol_P-E      LTVNEKRRLNLIMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN545842_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FJ349226_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPDNVVNHYFQTRHYL
AM494692_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
AM494714_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
MH580650_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
AM494710_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
AM494697_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
AM494709_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
KM606739_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FJ349239_Pol_P-E      LTVNEKRRLNLVMPARFFPIVTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MN507846_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN545827_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FN545841_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MF772360_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB201288_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB091256_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161768_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736894_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161807_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161761_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKSYYPDNVVNHYFQTRHYL
GQ161830_Pol_P-E      LTVNEKRRLKLVMPARFFPISTKYLPLEKGIKSYYPDNVVNHYFQTRHYL
AM494706_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161778_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161810_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161790_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161805_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161799_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161818_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161821_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161783_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161824_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
LT623848_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
LT623843_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MN507848_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363571_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161808_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161773_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161802_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
LT623845_Pol_P-E      LTVHEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MN507840_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363567_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB194948_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPNNVVNHYFQTRHYL
LT623849_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB274978_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
EU239217_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB274975_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
EU239226_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB274969_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB274981_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363600_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYFPLEKGIKPYYPDNVVNHYFQTRHYL
HM363593_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
MN507845_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580645_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363587_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363586_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161775_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580621_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580622_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580625_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580637_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363573_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580634_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580635_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580636_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580647_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB194947_Pol_P-E      LTVNEKRRLNLVMPARFFPLSTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580629_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580646_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580649_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580624_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363608_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161785_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB274977_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MN507844_Pol_P-E      LTVNEKRRLNLVMPARFFPIATKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KF849724_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363592_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MN507847_Pol_P-E      LTVNEKRRLNLVMPARFFPIATKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580631_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580632_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580652_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363594_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363568_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
EU239224_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB274976_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB274974_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736897_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736898_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161834_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161803_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161763_Pol_P-E      LTVNEKRRLNLVMPARFFPICTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736895_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736896_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161794_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161786_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPGNVVNHYFQTRHYL
GQ161769_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161779_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
HM363595_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDEVVNHYFQTRHYL
GQ161771_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161765_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161759_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FJ349237_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPDNVVNHYFQTRHYL
AB274971_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161817_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161784_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
GQ161776_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
GQ161789_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
GQ161828_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
AB274982_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161793_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPPEKGIKPYYPDNVVNHYFQTRHYL
GQ161777_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
LT623842_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPXXKGIKPYYPDNVVNHYFQTRHYL
GQ161816_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161804_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPPEKGIKPYYPDNVVNHYFQTRHYL
GQ161787_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161772_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161770_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
FJ349238_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLDKGIKPYYPDNVVNHYFQTRHYL
GQ161832_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161827_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPPEKGIKPYYPDNVVNHYFQTRHYL
GQ161755_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AB091255_Pol_P-E      LTVNEKRRLNLVMPARFFPIATKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MN507843_Pol_P-E      LTVNEKRRLNLVMPARFFPIATKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161835_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161833_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161836_Pol_P-E      LTVNEKRRLNLVMPARFFPIATKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH580630_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
KU736899_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161820_Pol_P-E      LTVNEKRRLNLVMPARFFPIXTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161829_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161819_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161801_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161800_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161798_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161791_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161781_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161764_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494700_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494694_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
AM494696_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161814_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
GQ161812_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
GQ161782_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
GQ161792_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPENVVNHYFQTRHYL
GQ161822_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161825_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH464855_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
MH464856_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
GQ161756_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKSYYPDNVVNHYFQTRHYL
GQ161795_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKSYYPDNVVNHYFQTRHYL
HQ700551_Pol_P-E      LTVNEKRRLNLVMPARFFPISTKYLPLEKGIKPYYPDNVVNHYFQTRHYL
                      ***::.***.*  **.*:*  *:* *  :* *.**   : *****.****

FN594765_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSXM-GEESFH
HM363611_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDSPSRM-GEESVY
AB106564_Pol_C-E      HTLWKAGILYKRETTRYASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB205190_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDCPSRM-GEESFH
MF772358_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MF772356_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161760_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPTRM-GKESFH
FN594760_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN594758_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFXDGPSPM-GEESFH
FN594759_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSLM-GEESFH
FN594751_Pol_P-E      HTLWEAGILYKRETTRSASFYGSPYSWEQELHHGAFLDGPSRM-GEESFH
MF772357_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGTFLDGPSRM-GEESFH
HM363602_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
EU239220_Pol_P-E      HTLWKAGILYKRESSRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN594766_Pol_P-E      HTLWKAGILYKRETTRSASFGGSPYSWEQELHHGAFLDGPSRM-GEESFH
EU239219_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
EU239223_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AY738147_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
AY738146_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWERELHHGAFLDGPSRM-GEESFH
AY738144_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
AY738145_Pol_C-E      HTLWKAGILYKRETTRSASFCGSPYSREHELHHGAFLDGPSRM-GEESFH
KF849717_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
FN594762_Pol_P-E      HTLWEAGILYKRETTRSASFWGSPYSWEQELHHGSFLDGPSRM-GEESFH
KF170741_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN594748_Pol_P-E      XTLWKAGILYKRETTRSASFWGSPYSWEQELHHGAFLDGPSRM-GEESFH
DQ060822_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
KF849714_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
FN594749_Pol_P-E      HTLWKAGILYKRETTRSASFWGSPYSWEQELHHGAFLDGPSRM-GEESFH
KF849726_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
AB219533_Pol_P-E      HTLWKAGILYKRETTRSASFYGSPYSWEQELHHGAFLDGPSRM-GEESFH
KF849715_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
DQ060825_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
DQ060828_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEKSFH
DQ060829_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEKSFH
KM606738_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
FN594750_Pol_P-E      HTLWKAGILYKRETTRSASFWGSPYSWEQELXHGAFLDRPSRM-GEESFH
AY935700_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
DQ060824_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
DQ060827_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEHELHHGAFLDGPSRM-GEKSFH
JQ000008_Pol_P-E      HTLWKAGILYKRETTSSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
DQ060823_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
KF849725_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
MF772354_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
KF849721_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
KF849718_Pol_P-E      HTLWKAGXLYKRETTRSASFCGSPYSWEXELHHGAFLXGPSRM-GEESFH
JQ000009_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
AB201290_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
KF849713_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
KF849719_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
KF849722_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
DQ060826_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEKSFH
KF922439_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KT192626_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KF922438_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN594763_Pol_P-E      HTLWEAGILYKRETTRSASFYGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB915175_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB201289_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN594752_Pol_P-E      HTLWKAGILYKRETTRSASFWGSPYSWEQGLHHGAFLDGPSRM-GEESFH
HM363565_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYPWEQELHHGAFLDGPSRM-GEESIH
HM363599_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MF772355_Pol_P-E      HTLWKAGILYKRETSRSASFCGSPYSWEHEIHHGAFLDGPSRM-GEESFH
AB274984_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363566_Pol_P-E      HTLWKAGILYKRETARSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161758_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161766_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161774_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
LT623844_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQALHHGAFLDGPSRM-GEESFH
HM363607_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363605_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQDLHHGAFLDGPSRM-GEESFH
FN594761_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB915180_Pol_P-E      HTLWKAGILYKRETTRSASFFGSLYSWEQELHHGAFLDGPSRM-GEESVH
HM363603_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
EU239222_Pol_P-E      HTLWKAGVLYKRETTRSASFYGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494689_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEPELHHGAFLDGPSRM-GEESFH
AY739674_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AY739675_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
LT623851_Pol_P-E      HTLWEAGILYKRETTRSASFXGSPYSWEQELHHGAFLDGPSRM-GEESXH
HM363572_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN594756_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGTFLDGPSRM-GEESFH
LT623846_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363598_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDCPSRM-GEESFH
AB915178_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESIH
AB274979_Pol_P-E      HTLWKAGILYKRETTHSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSVH
KU736913_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGPFLDGPSRM-GEESFH
HM363584_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363574_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN545822_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQDLHHGAFLDGPSRM-GEESFH
AM494699_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363580_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363581_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363579_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580640_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFY
MH580641_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFY
GQ161762_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEELFH
AB205129_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736911_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFVDGPSRM-GEESFH
AB205192_Pol_P-E      HTLWKAGILYKRGTTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB205191_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB205189_Pol_P-E      HTLWKAGILYKRETTSSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
EU239221_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KF849723_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363606_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSFH
HM363582_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN545823_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN545821_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494691_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESIH
X75657_Pol_P-E        HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEEYFH
MH580638_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
LT623850_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494705_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB201287_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MF772362_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736901_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDSPSRM-GEESFH
KU736893_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363609_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363583_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363578_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
DQ060830_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB274970_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736891_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736892_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736910_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFVDGPSRM-GEESFH
KU736909_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736903_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363569_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161811_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494703_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494695_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580617_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580628_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580644_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494707_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736902_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736900_Pol_P-E      HTLWKAGILYKRETTHSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363570_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
EU239218_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KF170742_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363575_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363576_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363585_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736904_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494690_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494693_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494701_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494702_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494704_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494708_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494713_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494717_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736905_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MK720632_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MK720631_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MK321264_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736912_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736908_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736906_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736907_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH918655_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQDLHHGAFLDGPSRM-GEESFH
KX186584_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494715_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161780_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MN507842_Pol_P-E      HTLWKAGILYKRETTRYASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MN507841_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRM-GEESFH
HM363610_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESVH
HM363604_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580648_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGTFLDGSSRM-GEESFH
GQ161757_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB274980_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580626_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FJ349240_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363591_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363597_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363601_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363590_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363588_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363589_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
LT623847_Pol_P-E      HTLWKAGILYRRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSFH
KT749841_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HQ700550_Pol_P-E      HTLWKEGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HQ700552_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363596_Pol_P-E      HTLWKAGVLYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161815_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFR
GQ161797_Pol_P-E      HTLWKAGILYKRETTHSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN545842_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGTFLDGPSRM-GEESFH
FJ349226_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494692_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494714_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580650_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494710_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQALHHGAFLDGPSRM-GEESFH
AM494697_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494709_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KM606739_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FJ349239_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MN507846_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN545827_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FN545841_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MF772360_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB201288_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQDLHHGAFLDGPSRM-GEESFH
AB091256_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161768_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736894_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161807_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161761_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161830_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494706_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161778_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161810_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161790_Pol_P-E      HTLWKAGILYKRETTRSASFCGLPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161805_Pol_P-E      HTLWKAGILYKRETTRSASFCGLPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161799_Pol_P-E      HTLWKAGILYKRETTRSASFCGLPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161818_Pol_P-E      HTLWKAGILYKRETTRSASFCGLPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161821_Pol_P-E      HTLWKAGILYKRETTRSASFCGLPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161783_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161824_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
LT623848_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
LT623843_Pol_P-E      HTLWKXGILYKRETTRSASFCGSPYXWEQELHHGAFLDGPSRM-GEESFH
MN507848_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363571_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161808_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161773_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161802_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
LT623845_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MN507840_Pol_P-E      HTLWKAGILYKRETARSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363567_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB194948_Pol_P-E      HTLWKAGILYKRETSRSASFYGSPYSWEQELHHGAFLDGPSRM-GEESFH
LT623849_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB274978_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
EU239217_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB274975_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
EU239226_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB274969_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB274981_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRV-GEESFH
HM363600_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363593_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MN507845_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDSPSRM-GEESFH
MH580645_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363587_Pol_P-E      HTLWKAGILYKRETTRSASFFGTPYSWEQELHHGAFLDGPSRM-GEESFH
HM363586_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161775_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580621_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580622_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580625_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580637_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363573_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580634_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580635_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580636_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580647_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGTFLDGPSRM-GEESFH
AB194947_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580629_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580646_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580649_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580624_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363608_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161785_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSVH
AB274977_Pol_P-E      HTLWKAGILYKRETSRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESIH
MN507844_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KF849724_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363592_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
MN507847_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580631_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEELFH
MH580632_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEELFH
MH580652_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEELFH
HM363594_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQDLHHGAFLDGPSRM-GEESFH
HM363568_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
EU239224_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESVH
AB274976_Pol_P-E      HTLWKAGILYKRETSRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSFH
AB274974_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
KU736897_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSFH
KU736898_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSFH
GQ161834_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSGM-GEESFH
GQ161803_Pol_P-E      HTLWEAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161763_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFVDGPSRM-GEESFH
KU736895_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSFH
KU736896_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSFH
GQ161794_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSFH
GQ161786_Pol_P-E      HTLWQAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161769_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161779_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HM363595_Pol_P-E      HTLWKAGILYKRETTRSASFFGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161771_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161765_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161759_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQDLHHGAFLDGPSRM-GEESFH
FJ349237_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB274971_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSFH
GQ161817_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEKSFH
GQ161784_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161776_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161789_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161828_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB274982_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161793_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161777_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFVDGPSRM-GEESFH
LT623842_Pol_P-E      HTLWZAGILYKRETTRSASFCGTPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161816_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161804_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161787_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161772_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161770_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
FJ349238_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161832_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161827_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161755_Pol_P-E      HTLWKAGILYKRETTCSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AB091255_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MN507843_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161835_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161833_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161836_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH580630_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQDLHHGAFLDGPSRM-GEESFH
KU736899_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161820_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161829_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161819_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161801_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161800_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161798_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161791_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161781_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161764_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494700_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494694_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
AM494696_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161814_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161812_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161782_Pol_P-E      HTLWKAGILYKRXXTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161792_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161822_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161825_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
MH464855_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFLDGPSRMXGEESFH
MH464856_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEHELHHGAFVDGPSRMXGEESFH
GQ161756_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
GQ161795_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
HQ700551_Pol_P-E      HTLWKAGILYKRETTRSASFCGSPYSWEQELHHGAFLDGPSRM-GEESFH
                       ***  * **.*  :  *** *  * .*  : **.*   .: : *::   

FN594765_Pol_P-E      HQSFGIFSRPPVGSSIQSKHQXSRLGSQSQQRPLDRSQQGRSGIIRAGVH
HM363611_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AB106564_Pol_C-E      HQASGMCSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSGSIWAGVH
AB205190_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQNSRLGPQSQQRPLDRSQQGRSGSIRAGVL
MF772358_Pol_P-E      HQSFGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWAH
MF772356_Pol_P-E      YQSFGSFSRPPVGSSIQSKHQQSRLGSQSQQRPLDRSQQGRSGSIRAWVH
GQ161760_Pol_P-E      HQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDGSQQGRSGSIRAGVH
FN594760_Pol_P-E      HQSFGIFSRPPVGSSIQSKHQQSRLGRQSQQRPLDRSQQGRSGSIRAGVH
FN594758_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
FN594759_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
FN594751_Pol_P-E      HQSFGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MF772357_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363602_Pol_P-E      YQSSGVFTRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
EU239220_Pol_P-E      RKSSGIFSRPPVGSSIQSKHQKSRLGQQSQQRPLDRSQQGRSGSIRAGVH
FN594766_Pol_P-E      HQSFGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSGIIRAGVH
EU239219_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSGSIWAGVH
EU239223_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSGSIWAGVH
AY738147_Pol_P-E      HQSSGIFSRPPVGSSIQSEHQKSRLGPQSQQRSLDGSQQGRSGSIRAWVH
AY738146_Pol_P-E      HQSSGIFSRPPVGSSIQSEHQKSRLGPQSQQRSLDSSQQGRSGSIRAWVH
AY738144_Pol_P-E      HQSSGIFSRPPVGSSIQSEHQKSRLGPQSQQRSLDSSQQGRSGSIRAWVH
AY738145_Pol_C-E      HQSSGIFSRPPVGSSIQSEHQKSRLGPQSQQRSLDSSQQGRSGSIRAWVH
KF849717_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
FN594762_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLEKSQQGRSGSILAGAH
KF170741_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
FN594748_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSGSIWAGXH
DQ060822_Pol_P-E      HQSSGIFSRPPVGSSVQSKYQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
KF849714_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAWVH
FN594749_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
KF849726_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
AB219533_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGQQSQQRPLDRSQQGRSGSIWAGVH
KF849715_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAXVH
DQ060825_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSGSIWAWVH
DQ060828_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
DQ060829_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KM606738_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSFRAWVH
FN594750_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
AY935700_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
DQ060824_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDKSQQGRSGSIRAWVH
DQ060827_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
JQ000008_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
DQ060823_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
KF849725_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
MF772354_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
KF849721_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KF849718_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
JQ000009_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
AB201290_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLERSQQGRSGSIRAWVH
KF849713_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KF849719_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KF849722_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
DQ060826_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KF922439_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
KT192626_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
KF922438_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
FN594763_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
AB915175_Pol_P-E      LQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
AB201289_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
FN594752_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGQQSQQRPLDRSQRGRSGSFWAGVH
HM363565_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363599_Pol_P-E      HQSSGIFSRPPVGSSIQSKYQKSRLGPQSQQRPLDRSQQGRSGSIRAGIH
MF772355_Pol_P-E      HQSSGIFSRPPVGSSIQSQHQKSRLGPQSQQRSLDRSQQGRSGSIWAGVH
AB274984_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363566_Pol_P-E      HQSSGIFSRPPVGSSIHSEHQKSRLGPQSQQRPLDRSQPGRSGSIRAGVH
GQ161758_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161766_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161774_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
LT623844_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWXH
HM363607_Pol_P-E      HQSSGIFSRPPVGSSIPSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVY
HM363605_Pol_P-E      HQSSGIFSRSPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSGSIRAGVH
FN594761_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSGSIWAGAH
AB915180_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWAH
HM363603_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
EU239222_Pol_P-E      LQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494689_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AY739674_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AY739675_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
LT623851_Pol_P-E      HQSSGIFSRPPVGSSIPSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363572_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLVRSQQGRSGSIRAGVH
FN594756_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQQSRLGPQSQQRPLDRSQQGRSGSIRAGVH
LT623846_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLVRSQQGRSGSIRAGVH
HM363598_Pol_P-E      HQSSGIFSRPSVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AB915178_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLXRSQQGRSGSIRAWVH
AB274979_Pol_P-E      HQSSGIFSRPPVGSRIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
KU736913_Pol_P-E      HQSSGIFSRPXVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
HM363584_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363574_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
FN545822_Pol_P-E      HQSSGIFXRPPVGSSIQGKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494699_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
HM363580_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRARVH
HM363581_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRARVH
HM363579_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRARVH
MH580640_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580641_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161762_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AB205129_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSRQRPLDRSQQGRSGSIRAGVH
KU736911_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
AB205192_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AB205191_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRARVH
AB205189_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRARVH
EU239221_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRARVH
KF849723_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAWGH
HM363606_Pol_P-E      LQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363582_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
FN545823_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRARVH
FN545821_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSGSIRAGVH
AM494691_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
X75657_Pol_P-E        HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
MH580638_Pol_P-E      HQSSGIFSRPPVGSSIPSKHPKSRLGPQSQQRPLDRSQQGRSGSIRAGVY
LT623850_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494705_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSLRAGVH
AB201287_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MF772362_Pol_P-E      HQSFGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736901_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
KU736893_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
HM363609_Pol_P-E      LQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGNIRAGVH
HM363583_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363578_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
DQ060830_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AB274970_Pol_P-E      HQSSGIFSRPPVGSSIPSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
KU736891_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736892_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736910_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736909_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736903_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
HM363569_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161811_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494703_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLARSQQGRSGSIRAWVH
AM494695_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
MH580617_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580628_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580644_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494707_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736902_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSGSIRAWVH
KU736900_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
HM363570_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
EU239218_Pol_P-E      LQSSGILSRPPVGSSIQSKHQKSRLGPQSQQRPLDRRQQGRSGSIRAGVH
KF170742_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
HM363575_Pol_P-E      HQSSGIFSRPPVGSSIPSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVY
HM363576_Pol_P-E      HQSSGIFSRPPVGSSIPSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVY
HM363585_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
KU736904_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
AM494690_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
AM494693_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
AM494701_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
AM494702_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
AM494704_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
AM494708_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
AM494713_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
AM494717_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736905_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
MK720632_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
MK720631_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
MK321264_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736912_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736908_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736906_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
KU736907_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAWVH
MH918655_Pol_P-E      LQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVY
KX186584_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494715_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161780_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MN507842_Pol_P-E      LQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSGSIRAGVH
MN507841_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQQSRLGPQSQQRPLDGSQQGRSGSIRAGVH
HM363610_Pol_P-E      HQSSGIFSRPPVGSSIQSKHPKSRLGSQSHQRPLDRSQQGRSGSIRAGVH
HM363604_Pol_P-E      HPSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580648_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDTGQQGRSGSIRAGVH
GQ161757_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AB274980_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580626_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
FJ349240_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLVRSQQGRSGSIRAGVH
HM363591_Pol_P-E      HKSSGIFSRSSVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSGSIRAGVH
HM363597_Pol_P-E      HKSSGIFSRSSVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSGSIRAGVH
HM363601_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSGSIRAGVH
HM363590_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSGSIRAGVH
HM363588_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSGSIRAGVH
HM363589_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSHQRPLDRSQQGRSGSIRAGVH
LT623847_Pol_P-E      HQSSGILSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
KT749841_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQQSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HQ700550_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HQ700552_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363596_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161815_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161797_Pol_P-E      HQSSGSFSRPPVGSSIQSKHQKSRLGPQSQQRSLDRSQQGRSGSIRAGVH
FN545842_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
FJ349226_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494692_Pol_P-E      HQSSGISSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494714_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSGSIRAGVH
MH580650_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494710_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494697_Pol_P-E      HQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AM494709_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
KM606739_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
FJ349239_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSGSIRAGVH
MN507846_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
FN545827_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGXQSQQRPLDRSQQGRSGSIRAGVH
FN545841_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MF772360_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AB201288_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSGSIRAGVH
AB091256_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161768_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSGSIRAGAH
KU736894_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSGSIRAGVH
GQ161807_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSGSIRPGVH
GQ161761_Pol_P-E      HQSSGIFSRPPVGSSIQSKYQKSRLGPQSQQRPLDGSQQGRSGSIRAGVH
GQ161830_Pol_P-E      HQSSGIFSRPPVGSSIQSKYQKSRLGPQSQQRPLDGSQQGRSGSIRTGVH
AM494706_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161778_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161810_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161790_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161805_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161799_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161818_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161821_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161783_Pol_P-E      HQSSGIFSRPPVGSRIPSKHQKSRLGSQSQQRPLDRSQQGRSGSIRAGVH
GQ161824_Pol_P-E      HQSSGIFSRPPVGSRIPSKHQKSRLGSQSQQRPLDRSQQGRSGSIRAGVH
LT623848_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
LT623843_Pol_P-E      XQSAGXFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIWAGVH
MN507848_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363571_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161808_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
GQ161773_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSGSIRAGVH
GQ161802_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGSQSQQRPLDRSQQGRSGSIRAGVH
LT623845_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MN507840_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSGSIRAGVH
HM363567_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AB194948_Pol_P-E      HQSSGIFSRPPVGSSIQCKHQKSRLGPQSQQRPLDGSQPGRSGSIRAGVH
LT623849_Pol_P-E      HQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSGCIRAGVH
AB274978_Pol_P-E      HQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSGCIRAGVH
EU239217_Pol_P-E      HQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSGCIRAGVH
AB274975_Pol_P-E      HQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSGCIRAGVH
EU239226_Pol_P-E      HQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSGCIRAGVH
AB274969_Pol_P-E      HQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRSQQGRSGCIRAGVH
AB274981_Pol_P-E      HQSSGIFSRPPVGSSVQSKHQKSRLGPQSQQRPLDRTQRGRSECIRAGVH
HM363600_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363593_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MN507845_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRSLDRSQQGRSGSIRAGVH
MH580645_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKPRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363587_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGQQSQQRPLDRSQQGRSGSIRAGVH
HM363586_Pol_P-E      YQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDKSQQGRSGSIRAGVH
GQ161775_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDGSQQGRSGSIRAGVH
MH580621_Pol_P-E      HQSSGIFSRPPVGSSLQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580622_Pol_P-E      HQSSGIFSRPPVGSSLQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580625_Pol_P-E      HQSSGIFSRPPVGSSLQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580637_Pol_P-E      HQSSGIFSRPPVGSSLQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
HM363573_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580634_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580635_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580636_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
MH580647_Pol_P-E      HQSSGIFSRPPVGSSIQSKHQKSRLGPQSQQRPLDRSQQGRSGSIRAGVH
AB194947_Pol_P-E      HRSSGIFSRPPVGSSIQSKHQKS