HBVdb

Dataset for protein LHBs of genotype D

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
          * ** * :             .** ..  :    .   * *.                            
-MGQNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKVGAGAFGLGFTPPHGGLLGWSPQAQGIlQTLPa
                        k  sn           p  n        y p l                mih v t
                            t                                            tm    e
                            s                                                  v
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                               .                
NPPPASTNRQSGRQPTPLSPPLRnTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTaSpiSSIFSRIGD
    va   rtr      t    d     i   ykn   a    k k   l     t ea s  l  v hll    k   
                                              s                       t         
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    *          *    *              *    .::                     * * ..        : 
PALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMC
lvp        l           s   k     k         s    n   r                          y
  q                                                                             
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
             .           .   * *          ..                         *    . *   
LRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIP--GS---STTStGPCRTCTTpaQGTSMYPSCCCTKPSDGNCTCIP
         t     t        h       ml            v t k  mitv  a  f     i  l r      
                        r                     a s      l                        
                                                       i                        
                                                                                

       330       340       350       360       370       380       390     
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:
:***    .: . *           .  ..                   .                         
IPSSWAFGKFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPSLYsILSPFLPLLPIFFCLWVYI
       a    a  l                a    i   l ml   c   n cnt r  il     ls  a  
                                            s       r fr  n                
                                                    x  t                   
                                                       x                   
© 1998-2022Legal notice