HBVdb

Dataset for protein MHBs of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
       *.:             .**    .      :    *.     *  .  :   .* :* *   :. **  : * 
MQWNSTTFHQALQDPRVRGLYfPAGGSSSGTVNPVPTTASLISSIFSRIGDPAPNMEsITSGFLGPLLVLQAGFFLLTKI
----yka  kt  n k k  -l          s     v            l    dg                      
i                    -                                   n                      
v                                                                               

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* **:. *  ***  ::*  .   * . .     *   * *    .   *  * :    :* * ***    *    *:* 
LTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPtSnHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
              s   es   r   l   i s  l     tw                               h i  
                   t   p                                                        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *.  * .. . :*  *: ** ..  *  *  *. :.   * ..  **** *  *:** **  *   :  **  ..**.*
VCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAG
    l                p              er                  g                   v 
                                                          v                     
                                                                                

       250       260       270       280 
....:....|....:....|....:....|....:....|.
:.  . * . **** *.  *      *  *  *   **.: 
LSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
   i             rr   t     l       a  
                  n                      
                  g                      
© 1998-2022Legal notice