HBVdb

Dataset for protein MHBs of genotype E

[Download (right click)] [Sequences] [Repertoires]

509 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KR139749_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB091255_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB091256_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRTG
AB106564_MHBs_C-E      MQRNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB194947_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB194948_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYRPAGGSSSGTVNPVPTTASLISSIFSRIG
AB201287_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB201288_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB201289_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB201290_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB205129_MHBs_P-E      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVSPVPTTASLISSIFSRIG
AB205189_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
AB205190_MHBs_P-E      MQWNSTTFHQALQDPRVRGLFLPAGGSSSGTVNPVPTTASLISSIFSRIG
AB205191_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB205192_MHBs_P-E      MQWNSTAFHQALQDPKVRGLYFPAGGSSSGTVSPVPTTASLISSIFSRIG
AB219529_MHBs_P-E      MQWNSTTFHQALQDPRVT----PAGGSSSGTVNPVPTTASLISSIFSRIG
AB219533_MHBs_P-E      MQWNSTTFHQALQDPRVKNLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB274969_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB274970_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVSPVPTTASLISSIFSRIG
AB274973_MHBs_P-E      MQWNSTTFHQVQQDHRVRGL--PAGGSSSGTVNPVPTTASLISSIFSRIG
AB274974_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGFSSGTVNPVPTTASLISSIFSRIG
AB274975_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSISSRIG
AB274976_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB274977_MHBs_P-E      MQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
AB274978_MHBs_P-E      MQWNSTTFHQALQDPRVTGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB274979_MHBs_P-E      IQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
AB274980_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB274982_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB274984_MHBs_P-E      MQWNSTTFHQALQDPRVRGLQFPAGGSSSGTVSPVPTTVSRISSIFSRIG
AB274985_MHBs_P-E      IQWNSTTFHQALQDPRVRGL--PAGGSSSGTVNPVPTTASLISSIFSRIG
AB915175_MHBs_P-E      MQWNSTTFHQALQDPRVRNLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB915176_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB915177_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTASLISSIFSRIG
AB915178_MHBs_P-E      MQWNSKTFHQALQDXRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494690_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494691_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494692_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494694_MHBs_P-E      IQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRXG
AM494695_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494696_MHBs_P-E      IQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494697_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494699_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494700_MHBs_P-E      IQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494703_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494704_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494705_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494706_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494709_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494710_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
AM494711_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
AM494712_MHBs_P-E      VQWNSKTFHQALQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
AM494714_MHBs_P-E      VQWNSKTFHQALQDPRVRGLYPPAGGSSSGTVNPVPTTASLISSIFSRIG
AY738144_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AY738145_MHBs_C-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AY738146_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AY738147_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AY739675_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AY935700_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
DQ060822_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
DQ060824_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
EU159673_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
EU239217_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
EU239218_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
EU239219_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSETVNPVPTTASLISSIFSRIG
EU239220_MHBs_P-E      VQWNSTTFHQNLQDPRVRGLYFPAGGSSSGTVNPVPTTASLTSSIFSRIG
EU239221_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
EU239222_MHBs_P-E      MQWNSTTFHQALQNPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
EU239223_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
EU239224_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
EU239226_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISPIFSRIG
FJ349226_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FJ349239_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN545821_MHBs_P-E      MQWNSTTFHQALQDPKVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN545822_MHBs_P-E      MKWNSTTFHQALQDPRIKGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
FN545823_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
FN545841_MHBs_P-E      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN545842_MHBs_P-E      IQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594748_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594749_MHBs_P-E      MKWNSTTFHQALQDPRVRGLYSPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594750_MHBs_P-E      MQWNSKTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594751_MHBs_P-E      IQWNSKTFHQALQDPRVRGLHXSAGGSSSGTVNPVPTTASLISSIFSRIG
FN594752_MHBs_P-E      MQWNSTTFHQALQDPKVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594756_MHBs_P-E      MQWNSTTFHQALQDPRVTGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594758_MHBs_P-E      MQWNSTTFHQALQDPRVRGLXFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594759_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594760_MHBs_P-E      MQWNSKTFHQALQDPRVRGLXFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594761_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594762_MHBs_P-E      MQWNSTTFHQALLDPTVGGLSSPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594763_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594765_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FN594766_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVRTTASLISSIFSRIG
GQ161755_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSFGTVNPVPTTASLISSIFSRIG
GQ161757_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161758_MHBs_P-E      MQWNYTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161759_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161760_MHBs_P-E      MQWNSTTFHQALQDPRVRGLNFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161762_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161763_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161764_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161768_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161770_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161773_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161775_MHBs_P-E      MQWNSTTFHQPLQNPRVRGQDFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161776_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161778_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161780_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161782_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVSPVPTTASLISSIFSRIG
GQ161783_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161785_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYPPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161786_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161796_MHBs_P-E      MQWNYTTFHQALQDPKVR----PAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161797_MHBs_P-E      MQWNSTTFHQALQDPKIRGPYLPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161798_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161801_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161803_MHBs_P-E      VQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSTFSRIG
GQ161804_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161807_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161811_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161816_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161817_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPVGGSSSGTVNPVPTTASLISSIFSRIG
GQ161820_MHBs_P-E      MQWNSTTFHQXLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161822_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161825_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161831_MHBs_P-E      MQWNSTTFHQALQDPRVR----PAGGSSSGTVNPVPTTASLISSISSRIG
GQ161833_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161834_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161836_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYLPAGGSSSGTVNPVPTTASLISSIFSTIG
HM363565_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363566_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363567_MHBs_P-E      MQWNSTTFHQALQDPRVRGLDFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363568_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363572_MHBs_P-E      MQWNSTTFHQALQDPRVRCLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363573_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363575_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363576_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363577_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363578_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363579_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363580_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363583_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363584_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363585_MHBs_P-E      MQWNSTTFHQALQDPRVRGLSFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363586_MHBs_P-E      MQWNSTKFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363587_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSKIG
HM363588_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363589_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363590_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363592_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363593_MHBs_P-E      MQWNSKTFHQALQDPRVRGLYLPAGGSHSGTVNPVPTTASLISSIFSRIG
HM363594_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363595_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363596_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363597_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363598_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363599_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363600_MHBs_P-E      MQWNSTTFHQTLQNPRVTGLYPPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363601_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363602_MHBs_P-E      MQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVNPVPTTASRISSIFSRIG
HM363603_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363606_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363607_MHBs_P-E      IQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363608_MHBs_P-E      MQWNSRTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTVSLISSIFSRIG
HM363609_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363610_MHBs_P-E      MQWNSTTFHKALQDPRVRGLYLPAGGSSSGKVNPVPTTASLISSIFSRIG
HM363611_MHBs_P-E      MQWNSKTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
HQ700550_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JN604166_MHBs_P-E      MXWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JN604168_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTXSLISSIFSRIG
JN604235_MHBs_P-E      MQWNSTTFHQALQXPTVRGLYFPAGGCSSGTVNPVPTTASLISSIFSRIG
JQ000008_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JQ000009_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JQ972812_MHBs_P-E      ----STTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JQ972822_MHBs_P-E      ----STTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIXSRIG
KF170741_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF170742_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF170750_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
KF170751_MHBs_P-E      MQWNSKTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
KF170782_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
KF170783_MHBs_P-E      MQWNSTTFHQALQDPKVSALYLPAGGSSSGTVNPVPTTASLISSIFSRIG
KF170784_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSFGTVNPVPTTASLISSIFSRIG
KF170785_MHBs_P-E      MQWNSTTFHKTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF170786_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF170787_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLTSSIFSTIG
KF170790_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYFPAGGSSSETVNPVPTTASLISSIFSRIG
KF849713_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF849715_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRTG
KF849716_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF849717_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF849718_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
KF849720_MHBs_P-E      MQXNSTTFHQALQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
KF849721_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF849723_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
KF849726_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
KF849727_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF849728_MHBs_P-E      MQWNSTTFHQALQDPKAK----PAGGSSSGTVNPVPTTASLISSIFSRIG
KM108610_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSTIG
KM108622_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
KM108623_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KM108624_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KM108625_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
KM108626_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736892_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736897_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736899_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSFGTVNPVPTTASLISSIFSRIG
KU736911_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736912_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736913_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYIPAGGSSSGTVNPVPTTASLISSIFSRIG
KY498770_MHBs_P-E      MXWNSTTFHQALQDPRXXGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
LT623843_MHBs_P-E      MQWNSTTFRQALQDPRVRXLXXXAGGSSSGTVNPVPTTASLISSIFSRIG
LT623844_MHBs_P-E      MQWNSTTFHKALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
LT623845_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYYPAGGSSSGTVNPVPTTASLISSIFSRIG
LT623847_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
LT623848_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
LT623849_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
LT623850_MHBs_P-E      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
LT623851_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MF772355_MHBs_P-E      MQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVXPVPTTASLISSIFSRIG
MF772357_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MF772360_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
MH165306_MHBs_P-E      ----STTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
MH464856_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580614_MHBs_P-E      MQWNSTAFHQALQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
MH580629_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTSASLISSIFSRIG
MH580630_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580634_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580638_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580644_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTANPVPTTVSLISSIFSRIG
MH580645_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580648_MHBs_P-E      VQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580650_MHBs_P-E      MRWNSPTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MN507840_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MN507841_MHBs_P-E      MQWNSTTFHQALQDPRVKNLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MN507844_MHBs_P-E      MQWHYKTFHQDLQNPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MN507845_MHBs_P-E      MQWNSKTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLTSSTFSRIG
MN507846_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
MN507847_MHBs_P-E      MQWNSTTFQQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLVSSIFSRIG
MN967527_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MN967528_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT426115_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427110_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427112_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427113_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427118_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427120_MHBs_P-E      MQWNSATFHQALQDPRVRGLYFPAGGSSSGTVHPVPTTASLISSIFSRIG
MT427123_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427124_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTAYLISSIFSRIG
MT427133_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427134_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427135_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427139_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427141_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNLVPTTASLISSIFSRIG
MT427142_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427148_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427152_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427155_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427156_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427162_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427164_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427169_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFLRIG
MT427175_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427186_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427189_MHBs_P-E      MQWNSTTFHQALQDPRGRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW082636_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
MW455161_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW455162_MHBs_P-E      MQWHYKTFHQDLQNPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW455163_MHBs_P-E      MQWHSTTFHKALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW455164_MHBs_P-E      MQWHSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW455165_MHBs_P-E      MQWNSTTFHKALQDPRVRGLYFPAGGSSSGTVNPVPTTASLVSSIFSRIG
MW679682_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFSAGGSSSGTVNPGPTTALLISSIFSRVG
MW679683_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926549_MHBs_P-E      VQWNSTTFHQALQDPRVRGPSLPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926550_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926551_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
MW926554_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926555_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926556_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYHPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926558_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926559_MHBs_P-E      MQWNYPTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
MW926560_MHBs_P-E      MQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926561_MHBs_P-E      MQWNSKTFHQALQDPQVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926562_MHBs_P-E      VQWNSTTFHQALQDPRVKGLYLPAGGSSSGTVNPVPTTASLTSSIFSRIG
MW926563_MHBs_P-E      MQWNSTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926564_MHBs_P-E      MQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MW926566_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW999660_MHBs_P-E      MQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW999661_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MZ962189_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MZ962190_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MZ962191_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MZ962192_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYVPAGGSSSGTVNPVPTTASLISSIFSRIG
MZ962193_MHBs_P-E      MQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MZ962194_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MZ962195_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGPNSGTRNPVPTTALLLSSIFPRIG
MZ962196_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MZ962197_MHBs_P-E      MQWNYTAFHQALQDPRVRHLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
MZ962198_MHBs_P-E      IQWNSTTFHQALQDPRVSGLYLPAGGSSSGTVNPVPATASLISSIFSRIG
MZ962199_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
OM256457_MHBs_P-E      MQWNSTXFHQXLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
ON093163_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
ON402784_MHBs_P-E      MQWNSRTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
ON402785_MHBs_P-E      MQWNSTTFHQALQDPRVKNLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
ON854611_MHBs_P-E      MQWISTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
HM363582_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926552_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB274981_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
DQ060823_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
DQ060826_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
DQ060827_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
DQ060828_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
DQ060829_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF849719_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF849722_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF922438_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF922439_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KT192626_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MF772354_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH918655_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926548_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW999678_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161779_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HQ700552_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MN507848_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427111_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427117_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427119_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427121_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427125_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427126_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427127_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427129_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427131_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427132_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427137_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427138_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427140_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427143_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427145_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427146_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427147_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427149_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427150_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427151_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427153_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427154_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427157_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427158_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427159_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427160_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427163_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427165_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427166_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427167_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427168_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427170_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427171_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427172_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427173_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427174_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427176_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427177_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427178_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427179_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427180_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427181_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427182_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427183_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427184_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427185_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427187_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427188_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427190_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427191_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427192_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427193_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427195_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427196_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427197_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427198_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427199_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427200_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427201_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AB274971_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AY739674_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
DQ060830_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FJ349237_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
FJ349238_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161761_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161765_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161769_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161771_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161772_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161781_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161787_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161790_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161791_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161793_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161794_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161799_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161800_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161805_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161815_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161818_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161819_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161821_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161827_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161829_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161830_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161832_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363574_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363591_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363604_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736895_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736896_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KX186584_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
LT623846_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MF772362_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580621_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580622_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580624_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580625_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580631_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580632_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580637_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580646_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580647_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580649_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580652_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MN507842_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MN507843_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494707_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494693_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494701_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494702_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494708_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494713_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494715_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
AM494717_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363569_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363570_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363571_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF170788_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF170789_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736891_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736893_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736900_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736901_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736902_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736903_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736904_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736905_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736906_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736907_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736908_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736910_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580640_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580641_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MK321264_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MK720631_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MK720632_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MN967529_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
X75657_MHBs_P-E        MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580617_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
MH580628_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
DQ060825_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF849714_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KF849724_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH464855_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW926557_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161835_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSFGTVNPVPTTASLISSIFSRIG
GQ161766_MHBs_P-E      MQWNYTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161774_MHBs_P-E      MQWNYTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736894_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161777_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161802_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161784_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161789_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161828_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161810_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MW999659_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161792_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVSPVPTTASLISSIFSRIG
GQ161812_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVSPVPTTASLISSIFSRIG
GQ161814_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVSPVPTTASLISSIFSRIG
GQ161824_MHBs_P-E      MQWNSTTFHQALQDPRVKGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161808_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363605_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTVNPVPTTASLISSIFSRIG
HM363581_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
ON528578_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JQ972813_MHBs_P-E      ----STTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JQ972814_MHBs_P-E      ----STTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JQ972821_MHBs_P-E      ----STTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JQ972823_MHBs_P-E      ----STTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JQ972824_MHBs_P-E      ----STTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JQ972828_MHBs_P-E      ----STTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
JQ972829_MHBs_P-E      ----STTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736909_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736898_MHBs_P-E      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580615_MHBs_P-E      MQWNSTAFHQALQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
MH580616_MHBs_P-E      MQWNSTAFHQALQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
MH580618_MHBs_P-E      MQWNSTAFHQALQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
MH580619_MHBs_P-E      MQWNSTAFHQALQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
MH580620_MHBs_P-E      MQWNSTAFHQALQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
MH580623_MHBs_P-E      MQWNSTAFHQALQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
MH580651_MHBs_P-E      MQWNSTAFHQALQDPRVRGLY-PAGGSSSGTVNPVPTTASLISSIFSRIG
MH580635_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MH580636_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427128_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427136_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427144_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
MT427194_MHBs_P-E      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
                              *::             .**    .      :    *.     *

KR139749_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB091255_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB091256_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB106564_MHBs_C-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB194947_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB194948_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
AB201287_MHBs_P-E      DPAPNMESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB201288_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
AB201289_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB201290_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGV
AB205129_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB205189_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB205190_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB205191_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB205192_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB219529_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB219533_MHBs_P-E      DPAPNMESITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274969_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274970_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
AB274973_MHBs_P-E      DHAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274974_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274975_MHBs_P-E      DPVPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274976_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274977_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274978_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274979_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274980_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274982_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274984_MHBs_P-E      DLAPNMENITSGFLGPLRVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274985_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
AB915175_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB915176_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB915177_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB915178_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494690_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494691_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494692_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494694_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494695_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494696_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494697_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494699_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494700_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494703_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGA
AM494704_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494705_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494706_MHBs_P-E      DPAPNMEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494709_MHBs_P-E      DPALNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494710_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494711_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
AM494712_MHBs_P-E      DLAPNMESITSXFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
AM494714_MHBs_P-E      DPAPNMESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AY738144_MHBs_P-E      DPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AY738145_MHBs_C-E      DPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AY738146_MHBs_P-E      DPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AY738147_MHBs_P-E      DPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AY739675_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AY935700_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ060822_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ060824_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU159673_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU239217_MHBs_P-E      DPAPSMESITSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU239218_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGV
EU239219_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU239220_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLSFLGGA
EU239221_MHBs_P-E      DPAPNMAGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU239222_MHBs_P-E      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU239223_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU239224_MHBs_P-E      DPAPNMESITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
EU239226_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FJ349226_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FJ349239_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN545821_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN545822_MHBs_P-E      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FN545823_MHBs_P-E      GLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN545841_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN545842_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594748_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594749_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594750_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
FN594751_MHBs_P-E      DLAPNMESITSGLLGPLPVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594752_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594756_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594758_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594759_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594760_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594761_MHBs_P-E      DLAPNMESITSGFLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594762_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594763_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGA
FN594765_MHBs_P-E      DLAPNMESITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FN594766_MHBs_P-E      DPAPNMESTTSGFLGPLHVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
GQ161755_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161757_MHBs_P-E      DPAPNMESITSRFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161758_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
GQ161759_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161760_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161762_MHBs_P-E      DPAQNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161763_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161764_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGA
GQ161768_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
GQ161770_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFVGGA
GQ161773_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161775_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161776_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161778_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161780_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161782_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161783_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161785_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161786_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161796_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161797_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161798_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161801_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161803_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161804_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161807_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161811_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161816_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
GQ161817_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161820_MHBs_P-E      DPAPNMEXITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161822_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161825_MHBs_P-E      DLAPNMEGITSGFLGPLLVLQAGFFLLTKILKIPQSLDSWWTSLNFLGGA
GQ161831_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161833_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161834_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161836_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLIKILTIPQSLDSWWTSLNFLGGA
HM363565_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGA
HM363566_MHBs_P-E      DLALNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363567_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363568_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGV
HM363572_MHBs_P-E      DPAPNMESITSRFLGPLLVLQAGFFSLTKTLTIPQSLDSWWTSLNFLGGA
HM363573_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNILGGA
HM363575_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363576_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363577_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363578_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363579_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
HM363580_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
HM363583_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363584_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363585_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363586_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363587_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363588_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363589_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363590_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363592_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363593_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363594_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363595_MHBs_P-E      DPAQNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363596_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363597_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363598_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363599_MHBs_P-E      DHAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363600_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGA
HM363601_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363602_MHBs_P-E      DLAPNMESITSGFLGPLLALQAGFFSLIKILTIPQSLDSWWTSLNFLGGA
HM363603_MHBs_P-E      DPAPNMETITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363606_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363607_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363608_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363609_MHBs_P-E      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363610_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363611_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HQ700550_MHBs_P-E      DPAPNIEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JN604166_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JN604168_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JN604235_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
JQ000008_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ000009_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ972812_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ972822_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170741_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170742_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170750_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170751_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGA
KF170782_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170783_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170784_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170785_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170786_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170787_MHBs_P-E      DLVPNMESITSGFLGPLLVLQEGFSLLTKILTIPQSLDSWWTSLNFLGGA
KF170790_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849713_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849715_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849716_MHBs_P-E      DPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849717_MHBs_P-E      DPAPKMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849718_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849720_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849721_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
KF849723_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
KF849726_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849727_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGV
KF849728_MHBs_P-E      VPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KM108610_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGA
KM108622_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KM108623_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGA
KM108624_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KM108625_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KM108626_MHBs_P-E      DPAPNMDSITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736892_MHBs_P-E      DXAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736897_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736899_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736911_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736912_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736913_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY498770_MHBs_P-E      DPAPNMESITSRFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGX
LT623843_MHBs_P-E      DLAPNMESITSGFLGPLLVLQEGFFXLTKILTIPQSLDSWWTSLNFLGGA
LT623844_MHBs_P-E      DXAPNMESITSGFLGPLLVLQXGFFLLTKILTIPQSLDSWWTSLSFLGGA
LT623845_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLXFLGGA
LT623847_MHBs_P-E      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
LT623848_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
LT623849_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
LT623850_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
LT623851_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLSFLGEA
MF772355_MHBs_P-E      DLVPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MF772357_MHBs_P-E      DLASNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MF772360_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
MH165306_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH464856_MHBs_P-E      DPAPNMESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580614_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580629_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580630_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580634_MHBs_P-E      DPARNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580638_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580644_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580645_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580648_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580650_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN507840_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN507841_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGA
MN507844_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN507845_MHBs_P-E      DPAPNMEGITSGFLGPLHVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN507846_MHBs_P-E      DPAPNMESITSGFLQPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN507847_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN967527_MHBs_P-E      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN967528_MHBs_P-E      DPASNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT426115_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
MT427110_MHBs_P-E      DPAPNMEGITSGFLGPLLVLRTGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427112_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427113_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427118_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSGWTSLNFLGGA
MT427120_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427123_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427124_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427133_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427134_MHBs_P-E      DPAPNMEGITSGFLGPLLVFQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427135_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427139_MHBs_P-E      DPAPNMEGITSGFLGPLLVFKAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427141_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427142_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427148_MHBs_P-E      DPAPNMEGITSGFLGPLLMLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427152_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427155_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427156_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427162_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427164_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427169_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427175_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427186_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427189_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW082636_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW455161_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW455162_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW455163_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW455164_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW455165_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW679682_MHBs_P-E      GPAPNMERITSGFLGPPLVLQAGFFLVTKILTIPQSPDSWWTSFNFLGGG
MW679683_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW926549_MHBs_P-E      DHAPNMESITSGFLGPLHVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGA
MW926550_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGS
MW926551_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAXFFLLTRILTIPQSLDSWWTSLNFLGGA
MW926554_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW926555_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW926556_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW926558_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW926559_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQXLDSWWTSLNFLGGA
MW926560_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW926561_MHBs_P-E      DLAPNMESITSGFLGPLLVLQAGFFLLTKILTIPKSLDLWWTSLNFLGGA
MW926562_MHBs_P-E      DLAPNMESITSGFLEPPPVLQAGLSLLTKILTIPQSLDSWWTSLSFLGGA
MW926563_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW926564_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
MW926566_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW999660_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW999661_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MZ962189_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MZ962190_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MZ962191_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MZ962192_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MZ962193_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGA
MZ962194_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFVGGA
MZ962195_MHBs_P-E      GLAPDMESLPSGFLGPLPVLQAGFFLLTKILPIPKSPDLWWTSPNFLGGA
MZ962196_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MZ962197_MHBs_P-E      DPAPNMESITSGFLEPLRVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MZ962198_MHBs_P-E      DLVPTMESITSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLPFLGGA
MZ962199_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFVGGA
OM256457_MHBs_P-E      DXAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
ON093163_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
ON402784_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
ON402785_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGA
ON854611_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363582_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW926552_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
AB274981_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ060823_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ060826_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ060827_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ060828_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ060829_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849719_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849722_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF922438_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF922439_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KT192626_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MF772354_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH918655_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW926548_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW999678_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161779_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HQ700552_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN507848_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427111_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427117_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427119_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427121_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427125_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427126_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427127_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427129_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427131_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427132_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427137_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427138_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427140_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427143_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427145_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427146_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427147_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427149_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427150_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427151_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427153_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427154_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427157_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427158_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427159_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427160_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427163_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427165_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427166_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427167_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427168_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427170_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427171_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427172_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427173_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427174_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427176_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427177_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427178_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427179_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427180_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427181_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427182_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427183_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427184_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427185_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427187_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427188_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427190_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427191_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427192_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427193_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427195_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427196_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427197_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427198_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427199_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427200_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427201_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB274971_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AY739674_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ060830_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FJ349237_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FJ349238_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161761_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161765_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161769_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161771_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161772_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161781_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161787_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161790_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161791_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161793_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161794_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161799_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161800_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161805_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161815_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161818_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161819_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161821_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161827_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161829_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161830_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161832_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363574_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363591_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363604_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736895_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736896_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KX186584_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
LT623846_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MF772362_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580621_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580622_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580624_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580625_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580631_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580632_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580637_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580646_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580647_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580649_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580652_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN507842_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN507843_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494707_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494693_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494701_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494702_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494708_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494713_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494715_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AM494717_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363569_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363570_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363571_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170788_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF170789_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736891_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736893_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736900_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736901_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736902_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736903_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736904_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736905_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736906_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736907_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736908_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736910_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580640_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580641_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MK321264_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MK720631_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MK720632_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MN967529_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
X75657_MHBs_P-E        DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580617_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580628_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
DQ060825_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849714_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF849724_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH464855_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW926557_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161835_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161766_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
GQ161774_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KU736894_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161777_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161802_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161784_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161789_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161828_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161810_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MW999659_MHBs_P-E      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161792_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161812_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161814_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161824_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161808_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363605_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
HM363581_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
ON528578_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ972813_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ972814_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ972821_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ972823_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ972824_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ972828_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
JQ972829_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736909_MHBs_P-E      DXAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KU736898_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580615_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580616_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580618_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580619_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580620_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580623_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580651_MHBs_P-E      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580635_MHBs_P-E      DPARNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MH580636_MHBs_P-E      DPARNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427128_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSGWTSLNFLGGA
MT427136_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSGWTSLNFLGGA
MT427144_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MT427194_MHBs_P-E      DPAPNMEGITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
                         .  :   .* :* *   ::  :  : : * **:  *  ***  ::*  

KR139749_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB091255_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB091256_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB106564_MHBs_C-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB194947_MHBs_P-E      PVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB194948_MHBs_P-E      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB201287_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB201288_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB201289_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB201290_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB205129_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB205189_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB205190_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB205191_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB205192_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB219529_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB219533_MHBs_P-E      PVCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274969_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274970_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274973_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274974_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274975_MHBs_P-E      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274976_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274977_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274978_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274979_MHBs_P-E      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274980_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMFLRRFIIFLFILLLCLIFLL
AB274982_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274984_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274985_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB915175_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB915176_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB915177_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB915178_MHBs_P-E      PVCPGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494690_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494691_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494692_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494694_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494695_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494696_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494697_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPLICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494699_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494700_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494703_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494704_MHBs_P-E      PVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494705_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494706_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494709_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494710_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494711_MHBs_P-E      PVCRGQNSQSPTSSHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494712_MHBs_P-E      PVCRGQNSQSPTSSHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494714_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY738144_MHBs_P-E      PVCLGQNSRSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY738145_MHBs_C-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY738146_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY738147_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFTIFLFILLLCLIFLL
AY739675_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY935700_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
DQ060822_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ060824_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU159673_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU239217_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU239218_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU239219_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU239220_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU239221_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU239222_MHBs_P-E      PVYLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU239223_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU239224_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU239226_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ349226_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ349239_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN545821_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLL
FN545822_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN545823_MHBs_P-E      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN545841_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN545842_MHBs_P-E      PVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594748_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594749_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594750_MHBs_P-E      PVCRGQNSQSPISNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594751_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPIWPGYRWMCLRRFIIFLFILLLCLIFWW
FN594752_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594756_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594758_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594759_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594760_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLM
FN594761_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594762_MHBs_P-E      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594763_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FN594765_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FN594766_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRIFIFLFILLLCLIFLL
GQ161755_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161757_MHBs_P-E      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161758_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161759_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161760_MHBs_P-E      PVCPGQNSQSPTSNHSLTSCPPICPGYRWMYLRRFIIFLFILLLCLIFLL
GQ161762_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161763_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161764_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161768_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161770_MHBs_P-E      PVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161773_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161775_MHBs_P-E      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161776_MHBs_P-E      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161778_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161780_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161782_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161783_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161785_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161786_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161796_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161797_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161798_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161801_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161803_MHBs_P-E      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161804_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161807_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161811_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161816_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161817_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161820_MHBs_P-E      PVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLL
GQ161822_MHBs_P-E      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161825_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161831_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPTCPGNRWMCLRRFIIFLFILLLCLIFLL
GQ161833_MHBs_P-E      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161834_MHBs_P-E      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161836_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363565_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363566_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363567_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363568_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363572_MHBs_P-E      PVCRGQNSQSPTSNHSPISCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363573_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363575_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363576_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363577_MHBs_P-E      PVCLGQNSQSPTSNHSPTSSPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363578_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363579_MHBs_P-E      PVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363580_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363583_MHBs_P-E      PVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363584_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363585_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363586_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363587_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363588_MHBs_P-E      PVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363589_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363590_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363592_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363593_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363594_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363595_MHBs_P-E      PGCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363596_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363597_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363598_MHBs_P-E      PVCLGQNSQSPISNHLPTSCPPICPGYRWMCQRRFIIFLFILLLCLIFLL
HM363599_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363600_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363601_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363602_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363603_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363606_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363607_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363608_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCRRRFIIFLFILLLCLIFLL
HM363609_MHBs_P-E      PVCLGQNLQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363610_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363611_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700550_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JN604166_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JN604168_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLL
JN604235_MHBs_P-E      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ000008_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ000009_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ972812_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ972822_MHBs_P-E      PVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170741_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170742_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170750_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170751_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170782_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170783_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170784_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170785_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170786_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170787_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIYLFILLLCLIFLL
KF170790_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849713_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849715_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849716_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849717_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849718_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849720_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849721_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849723_MHBs_P-E      PVCLGQNSQSPISNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849726_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849727_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849728_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KM108610_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KM108622_MHBs_P-E      PVCLGQNSQSPISSHSPTSCPQICPGYRWMCLRRFIIFLFILLLCLIFLL
KM108623_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KM108624_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLISLL
KM108625_MHBs_P-E      PVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KM108626_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736892_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736897_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736899_MHBs_P-E      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736911_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736912_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736913_MHBs_P-E      PVCRGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KY498770_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
LT623843_MHBs_P-E      PVCRGQNSQSPISNHSPTSCPXICPGYRWMCLRRFIIFLFILLLCLIFLL
LT623844_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
LT623845_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLXCLIFLL
LT623847_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLFILLLCLIFLL
LT623848_MHBs_P-E      PVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
LT623849_MHBs_P-E      PVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
LT623850_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
LT623851_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPTCPGFRWMCLRRFIIFLFILLLCLIFLL
MF772355_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF772357_MHBs_P-E      PVCLGQNSQFPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF772360_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH165306_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH464856_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580614_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580629_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580630_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580634_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580638_MHBs_P-E      PVCLGQNSQSQISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580644_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580645_MHBs_P-E      PVCLGQNSQSPTCNHSPTSCPPTCPGFRWMCLRRFIIFLFILLLCLIFLL
MH580648_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580650_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN507840_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGFRWMCLRRFIIFLFILLLCLIFLL
MN507841_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN507844_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN507845_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN507846_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN507847_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN967527_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPLICPGYRWMCLRRFIIFLFILLLCLIFLL
MN967528_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426115_MHBs_P-E      PVCLGQNSQSPTSYHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427110_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427112_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427113_MHBs_P-E      PVCLGQNSQSPTSNHSPISCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427118_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427120_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427123_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427124_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427133_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427134_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427135_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427139_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427141_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427142_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427148_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427152_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427155_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427156_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427162_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427164_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427169_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427175_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427186_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427189_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW082636_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW455161_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW455162_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLL
MW455163_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLL
MW455164_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRLMCLRRFIIFLFILLLCLIFLL
MW455165_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW679682_MHBs_P-E      SVCFGQNLQAPTPNHSPTSCPPIWPGYRWMCLRRFIIFLFILLLCLIFLL
MW679683_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926549_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926550_MHBs_P-E      PVCLGQNSQSLTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926551_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926554_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLL
MW926555_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926556_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926558_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926559_MHBs_P-E      PVCLGQNSQSPTSNHSLTSCPPNCPGYRWMCLRRFIIFLFILLLCLIFLL
MW926560_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MW926561_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926562_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIICLFILLLCLIFLL
MW926563_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MW926564_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926566_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW999660_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW999661_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGFRLMCLRRFIIFLFILLLCLIFLL
MZ962189_MHBs_P-E      TVCLGQNSQSPTSNHSPGSCPPIWPGYPWMGLRGFLVFLFILLLCLIFLL
MZ962190_MHBs_P-E      SVCLGQNSQSPTSNHSPTSCPSVCRGYRWMCLRRFIIFLFILLLCLIFLL
MZ962191_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLYILLLCLIFLL
MZ962192_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MZ962193_MHBs_P-E      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFIPLLCLIFLL
MZ962194_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MZ962195_MHBs_P-E      PVCLGPNSQSPNPNHSPTSLPSIWPAYRWMCLRRFIIFLFILLLCLIFLL
MZ962196_MHBs_P-E      PVCLGQSSQSPTSNHSPTSCPPIWPGYRWMCLRRFIIFLYILLLCLIFLL
MZ962197_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIISYYILLLCLIFLL
MZ962198_MHBs_P-E      PVCLGQNSQSPSYNHSPTSCPPICPGYRWMFQRRFIIFLFILLLCLIFLL
MZ962199_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
OM256457_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
ON093163_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
ON402784_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGFRWMCLRRFIIFLFILLLCLIFLL
ON402785_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
ON854611_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363582_MHBs_P-E      PVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926552_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274981_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
DQ060823_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
DQ060826_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
DQ060827_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
DQ060828_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
DQ060829_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849719_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849722_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF922438_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF922439_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KT192626_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF772354_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH918655_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926548_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW999678_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161779_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700552_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN507848_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427111_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427117_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427119_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427121_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427125_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427126_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427127_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427129_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427131_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427132_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427137_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427138_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427140_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427143_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427145_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427146_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427147_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427149_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427150_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427151_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427153_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427154_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427157_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427158_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427159_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427160_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427163_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427165_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427166_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427167_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427168_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427170_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427171_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427172_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427173_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427174_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427176_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427177_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427178_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427179_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427180_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427181_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427182_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427183_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427184_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427185_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427187_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427188_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427190_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427191_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427192_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427193_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427195_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427196_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427197_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427198_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427199_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427200_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427201_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB274971_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY739674_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
DQ060830_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ349237_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ349238_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161761_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161765_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161769_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161771_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161772_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161781_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161787_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161790_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161791_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161793_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161794_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161799_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161800_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161805_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161815_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161818_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161819_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161821_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161827_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161829_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161830_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161832_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363574_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363591_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363604_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736895_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736896_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KX186584_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
LT623846_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF772362_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580621_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580622_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580624_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580625_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580631_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580632_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580637_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580646_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580647_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580649_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580652_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN507842_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN507843_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494707_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494693_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494701_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494702_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494708_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494713_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494715_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AM494717_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363569_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363570_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363571_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170788_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170789_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736891_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736893_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736900_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736901_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736902_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736903_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736904_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736905_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736906_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736907_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736908_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736910_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580640_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580641_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK321264_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK720631_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK720632_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN967529_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
X75657_MHBs_P-E        PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580617_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580628_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
DQ060825_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849714_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF849724_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH464855_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW926557_MHBs_P-E      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161835_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161766_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161774_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736894_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161777_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161802_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161784_MHBs_P-E      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161789_MHBs_P-E      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161828_MHBs_P-E      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161810_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW999659_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161792_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161812_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161814_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161824_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161808_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363605_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM363581_MHBs_P-E      PVCLGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
ON528578_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ972813_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ972814_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ972821_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ972823_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ972824_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ972828_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ972829_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736909_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU736898_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580615_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580616_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580618_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580619_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580620_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580623_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580651_MHBs_P-E      PVCLGQNSQSPTSSHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580635_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH580636_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427128_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427136_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427144_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT427194_MHBs_P-E      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
                       .   * . :     *   * *    .   *  * :    :* * ***   

KR139749_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB091255_MHBs_P-E      VLLGYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB091256_MHBs_P-E      VLLGYQGMLPVCPLIPGSSTTITGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB106564_MHBs_C-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPADG
AB194947_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB194948_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDG
AB201287_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB201288_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB201289_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB201290_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB205129_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB205189_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB205190_MHBs_P-E      VLLDYRGILPVCPLLPGSATTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB205191_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB205192_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB219529_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB219533_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDG
AB274969_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274970_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274973_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSGG
AB274974_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274975_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274976_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274977_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274978_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274979_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274980_MHBs_P-E      VLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274982_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274984_MHBs_P-E      GLLDYQGMLPVCPLIPGSSNTSTGPCRTCTTLAQGTSMFPSCCCSKPLDG
AB274985_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB915175_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDG
AB915176_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB915177_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSLFPSCCCSKPSDG
AB915178_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMCPSCCCLKPSDG
AM494690_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494691_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494692_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494694_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDG
AM494695_MHBs_P-E      VLLDYQGMLPVCPLIPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPTDG
AM494696_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494697_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494699_MHBs_P-E      ALLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494700_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDG
AM494703_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDG
AM494704_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494705_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494706_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494709_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494710_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494711_MHBs_P-E      VLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494712_MHBs_P-E      VLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AM494714_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AY738144_MHBs_P-E      VLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AY738145_MHBs_C-E      VLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AY738146_MHBs_P-E      VLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AY738147_MHBs_P-E      VLLDYHGMLPVCPLIPGSPTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AY739675_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AY935700_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
DQ060822_MHBs_P-E      VLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
DQ060824_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
EU159673_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
EU239217_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
EU239218_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
EU239219_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
EU239220_MHBs_P-E      VLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCTKPSDG
EU239221_MHBs_P-E      VLLDYQGMLRVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
EU239222_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
EU239223_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
EU239224_MHBs_P-E      VLLDYRGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCLKPSDG
EU239226_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FJ349226_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDG
FJ349239_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDG
FN545821_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSXFPSCCCSKPSDG
FN545822_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN545823_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN545841_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN545842_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN594748_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN594749_MHBs_P-E      VLLDYQGMLPVCTLIPGSSTTSTGLTRACTTLAQGTSMFPSCCCSKPSDG
FN594750_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDG
FN594751_MHBs_P-E      DLQDYQGMLRECPQTPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN594752_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN594756_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEG
FN594758_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN594759_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSAGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN594760_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN594761_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN594762_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLVQGTSMFPSCCCSKPSDG
FN594763_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FN594765_MHBs_P-E      VLLDYQGMLPACPLTPGSSTTSTGPCRTCTTLAQGTSMCPSCCCSKPSDG
FN594766_MHBs_P-E      DLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161755_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161757_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTIAQGTSMFPSCCCSKPSDG
GQ161758_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161759_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDG
GQ161760_MHBs_P-E      VLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPLCCCSKPSDG
GQ161762_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161763_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161764_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161768_MHBs_P-E      VLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161770_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161773_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161775_MHBs_P-E      VLLDYHGMLPVCPLIPXSSTTSTGPCRTCTTXAQGXSMFPSCCCSKPSDG
GQ161776_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161778_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161780_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161782_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161783_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161785_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161786_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161796_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161797_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161798_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161801_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161803_MHBs_P-E      GLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161804_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161807_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161811_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161816_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161817_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161820_MHBs_P-E      VLLXYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161822_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161825_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPTDG
GQ161831_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161833_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161834_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161836_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363565_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSAG
HM363566_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363567_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363568_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363572_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363573_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363575_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDG
HM363576_MHBs_P-E      VLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363577_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363578_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363579_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363580_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363583_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363584_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363585_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363586_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363587_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363588_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363589_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363590_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEG
HM363592_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDI
HM363593_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363594_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363595_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363596_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQETSMFPSCCCSKPSDG
HM363597_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDG
HM363598_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQRTSMFPSCCCSKPSDG
HM363599_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGSCRTCTTLAQGTSMFPSCCCSKPSDG
HM363600_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363601_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363602_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363603_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDG
HM363606_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363607_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363608_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTNRTGPCRTCTTLAQGTSMIPSCCCSKPSDG
HM363609_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363610_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363611_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HQ700550_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
JN604166_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
JN604168_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
JN604235_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
JQ000008_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSXG
JQ000009_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
JQ972812_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
JQ972822_MHBs_P-E      VLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF170741_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF170742_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF170750_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF170751_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSTFPSCCCSKPSDG
KF170782_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF170783_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF170784_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF170785_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF170786_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF170787_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF170790_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849713_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849715_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849716_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849717_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849718_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849720_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDG
KF849721_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849723_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849726_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849727_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849728_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KM108610_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KM108622_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KM108623_MHBs_P-E      VLLDYQGMLPVCPLIPGPSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KM108624_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KM108625_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KM108626_MHBs_P-E      VLLDYQGILPVCPLIPGSSTTSTGLCRTCTTLAQGTSMFPSCCCSKSSDR
KU736892_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KU736897_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KU736899_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KU736911_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KU736912_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KU736913_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KY498770_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
LT623843_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTXAQGTSMFPSCCCSKPSDG
LT623844_MHBs_P-E      VLLDYQGMLPVCPLXPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
LT623845_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
LT623847_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDA
LT623848_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
LT623849_MHBs_P-E      VLLDYXGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
LT623850_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
LT623851_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MF772355_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MF772357_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDG
MF772360_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH165306_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH464856_MHBs_P-E      VLLDSQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSLFPSCCCSKPSDG
MH580614_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580629_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580630_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580634_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580638_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDG
MH580644_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580645_MHBs_P-E      VLLDYQGMLPVCPLIPRSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580648_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580650_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MN507840_MHBs_P-E      VLLDYQGMLPVCPLLPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MN507841_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MN507844_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MN507845_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MN507846_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MN507847_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MN967527_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQSTSMFPSCCCSKPSDG
MN967528_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT426115_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427110_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427112_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427113_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427118_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427120_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427123_MHBs_P-E      VLLDYQGMLPVCPPIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427124_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427133_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQRTSMFPSCCCSKPSDG
MT427134_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQRTSMFPSCCCSKPSDG
MT427135_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427139_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427141_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427142_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDR
MT427148_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427152_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427155_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427156_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEG
MT427162_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427164_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPPCCCSKPSDG
MT427169_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427175_MHBs_P-E      VLLDYQGMLPVCPLIPGTSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427186_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427189_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW082636_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW455161_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSER
MW455162_MHBs_P-E      VLLDCQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSYCCSKPSDG
MW455163_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSEPSDG
MW455164_MHBs_P-E      VLLDCQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSIFPSCCCSKPSDG
MW455165_MHBs_P-E      VLLDCQGILPVCPLIPGSSTTSTGPCRTCTTLAHGTSMFPSCCCSKPSDG
MW679682_MHBs_P-E      VLLDYHGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW679683_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDA
MW926549_MHBs_P-E      VLLDYHGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926550_MHBs_P-E      GLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926551_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926554_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926555_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926556_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926558_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926559_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926560_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926561_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLARGTSMFPSCCCSKPSDG
MW926562_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926563_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926564_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926566_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW999660_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW999661_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MZ962189_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDR
MZ962190_MHBs_P-E      VLLDYQGMLPVCPLIPGSSITSTGPCRTCTTLAQGTSAFPSCCCSKPSDG
MZ962191_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEG
MZ962192_MHBs_P-E      VLLDYQGMLPVCPLIPGSSITSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MZ962193_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEG
MZ962194_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSAFPSCCCSKPSDR
MZ962195_MHBs_P-E      VLLDYQGILPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDR
MZ962196_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLARGTSMFPSCCCSKPSDG
MZ962197_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMHPSYCCSEPSDG
MZ962198_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTYTTLAQGTSMFPSCCSSEPSDG
MZ962199_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTYTTLAQGTSIFPSCCCSEPSDG
OM256457_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
ON093163_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
ON402784_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
ON402785_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
ON854611_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363582_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926552_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274981_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
DQ060823_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
DQ060826_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
DQ060827_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
DQ060828_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
DQ060829_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849719_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF849722_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF922438_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KF922439_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KT192626_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MF772354_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH918655_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW926548_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MW999678_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161779_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HQ700552_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MN507848_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427111_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427117_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427119_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427121_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427125_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427126_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427127_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427129_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427131_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427132_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427137_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427138_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427140_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427143_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427145_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427146_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427147_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427149_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427150_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427151_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427153_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427154_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427157_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427158_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427159_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427160_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427163_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427165_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427166_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427167_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427168_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427170_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427171_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427172_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427173_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427174_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427176_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427177_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427178_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427179_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427180_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427181_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427182_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427183_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427184_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427185_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427187_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427188_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427190_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427191_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427192_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427193_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427195_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427196_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427197_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427198_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427199_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427200_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MT427201_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AB274971_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
AY739674_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
DQ060830_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FJ349237_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
FJ349238_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161761_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161765_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161769_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161771_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161772_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161781_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161787_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161790_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161791_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161793_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161794_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161799_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161800_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161805_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161815_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161818_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161819_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161821_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161827_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161829_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161830_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
GQ161832_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363574_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363591_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
HM363604_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KU736895_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KU736896_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
KX186584_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
LT623846_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MF772362_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580621_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580622_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580624_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580625_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580631_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580632_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580637_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580646_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580647_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580649_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MH580652_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MN507842_MHBs_P-E      VLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDG
MN507843_MHBs_P-E      VLLDYQG