HBVdb

Dataset for protein LHBs of genotype D

[Download (right click)] [Sequences] [Repertoires]

1969 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


GU456678_LHBs_P-D      -MG-Q-NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779382_LHBs_P-D      -MG-ETDLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
DQ399006_LHBs_P-D      -MG-Q-NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257186_LHBs_P-D      GMG-Q-NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB048701_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
AB078031_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAANKV
AB078032_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAANKV
AB090268_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDGNKV
AB090270_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB104709_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB104710_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB104711_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB104712_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB109475_LHBs_P-D      -MGQ--NLSTSNPMGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB109476_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB109478_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
AB109479_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB116266_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPIKDTWPDAKKV
AB119251_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB119252_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB119255_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB120308_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB126581_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB188241_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB188242_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
AB188244_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB205127_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB205128_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTAHPDWDFNPNKDTWPDANKV
AB210820_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB222709_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB222710_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB222711_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB222712_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB222713_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB246347_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
AB246348_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB270539_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB270541_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB270542_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKV
AB270543_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB270546_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
AB270547_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB270548_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB270550_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB330367_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
AB330369_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB330370_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB493846_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB554016_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB554024_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB555496_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB555497_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB555500_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB555501_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB583680_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB674405_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB674406_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
AB674407_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB674408_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
AB674411_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB674416_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKV
AB674419_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB674420_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
AB674422_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB674423_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB674424_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB674425_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKV
AB674427_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB674428_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB674431_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
AF043593_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AF043594_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AF121239_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AF121242_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AF151735_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AF280817_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AJ131956_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AJ344116_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AJ627215_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AJ627216_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AJ627218_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AJ627219_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
AJ627220_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AJ627222_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AJ627223_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AJ627224_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
AM422939_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY090452_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
AY090453_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWSDANKV
AY161150_LHBs_P-D      -MGQ--NLSISNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY161157_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY233291_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY233292_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY233294_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY233296_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY236160_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY236162_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY661792_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY661793_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY721612_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY741794_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
AY741796_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
AY741797_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY741798_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY796030_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY796031_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
AY796032_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAHKV
AY945307_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ111986_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ304547_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ304548_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ304550_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ304551_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ315776_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ329356_LHBs_P-D      -MGQ--NLSTSNPLGFLPDHQLDPAFRANTGNPDWDFNPNKDTWQDANKE
DQ329357_LHBs_P-D      -MGQ--NLSTSNPLGFLPDHQLDPAFRANTGNPDWDFNPNKDTWQDANKV
DQ336674_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336675_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336676_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336678_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336679_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336685_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336686_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336687_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQSDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336688_LHBs_P-D      -MGQ--NLSTSNPLGFFPDYQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336689_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336690_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336691_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336692_LHBs_P-D      -MGQ--NLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ464168_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRAATANPDWDFNPNKDTWPDANKV
DQ464169_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPGWDFNPNKDTWPDANKV
DQ464170_LHBs_P-D      -MGQ--NLSTSNPLGFFPHHQLDPAFRSNTANPDWDFNPNKNTWPDANKV
DQ464172_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ464173_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ464174_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ464175_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ464176_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ464177_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ464178_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTAIPDWDFNPNKDTWPDANKV
DQ464182_LHBs_P-D      -MGR--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
DQ486021_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ486025_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EF103275_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EF103276_LHBs_P-D      -MGQ--NLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EF103277_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EF103281_LHBs_P-D      -MGQ--NLFTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU155893_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANQDWDFNPNKDTWPDANKV
EU155895_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU414135_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU414136_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
EU414138_LHBs_P-D      -MGX--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU414139_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU414140_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU414141_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU414142_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU414143_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594382_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594396_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594398_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594400_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594401_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
EU594402_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
EU594404_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594405_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594407_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594408_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594409_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594410_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594416_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594419_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594422_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594424_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
EU594425_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594426_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594428_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594433_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594434_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU787437_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU787438_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
EU787440_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU787441_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU787442_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU787443_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU787446_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU787447_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU919197_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU921418_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU921419_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU939680_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU939681_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ349206_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ349209_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ349213_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
FJ349214_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
FJ349215_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
FJ349216_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
FJ349218_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTASPDWDFNPNKDTWPDANKV
FJ349219_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
FJ349220_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
FJ349228_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
FJ349229_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ349231_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ349232_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
FJ349233_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ349234_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ349235_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
FJ386590_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ562338_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKV
FJ692506_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ692532_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
FJ692533_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
FJ899792_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904395_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
FJ904402_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTKNPDWDFNPNKDTWPDANKV
FJ904410_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
FJ904412_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904418_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904419_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
FJ904422_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904426_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904427_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904429_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904431_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904432_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904433_LHBs_C-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDPWPDANKV
FJ904435_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
FJ904438_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
FJ904439_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
FJ904445_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ167301_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ167302_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183448_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183449_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183450_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183456_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183458_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183459_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183460_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183461_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183465_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKG
GQ183467_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183470_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183471_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183472_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183473_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
GQ183474_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
GQ183475_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
GQ183476_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
GQ183477_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
GQ183479_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
GQ183480_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183481_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
GQ183482_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
GQ183485_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ184322_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ205380_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
GQ205382_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
GQ205384_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
GQ205385_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
GQ205388_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
GQ205389_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHRLDPAFRANTRNPDWDFNPNKDTWPDANKV
GQ477452_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ477453_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ477455_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ477456_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ477457_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ477458_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
GQ477459_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ922000_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKV
GQ922001_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ922002_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ922003_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
GQ922004_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
GQ922005_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
GQ924652_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
GU357846_LHBs_P-D      -MGQ--NPSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456635_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
GU456636_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456637_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456639_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456640_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456641_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456643_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456645_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456647_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456649_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
GU456650_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456651_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456652_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456653_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
GU456654_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456655_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456656_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456657_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456658_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456659_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456661_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456663_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
GU456664_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456665_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456666_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456667_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456668_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456669_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456673_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
GU456674_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456675_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456677_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456679_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456680_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456681_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456682_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
GU456683_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
GU456684_LHBs_P-D      -MGQ--NLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HM750151_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKV
HM750153_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HM750154_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HM750155_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HM750156_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ236014_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ236015_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
HQ236016_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700444_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKV
HQ700445_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700448_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700449_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700453_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKV
HQ700454_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTXNPDWDFNPNKDTWPDANKV
HQ700455_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700458_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
HQ700463_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKV
HQ700472_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPHKDTWPDANKV
HQ700473_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDXWPDANKV
HQ700474_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
HQ700478_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700480_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700481_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700483_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700487_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700510_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700511_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDIWPDANKV
HQ700513_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700514_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700553_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ833465_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ833467_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ833468_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ833469_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ833470_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ833471_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAXKV
JF439692_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF439696_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF439699_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF439700_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF439703_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF439704_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKV
JF439706_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKV
JF439708_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKV
JF439709_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKV
JF439718_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754588_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754590_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754593_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754594_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754595_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754597_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754599_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754600_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754601_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754602_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754603_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754609_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754610_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754611_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754612_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
JF754614_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754615_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JF754617_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754618_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JF754619_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754623_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754624_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754626_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JF754627_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JF754628_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JF754629_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754631_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754632_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754633_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754634_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754635_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040750_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040751_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040753_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040755_LHBs_P-D      -MGQ--NLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040757_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040758_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040759_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040761_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040762_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040765_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040766_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040767_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040768_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
JN040769_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040770_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040771_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040773_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPACRANTANPDWDFNPNKDTWPDANKV
JN040774_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JN040775_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040777_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040778_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040779_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040781_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040782_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040783_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040784_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040785_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040786_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040787_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040788_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040790_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040791_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040793_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040795_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040796_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040797_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040799_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040800_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040801_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040802_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDAWPDANKV
JN040805_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPDFRANTANPDWDFNPNKDTWPDANKV
JN040806_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040807_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040808_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040809_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040810_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040811_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040812_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040813_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040814_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040815_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRAKTANPDWDFNPNKDTWPDANKV
JN040818_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQWDPAFRANTANPDWDFNPNKDTWPDANKV
JN040819_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
JN040820_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JN040821_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040822_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040823_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040824_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040826_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040827_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040828_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040830_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
JN257148_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257149_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257150_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
JN257152_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257153_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257159_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
JN257160_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257162_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257163_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257165_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257169_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257170_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257172_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
JN257176_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDXWPDANKV
JN257181_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKV
JN257183_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257188_LHBs_P-D      -MGQ--NLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDPWPDANKV
JN257190_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
JN257193_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257196_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257199_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257200_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257201_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257202_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257203_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257205_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257209_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604120_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPXANKV
JN604139_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604152_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604161_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
JN604170_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604174_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
JN604175_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604189_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604206_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604207_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
JN604238_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
JN604239_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604250_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604259_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604263_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604265_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604272_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604275_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604278_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604301_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604312_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JN604318_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642126_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642129_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642130_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
JN642131_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642132_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
JN642133_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642134_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
JN642135_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642136_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642138_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642140_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642142_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642143_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642144_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642145_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642146_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642148_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
JN642149_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642150_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642151_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
JN642153_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWSDANKV
JN642154_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642157_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
JN642158_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642159_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
JN642161_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642163_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642164_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642165_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
JN642166_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664909_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTGNPDWDFNPNKDTWPDANKV
JN664910_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPDANKV
JN664912_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTPNPDWDFNPNKDTWPDANKV
JN664913_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664917_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664918_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664919_LHBs_P-D      -MGQ--NLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664920_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664921_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664922_LHBs_P-D      -MGG--CLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664926_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
JN664927_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664930_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTAYPDWDFNPNKDTWPDANKV
JN664931_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664932_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDPWPDANKV
JN664936_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664937_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664938_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664939_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664941_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN688678_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN688679_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN688683_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN688685_LHBs_P-D      -MGQ--NLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDNWPDANKV
JN688695_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN688708_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN688710_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN688711_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN688712_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
JN688713_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN792903_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN792905_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN792906_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN792908_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN792911_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN792912_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ687530_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ687531_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JQ707476_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707480_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707483_LHBs_P-D      -MGQ--NLSTNNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707486_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707493_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707497_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707512_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707513_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707515_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
JQ707524_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707529_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707682_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707683_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707686_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPDKDTWPDANKV
JQ707689_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707690_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707693_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707697_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707703_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ927384_LHBs_P-D      -MGQ--NLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX036331_LHBs_P-D      -MG--TNLSVPNPLGFFPDHQLDPAFGANSNNPDWDFNPNKDHWPEASQI
JX090605_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090606_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090607_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090608_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090609_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090610_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090611_LHBs_P-D      -MGQ--NLSTSNPMGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090613_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090615_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090616_LHBs_P-D      -MGQ--NLSVRNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
JX090617_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090618_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKX
JX090619_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090620_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090621_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090622_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090623_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090624_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090625_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090626_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090627_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
JX090628_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090629_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090633_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090634_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090635_LHBs_P-D      -MGQ--NLSSSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090636_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090639_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090640_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090641_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090644_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090646_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090647_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JX090656_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTDNPDWDFNPNKDTWPDANKV
JX090657_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090658_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090659_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090660_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090662_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090663_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090665_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090666_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JX090667_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDLAFRANTANPDWDSNPNKDTWPDANMV
JX090668_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090670_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090671_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090672_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090673_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JX090675_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090676_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
JX090677_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090678_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090679_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
JX090680_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090681_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPIKDTWPDANKV
JX090682_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090683_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090685_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPGANKV
JX090686_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090687_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090688_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090689_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090690_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090693_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090694_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090695_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090696_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWSDANKV
JX090697_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090698_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090700_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090701_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090703_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090705_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090706_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090707_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090708_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090712_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090715_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090716_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090719_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090720_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090721_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090723_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090724_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX096955_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX310726_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPGANKV
JX310727_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKV
JX310728_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX310729_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX310733_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX310734_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX310735_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANQDWDFNPNKDTWPDANKV
JX470760_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX898689_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDASKV
JX898691_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX898694_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC774440_LHBs_P-D      -MG--TNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC774444_LHBs_P-D      -MG--TNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC774445_LHBs_P-D      -MG--TNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC774462_LHBs_P-D      -MGT--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC774477_LHBs_P-D      -MG--TNLSVPNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875276_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875277_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875278_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLVPAFRANTANPDWDFNPNKDTWPDANKV
KC875279_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875280_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875281_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875282_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFKPNKDTWPDANKV
KC875283_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875284_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875285_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875286_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875287_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875288_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875289_LHBs_P-D      -MGQ--NLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875290_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875291_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875292_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
KC875293_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875295_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875297_LHBs_P-D      -MGQ--NLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875298_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875299_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875300_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875301_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875302_LHBs_P-D      -MGQ--NLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875303_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875304_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875305_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875309_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875310_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875311_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875313_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875314_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875315_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875316_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875317_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875318_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875320_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875321_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNNDTWPDANKV
KC875322_LHBs_P-D      -MGQ--NLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875324_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875325_LHBs_P-D      -MGE--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875326_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLGPAFRANTANPDWDFNPNKDTWPDANKV
KC875328_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875329_LHBs_P-D      -MGQ--NLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875330_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875331_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875332_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875333_LHBs_P-D      -MGK-N-HSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875334_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875335_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875336_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
KC875337_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875340_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
KC875342_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
KF053178_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF061167_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF061168_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF061169_LHBs_P-D      -MGQ--NLSTXXPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF061170_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAXRANTANPDWDFNPNKDTWPDANKV
KF170755_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170756_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170757_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
KF170760_LHBs_P-D      -MGQ--NLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDPWPDANKV
KF170761_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170763_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
KF170764_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170765_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170767_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDSWPDANKV
KF170768_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKV
KF170770_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170771_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170772_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170774_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAHKV
KF170776_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF192830_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
KF192834_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
KF471640_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471641_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471642_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471644_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471646_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDPWPDANKV
KF471647_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471649_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDANKV
KF471650_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471654_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471655_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471656_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471657_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471658_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
KF471659_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
KF471660_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF476028_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNEDTWPDANKV
KF476029_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDADKV
KF476030_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF584160_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTXNXDWDFNPNKDTWPDANKV
KF584162_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF584163_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF584165_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF679989_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF679990_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF679992_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF679994_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF679997_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF679998_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779209_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779212_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779214_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779216_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779217_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779218_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779219_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQVDPAFRANMGNPDWDFNPNKDTWPDANKV
KF779220_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779222_LHBs_P-D      -MGQ--NLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779225_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANMGNPDWDFNPNKDTWPDANKV
KF779228_LHBs_P-D      -MGVQ-NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779230_LHBs_P-D      -MGV-QNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779289_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRVNTANPDWDFNPNKDTWPDANKV
KF779292_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779296_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779301_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779302_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779303_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779340_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779341_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF922432_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
KJ470889_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
KJ470893_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
KJ470894_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
KJ470895_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
KJ470896_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
KJ647350_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KJ647352_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KJ647353_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KJ647355_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KJ843187_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM108591_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
KM108592_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDASKV
KM108593_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM108594_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
KM108595_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM108596_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPAANKV
KM108597_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM108598_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM108599_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM108600_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM108603_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM108605_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524338_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524339_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524340_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDPWPDANKV
KM524341_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524342_LHBs_P-D      -MGQ--NLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524344_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524345_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTKNPDWDFNPNKDTWPDANKV
KM524346_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524347_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524349_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524350_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524351_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524353_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
KM524354_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524355_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKV
KM524356_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
KM524358_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM577668_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM577669_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM577670_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM577671_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM606744_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
KM606745_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM606752_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
KM606754_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
KM606755_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
KP090177_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KP090179_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KP090180_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KP090181_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KP168419_LHBs_P-D      -MGQ--NLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KP995100_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KR139748_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT151620_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT347090_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366465_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366491_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366494_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366496_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366499_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366508_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366510_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
KT366511_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT749821_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT749827_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT749828_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT963508_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU668433_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
KU668435_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
KU668436_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU668439_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
KU668441_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
KU668442_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU668444_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTAYPDWDFNPNKDTWPDANKV
KU668447_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU668448_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTACPDWDIDPNKDTWPDANKV
KU668449_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU736924_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU736926_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
KU736927_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
KX196208_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196209_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196213_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196215_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196216_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196218_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196219_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
KX196220_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196222_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196224_LHBs_P-D      -MGQ--NLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196226_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196227_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196228_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196229_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
KX196233_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX276856_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX276857_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
KX276998_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDANKV
KX276999_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX357622_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTHPDWDFNPNKDTWPDANKV
KX357637_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX357638_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX357639_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
KX827290_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX827291_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX827292_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KY629630_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KY629633_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
L27106_LHBs_P-D        -MGQ--SLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LC519802_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
LC519808_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPAANKV
LC519809_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LC519814_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LC519816_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LT717702_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LT717703_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LT992438_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LT992439_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDNWPDANKV
LT992444_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTKNPDWDFNPNKDPWPDANKV
LT992454_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
M32138_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
MF618343_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF618348_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF618349_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF925363_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF925364_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF925366_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDCWPAANKV
MF925379_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF925383_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF925391_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979154_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979155_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979156_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979157_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979158_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979161_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979162_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979163_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979165_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979166_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
MF979167_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979168_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979170_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MF979171_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979173_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MF979174_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979175_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979176_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MG877709_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MG877718_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MG877719_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MG877720_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MG877726_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MG877728_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464831_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464833_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464834_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464836_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464838_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464839_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464840_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MH464841_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDXWPDANKV
MH464843_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTXXPDWDFNPNKDTWPDXNKV
MH464844_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
MH464847_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464848_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464849_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464854_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724216_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724217_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724224_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MH724226_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724228_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MH724232_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MH724233_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MH724235_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724236_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724237_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724238_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724241_LHBs_P-D      -MGQ--NLSNSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724242_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724245_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANNV
MH724246_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724247_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724249_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
MH724250_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724251_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
MH724252_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH932714_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052947_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052948_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052949_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052950_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052951_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052952_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052953_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052954_LHBs_P-D      -MGQ--NLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052955_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052956_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052959_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052961_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052963_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052966_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052971_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052972_LHBs_P-D      -MGQ--NLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
MK052973_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052974_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK355500_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLGPAFKANTANPDWDFNPNKDTWPDANKV
MK355501_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKV
MK507913_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK516278_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK541688_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598636_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598637_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598638_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598639_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598640_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598641_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598642_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598643_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598644_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598645_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTPNPDWDFNPNKDPWPDANKV
MK598646_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598647_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598648_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598649_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598650_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598651_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNRDALPDANKV
MK598655_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNRDALPDANKV
MK598657_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNRDALPDANKV
MK598658_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598659_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPGWDFNPNKDTWPDANKV
MK598660_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598661_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTAIPDWDFNPNKDTWPDGNKV
MK598662_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTAIPDWDFNPNKDTWPDGNKV
MK598663_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598664_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598665_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598666_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598667_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598669_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598670_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598671_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598672_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598674_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598675_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNTKKDTWPDANKV
MK598676_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598677_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598678_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598679_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618418_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618419_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618420_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618422_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618424_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618425_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618426_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618427_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618429_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MK618430_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MK618431_LHBs_P-D      -MGH--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618432_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MK618433_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MK618434_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618435_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618436_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618437_LHBs_P-D      -MGH--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618441_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK693107_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPDKDTWPDANKV
MK693108_LHBs_P-D      -MGQ--NLFTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK693109_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310705_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310706_LHBs_P-D      -MGQ--NISTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310707_LHBs_P-D      -MGQ--NISTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310708_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310709_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310710_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310711_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310712_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310713_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310714_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN310715_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN507836_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN507837_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN507838_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN507839_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKI
MN507852_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MN585095_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MN839643_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN844881_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN844882_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
MT114169_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT114172_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKV
MT114173_LHBs_P-D      -MRQ--NLSTSNPPGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT579898_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT579899_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKV
MT579901_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT579903_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT591276_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT591277_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT591279_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
MT591281_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDPWPDANKV
MT603387_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603388_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603389_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603390_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603391_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603393_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603394_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603395_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603396_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603397_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603398_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603399_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603400_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603404_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW082640_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW455166_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601228_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601229_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601231_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601232_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601233_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601234_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601236_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601237_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MW601238_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601239_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601242_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601243_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MW601244_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MW601245_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MW601246_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601248_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601249_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601250_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MW601251_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601252_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601253_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MW601254_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601255_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601256_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601257_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MW601258_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601259_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601262_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601263_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPDANKV
MW601265_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601267_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601268_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601269_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601271_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPDANKV
MW601272_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601273_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601275_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601276_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601278_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
MW601279_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601280_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601281_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
MW601283_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601285_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601286_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601287_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601288_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601289_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601290_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
MW601291_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601292_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601294_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
MW601295_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601297_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601298_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601299_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601300_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
MW601302_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
MW601303_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601305_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
MW601306_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601307_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601309_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDIWPDANKV
MW601311_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601312_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601314_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
MW601315_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601316_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601318_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601320_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601321_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601323_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
MW601324_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601325_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MW601326_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601327_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601328_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601329_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601330_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601332_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601333_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601335_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601336_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601337_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MW601338_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601339_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MW675897_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
MW675898_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW847931_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999631_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDANKV
MW999632_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999634_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999635_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999636_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999642_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999644_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999646_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999648_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MW999649_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999650_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MW999654_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999655_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDANKV
MW999656_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
MW999657_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999658_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097624_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097625_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
MZ097626_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097627_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
MZ097628_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097630_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097631_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097632_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097633_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097635_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097636_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097637_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097638_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDIWPDANKV
MZ097639_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097641_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097642_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097643_LHBs_P-D      -MGQ--NLSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097644_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097645_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097646_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097647_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097648_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097650_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097651_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097653_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097654_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKV
MZ097655_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097656_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097657_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097658_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097659_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097660_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097661_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPDANKV
MZ097662_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097663_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097664_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097665_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097668_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097669_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097670_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097672_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097673_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MZ097674_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
MZ097675_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097676_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097677_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097679_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKV
MZ097681_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097682_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097683_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097684_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097685_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097686_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097689_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097690_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097692_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097693_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097694_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097696_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097697_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
MZ097698_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097699_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097700_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097701_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
MZ097702_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097704_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
MZ097705_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKV
MZ097707_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097709_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097710_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097711_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097712_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097713_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097715_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097717_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097718_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097720_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097726_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097730_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097734_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097743_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097744_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPDANKV
MZ097752_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
MZ097754_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097755_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
MZ097763_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097765_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
MZ097771_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
MZ097772_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097775_LHBs_P-D      -MGQ--NLSTSNPLGFXPXHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097776_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHXLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097779_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097780_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097782_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097784_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
MZ097785_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097787_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097788_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097789_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097790_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097791_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097794_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097795_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097797_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097798_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097799_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097800_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
MZ097801_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097802_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097803_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097804_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097807_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097808_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097809_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097811_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097812_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097815_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097816_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097817_LHBs_P-D      -MGQ--NLSTSNPLGFXPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097818_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097819_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKV
MZ097820_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097821_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097823_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097824_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWTDANKV
MZ097825_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097827_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097828_LHBs_P-D      -MGQ--NLSTTNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
MZ097829_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097830_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097832_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097834_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097835_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097836_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097837_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097839_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097840_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097841_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097842_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MZ097843_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097844_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTATPDWDFNPNKDTWPDANKV
MZ097845_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MZ097847_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097848_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097849_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097851_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097852_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097853_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097855_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MZ097856_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097857_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097858_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MZ097861_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097863_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097864_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097865_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTASPDWDFNPNKDTWPDANKV
MZ097866_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097867_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097868_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MZ097870_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097871_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097872_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097873_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097874_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097875_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097876_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097877_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097878_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097879_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097880_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097881_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097882_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097883_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097884_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
OK106256_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143467_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143470_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
OK143472_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
OK143474_LHBs_P-D      -MGQ--NLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143476_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143479_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143486_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143489_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143490_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143496_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKV
OK998519_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKETLPEANKV
OK998520_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK998521_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK998522_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK998523_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK998524_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK998525_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK998527_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM025254_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304306_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304307_LHBs_P-D      -MGQ--NLPTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304310_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304311_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304312_LHBs_P-D      -MGQ-I-FSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304313_LHBs_P-D      -MGQ--NLXTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304314_LHBs_P-D      -MGQ--NLPTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304315_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304316_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304317_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTLNPDWDFNPNKDNWPDANKV
OM304318_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
OM304322_LHBs_P-D      -MGQ--NLSTGNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304323_LHBs_P-D      -MGQ--NLXTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304324_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM304325_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM721310_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM721311_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
OM721312_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM721315_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM721316_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
ON585704_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153940_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSIPDWDFNPNKDTWPDANKV
OP153941_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
OP153943_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153945_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTVIPDWDFNPNKDTWPNANKV
OP153946_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153947_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153951_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153952_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153953_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153954_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153955_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTLPDANKV
OP153956_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANSDWDFNPNKDTWPDANKV
OP153957_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153958_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153959_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNRDALPDANKV
OP153960_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153961_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153964_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKV
OP153965_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153966_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTGFPDWDFNPNKDTWPNANKV
OP153967_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTAIPDWDFNPNKDTWPNANKV
OP153968_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTVIPDWDFNPNKDTWPNANKV
OP153969_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPXAXKV
OP153970_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153971_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
OP153973_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153974_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153976_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153977_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDARPDANKV
OP153978_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153983_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153985_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153986_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153987_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPEWDFNPNKDTWPDANKV
OP153988_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
OP153989_LHBs_P-D      -MGQ--NLSTSNPLGIFPDHQVDPAFRANTANPDWDFNPNKDTWPDANKV
OP153990_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153991_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNRDALPDANKV
OP153992_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153993_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153994_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
OP153996_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
OP153997_LHBs_P-D      -MGQ--NLSTSNPLGIFPDHQVDPAFRANTANPDWDFNPNKDTWPDANKV
OP153998_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153999_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP154000_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP154001_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
OP154002_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP154003_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP154004_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP154006_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNANKV
OP154007_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP154008_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP255998_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256000_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256001_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256002_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256003_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256004_LHBs_P-D      -MGQ--NLSTSNPLGVFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256006_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFKPNKVTWPNANKV
OP256007_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256009_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256010_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHHWDPAFRANTANPDWDFNPNKDTLPDANKV
OP256011_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHHLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256012_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256013_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
OP256014_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256017_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256018_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256019_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OR126893_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OR487153_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
OR580950_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
OR769213_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OR769214_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OR905602_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OR947659_LHBs_P-D      -MGQ--NLSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OR947660_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OY983050_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDANKV
OY983051_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OY983063_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
X02496_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
X65258_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPASRANTANPDWDFNPNKDTWPDANKD
X80924_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
X97848_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
Z35716_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDYNPNKDTWPDANKV
AB078033_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAANKV
AB267090_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAANKV
AF121240_LHBs_C-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AF121241_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456660_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456670_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040792_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257151_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170747_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999641_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097671_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097833_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB109477_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB110075_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB119254_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB205126_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB210821_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB210822_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB471856_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB471857_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594403_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594413_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594414_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594415_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594421_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875312_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF679996_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524352_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KR905424_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366495_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366506_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366509_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX827301_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LC488706_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LC519789_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LC519793_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF925358_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724231_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724244_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT579900_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999652_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999653_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AB119253_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF925393_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601274_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097750_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY721607_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594397_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU787436_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ349230_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904415_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904420_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904421_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904424_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904443_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ377589_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700440_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700441_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700442_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700443_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700447_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700450_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700451_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700459_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700464_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700469_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700470_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700471_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700479_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700482_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700484_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700488_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754591_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754592_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754604_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257155_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257171_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257179_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257182_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257185_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642147_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642167_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090649_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090650_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090651_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090652_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090653_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090654_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170758_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KP322600_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LC365689_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK507910_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK507911_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK507914_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601247_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601261_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601282_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601313_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999647_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097666_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097731_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097741_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097756_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097796_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097860_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM721313_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY721605_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY721606_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY721608_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ904399_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456638_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456646_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GU456648_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HM750152_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754596_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF754607_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040794_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN040829_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090655_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471651_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF471652_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM606753_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KP322599_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX827300_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KY629634_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618428_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN507851_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097695_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097786_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
Y07587_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366498_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
KT366500_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
KT366501_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
KT366502_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDANKV
AB554023_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097813_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090684_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097640_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
AY161158_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
AY741795_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
JN664911_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN664914_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF170746_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU668434_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU668437_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU668438_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU668446_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
LC705462_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF618339_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF618340_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF618341_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OR580949_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
V01460_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
DQ336677_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183478_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090661_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090674_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724215_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724220_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK507912_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
X65257_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594399_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594418_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594430_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ349205_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
FJ349208_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700512_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604295_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090699_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090713_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090718_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX096957_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF679995_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KP322601_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KR905423_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU736925_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601301_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097708_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097773_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
X72702_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
X97849_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594427_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594417_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594429_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594431_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594432_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX096958_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601266_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097747_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594420_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
EU594423_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX096956_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP256008_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
FJ692507_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183451_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183452_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183453_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183454_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183455_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183457_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183462_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183463_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183464_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183466_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183468_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183469_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
GQ183483_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
MF618342_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDANKV
KF170759_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF584161_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KY382414_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM519455_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KR139747_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724214_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724221_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724234_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MN507853_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700446_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
HQ700466_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDANKV
JX090702_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX096954_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598668_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF439701_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JF439705_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKV
JF439710_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKV
JF439711_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDANKV
KF170766_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN642156_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257195_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN257177_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDXWPDANKV
MW999640_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN604313_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX898697_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779224_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM524361_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN792904_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN792907_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN792909_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JN792910_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603392_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603401_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603402_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT603403_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707478_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707479_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707481_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707482_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707485_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707487_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707488_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707489_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707490_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707494_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707496_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707499_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707500_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707502_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707503_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707505_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707507_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707508_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNANKV
JQ707527_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707514_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707516_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707518_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707519_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707520_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707521_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707522_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707523_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707526_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707528_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707530_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707517_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707525_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707684_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707685_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707687_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707688_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707691_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707692_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707694_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707695_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707696_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707698_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707700_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707701_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707704_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707705_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707699_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707702_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JQ707706_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090612_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090630_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090631_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090632_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090638_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090642_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090643_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090645_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090704_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090709_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090710_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601308_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601334_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097805_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153950_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090711_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX090717_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC012652_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
JX898692_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC774459_LHBs_P-D      -MG--TNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196214_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875296_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196211_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196212_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196210_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875294_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875306_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875308_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196236_LHBs_P-D      -MGQ--NLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875319_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196234_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196217_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KC875323_LHBs_P-D      -MGQ--NLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196225_LHBs_P-D      -MGQ--NLSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196221_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196230_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KX196231_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDANKV
KX196232_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF192831_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
KF192832_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDANKV
KF584164_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KY382412_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF584166_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF679993_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366497_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KT366507_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097859_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779285_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779288_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779318_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779229_LHBs_P-D      -MGVQ-NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779377_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KF779376_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KM108606_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
KM108607_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
KM108604_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601293_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK598673_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEANKV
KP090178_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724218_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724219_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
KU668445_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW601319_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097634_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP255999_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979160_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MF979164_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MG877727_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464832_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464837_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464845_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464853_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH464842_LHBs_P-D      -X-X-XNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MH724223_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MH724225_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MH724227_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MH724229_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MH724230_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MH724248_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MK052958_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052960_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK052975_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153942_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618421_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618423_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MK618443_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MT579902_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097722_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097725_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097727_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097728_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDANKV
MZ097729_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097732_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097733_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097735_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097736_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097714_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MZ097737_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDANKV
MZ097738_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097742_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097746_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097748_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPDANKV
MZ097749_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097753_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097757_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097759_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097760_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097761_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097764_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097768_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097769_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097770_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097774_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDANKV
MZ097778_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097793_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097751_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MW999637_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDANKV
MW999638_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDANKV
MW999639_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDANKV
MW999643_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDANKV
MW999645_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDANKV
MW999651_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDANKV
MZ097846_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153944_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
MZ097831_LHBs_P-D      -MGQ--NLSTTNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDANKV
OK143468_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143473_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143480_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OK143488_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OM721314_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP153962_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
OP154005_LHBs_P-D      -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
X80926_LHBs_P-D        -MGQ--NLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDANKV
                                   * *. * :              ** .. .         

GU456678_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF779382_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
DQ399006_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257186_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB048701_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
AB078031_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB078032_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTFPANPPPASTNRQSGRQPTPL
AB090268_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILTTLPANPPPASTNRQSGRQSTPL
AB090270_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB104709_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB104710_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQPTPL
AB104711_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB104712_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
AB109475_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB109476_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB109478_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMTTLPANPPPASTNRQSGRQPTPL
AB109479_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB116266_LHBs_P-D      GAGAFGLGFTPPHGGLLGTSPQAQGIIETLPANPPPASTNRQSGRQPTPL
AB119251_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB119252_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB119255_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRRSTRQPTPL
AB120308_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB126581_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB188241_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQSLPVNPPPASTNRQSGRQPTPL
AB188242_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMTTLPANPPPASTNRKSGRQPTPL
AB188244_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB205127_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB205128_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB210820_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB222709_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
AB222710_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
AB222711_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB222712_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB222713_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB246347_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB246348_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB270539_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
AB270541_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB270542_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPX
AB270543_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB270546_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB270547_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB270548_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB270550_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB330367_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB330369_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB330370_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB493846_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB554016_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPSASTNRQSGRQPTPL
AB554024_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPSASTNRQSGRQPTPL
AB555496_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB555497_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB555500_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
AB555501_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB583680_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB674405_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB674406_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB674407_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB674408_LHBs_P-D      GAGAFGLGFTPPHGGLLEWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB674411_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB674416_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB674419_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQPTPL
AB674420_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB674422_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB674423_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPTPL
AB674424_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
AB674425_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPP
AB674427_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB674428_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB674431_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
AF043593_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQTGRQPTPL
AF043594_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQTGRQPTPL
AF121239_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
AF121242_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
AF151735_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
AF280817_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AJ131956_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
AJ344116_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AJ627215_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRQSGRQPTPL
AJ627216_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGVXQTLPANPPPASTNRQSGRQPTPL
AJ627218_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGVMQTLPANPPPASTNRQSGRQPTPL
AJ627219_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQSXPANPPPASTNRKSGRQPTPL
AJ627220_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIXQTLPANPPPASTNRQSARQPTPL
AJ627222_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AJ627223_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AJ627224_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
AM422939_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY090452_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGITQTLPANPPPASTNRQSGRQPTPL
AY090453_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AY161150_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY161157_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY233291_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY233292_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPIPL
AY233294_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY233296_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY236160_LHBs_P-D      GAGAFGLGFTQPHGGLLGWSPQVQGMLQTLPANPPPASTNRQSGRQPTPL
AY236162_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
AY661792_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPTSTNRQSGRQPTPL
AY661793_LHBs_P-D      GAGAFGRGFTPPHGGLLGWSPQAQGILQTLPANPPPTSTNRQSGRQPTPL
AY721612_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY741794_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPP
AY741796_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPP
AY741797_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
AY741798_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY796030_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTHRQSGRQPTPL
AY796031_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AY796032_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY945307_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
DQ111986_LHBs_P-D      GAGAFGMGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPP
DQ304547_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
DQ304548_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
DQ304550_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
DQ304551_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
DQ315776_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
DQ329356_LHBs_P-D      GAGAFGLGFTQPHGGLLGWSPQVQGMLQTLPANPPPASTNRQSGRQPTPL
DQ329357_LHBs_P-D      GAGAFGLGFTQPHGGLLGWSPQVQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336674_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336675_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336676_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336678_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336679_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336685_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
DQ336686_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336687_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336688_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336689_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336690_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ336691_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASNKCQSGRQPTPL
DQ336692_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ464168_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
DQ464169_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTRL
DQ464170_LHBs_P-D      GAGAFGLGFTPPHGGLLGWDPQAQGILQTLPANPPPASTNRQSGRQPTPL
DQ464172_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ464173_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ464174_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ464175_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ464176_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASSNRQSGRQPTPL
DQ464177_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ464178_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ464182_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
DQ486021_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
DQ486025_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
EF103275_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EF103276_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPPPL
EF103277_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EF103281_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EU155893_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPVSTNRQSRRQPTPL
EU155895_LHBs_P-D      GAGAFGLGFTPPHGSLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EU414135_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EU414136_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRHSGRQPTPL
EU414138_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU414139_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU414140_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU414141_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGIIQTXPANPPPASTNRQSGRQPTPL
EU414142_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU414143_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
EU594382_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594396_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
EU594398_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
EU594400_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRHSGRQPTPL
EU594401_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594402_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594404_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594405_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594407_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594408_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594409_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594410_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594416_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594419_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594422_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594424_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594425_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594426_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594428_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPANPPPASTNRQSGRQPTPL
EU594433_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594434_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLHTLPANPPPASTNRQSGRQPTPL
EU787437_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
EU787438_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTIPTHPPPASTNRQSGRQPTPL
EU787440_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPHASTNRQSGRQPTPL
EU787441_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
EU787442_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRKSGRQPTPL
EU787443_LHBs_P-D      GVGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EU787446_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPP
EU787447_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
EU919197_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
EU921418_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EU921419_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EU939680_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EU939681_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
FJ349206_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ349209_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ349213_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ349214_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ349215_LHBs_P-D      GAGAFGLGFTPPHGGLLGWRPQAQGILQTLPTNPPPASTNRQPGRQPTTL
FJ349216_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
FJ349218_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAATNRQSGRQPTPL
FJ349219_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
FJ349220_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
FJ349228_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ349229_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ349231_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ349232_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ349233_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
FJ349234_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ349235_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ386590_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
FJ562338_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ692506_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ692532_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ692533_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ899792_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
FJ904395_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ904402_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904410_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ904412_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPSSTNRQSGRQPTPL
FJ904418_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
FJ904419_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ904422_LHBs_P-D      GAGAFGPGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904426_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904427_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904429_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIL-----NPPPASTNRQSGRQPTPL
FJ904431_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904432_LHBs_P-D      GAGAFGPGITPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904433_LHBs_C-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ904435_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ904438_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ904439_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ904445_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GQ167301_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLQANPPPASTNRQTGRQPTPL
GQ167302_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
GQ183448_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183449_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183450_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183456_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183458_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183459_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183460_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183461_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
GQ183465_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183467_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183470_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GQ183471_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GQ183472_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GQ183473_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GQ183474_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GQ183475_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GQ183476_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPTPL
GQ183477_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPTPL
GQ183479_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPTPL
GQ183480_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GQ183481_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPTPL
GQ183482_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPTPL
GQ183485_LHBs_P-D      GAGAFGLGFTPPHGGLFGWNPQAQGILQTLPANPPPASTNRQSGRQPTPL
GQ184322_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPPNPPPASTNRQTGRQPTPL
GQ205380_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
GQ205382_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
GQ205384_LHBs_P-D      GAGAFGLGFTPPHGGHLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
GQ205385_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
GQ205388_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
GQ205389_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
GQ477452_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
GQ477453_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GQ477455_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GQ477456_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPANPPPASTNRQSGRQPTPL
GQ477457_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GQ477458_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPP
GQ477459_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
GQ922000_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GQ922001_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNPQSGRQPTPL
GQ922002_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GQ922003_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTDRQSGRQPTPL
GQ922004_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GQ922005_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GQ924652_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU357846_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456635_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGSLQTLPANPPPASTNRQSGRQPTPL
GU456636_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTMPANPPPASTNRQSGRQPTPL
GU456637_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456639_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456640_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456641_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456643_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456645_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRSGRQPTPL
GU456647_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456649_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQSTPL
GU456650_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456651_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456652_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQPTPL
GU456653_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456654_LHBs_P-D      GAGAFGPGLTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
GU456655_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
GU456656_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSSRQPTPL
GU456657_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456658_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456659_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456661_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456663_LHBs_P-D      GAGAFGPGLTPPHGGLLGWSPQAQGILQTLPANPPPTSTNRQTGRQPTPL
GU456664_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456665_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456666_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456667_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456668_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456669_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456673_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPP
GU456674_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456675_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456677_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQSLPANPPPASTNRQSGRQPTPL
GU456679_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTNPPPASTNRQSGRQPTPL
GU456680_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456681_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456682_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456683_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456684_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HM750151_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPVSTNRQSGRQPTPL
HM750153_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
HM750154_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
HM750155_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HM750156_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ236014_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
HQ236015_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTLPTNPPPASTNRQSGRQPTPL
HQ236016_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTLPTNPPPASTNRQSGRQPTPL
HQ700444_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700445_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700448_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700449_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700453_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700454_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700455_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700458_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAHPPPASTNRQSGRQPTPL
HQ700463_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700472_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700473_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700474_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700478_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700480_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700481_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700483_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700487_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700510_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQTGRQPTPL
HQ700511_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700513_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPHAQGIIQTLPANPPPASTNRQSGRQPTPL
HQ700514_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
HQ700553_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ833465_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGKLQTLPTNPPPASTNRQSGRQPTPL
HQ833467_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
HQ833468_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
HQ833469_LHBs_P-D      GAGAFGXGXTPPHGGLLGWSPQAQGRLQTLPTNPPPASTNRQSGRQPTPL
HQ833470_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
HQ833471_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JF439692_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439696_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439699_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439700_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439703_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439704_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439706_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439708_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439709_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439718_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF754588_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGALQTLPANPPPASTNRQSGRQPTPL
JF754590_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754593_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASANRQSGRQPTPL
JF754594_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754595_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754597_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQNLPANPPPASTNRQSGRQPTPL
JF754599_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754600_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754601_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JF754602_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754603_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754609_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754610_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754611_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASPNRKTSRQPTPL
JF754612_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JF754614_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JF754615_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754617_LHBs_P-D      GAGAFGMGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JF754618_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JF754619_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754623_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754624_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754626_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPATTNRRSGRQPTPL
JF754627_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JF754628_LHBs_P-D      GAGAFGLGFTPPHGGILGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JF754629_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JF754631_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQPRRQPTPQ
JF754632_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754633_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRKPTPL
JF754634_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754635_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040750_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040751_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAHPPPASTNRQSGRQPTPL
JN040753_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTRRQTGRQPTPL
JN040755_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040757_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040758_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040759_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040761_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040762_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040765_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040766_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040767_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040768_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040769_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANSPPASTNRQSGRQPTPL
JN040770_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040771_LHBs_P-D      GAGAFGLGFTPPDGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
JN040773_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040774_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040775_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
JN040777_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
JN040778_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040779_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQPTPL
JN040781_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040782_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040783_LHBs_P-D      GAGAFGLGFTPPHGGLLGGSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040784_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040785_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQNLPENPPPASTNRQSGRQPTPL
JN040786_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040787_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040788_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040790_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040791_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040793_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040795_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040796_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040797_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040799_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040800_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040801_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPATTNRQSGRQPTPL
JN040802_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040805_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040806_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040807_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040808_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040809_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040810_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGREPTPL
JN040811_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040812_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040813_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040814_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040815_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040818_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040819_LHBs_P-D      GAGACGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPP
JN040820_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040821_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQTGRQPTPL
JN040822_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040823_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPP
JN040824_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040826_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040827_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040828_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040830_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257148_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTNPPPASTNRQSGRQPTPL
JN257149_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQXXRQPTPQ
JN257150_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257152_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257153_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPX
JN257159_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
JN257160_LHBs_P-D      GAGAFGXGXTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
JN257162_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257163_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257165_LHBs_P-D      GAGAFGLGFTPPHGGLXGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257169_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257170_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257172_LHBs_P-D      GAGAFGPGXTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN257176_LHBs_P-D      GAGAFGXGXTPPHGGLLGXSPQAQGILXTLPANPPPASTNRQSGRQPTPL
JN257181_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257183_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257188_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGILXTXPTNPPPASTNRQSGRQPTPL
JN257190_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JN257193_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257196_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257199_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257200_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257201_LHBs_P-D      GAGAFGMGFTPPHGGLLGWSPQAQGMLQTLPASPPPASTXRQSGRQPTPL
JN257202_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRSGRQPTPL
JN257203_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257205_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPTSTNRQSGRQPTPL
JN257209_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN604120_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRQSGRQPTPL
JN604139_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTLPANPPPAQTNRQSGRQPTPL
JN604152_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JN604161_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPPSTNRQSGRQPTPL
JN604170_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JN604174_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JN604175_LHBs_P-D      GAGAFGXGXTPPHGGLLGWSPQAQGIIQTLPANPPPAXTNRXXGRQPTPL
JN604189_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN604206_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN604207_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQLGRQPTPL
JN604238_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JN604239_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTNPPPASTNRQSGRQPTPL
JN604250_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN604259_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAKPPPATTTRQSGRQPTPL
JN604263_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN604265_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTNPPPASTNRQSGRQPTPL
JN604272_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JN604275_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JN604278_LHBs_P-D      GAGAFGLGFTPPHGALLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN604301_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JN604312_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN604318_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642126_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642129_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642130_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642131_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN642132_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642133_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQSTPL
JN642134_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642135_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQPTPL
JN642136_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN642138_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN642140_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642142_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642143_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRQSGRQPTPL
JN642144_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAPTNRQSRRQPTPL
JN642145_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642146_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTNQPPASTKRQSGRQPTPL
JN642148_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JN642149_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRSGRQPTPL
JN642150_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
JN642151_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642153_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642154_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642157_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642158_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPP
JN642159_LHBs_P-D      GAGAFGMGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JN642161_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642163_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRKPTPL
JN642164_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642165_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642166_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664909_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664910_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664912_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664913_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664917_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664918_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JN664919_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JN664920_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664921_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664922_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664926_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
JN664927_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664930_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPHAHGIIQTLPANPPPASTNRQSGRQPTPL
JN664931_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTTRQSGRQPTPL
JN664932_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
JN664936_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASANRQSGRQPTPL
JN664937_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664938_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664939_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JN664941_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPTPL
JN688678_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKSGRQPTPL
JN688679_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JN688683_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN688685_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN688695_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN688708_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN688710_LHBs_P-D      GAGAFGLGITPPHGGLLGWSPQAQGILQTLPANPPPASTNRQAGRQPTPL
JN688711_LHBs_P-D      GAGAFGLGXTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN688712_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN688713_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN792903_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN792905_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN792906_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN792908_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN792911_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN792912_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JQ687530_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ687531_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JQ707476_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707480_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSERQPTPL
JQ707483_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707486_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707493_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707497_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707512_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707513_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707515_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPSPASTNRQSGRQPTPL
JQ707524_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707529_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707682_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707683_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707686_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707689_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707690_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707693_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707697_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707703_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ927384_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX036331_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILTTVPAAPPHASTNRQSGRQPTPI
JX090605_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090606_LHBs_P-D      GAGAFGLGFTPPHGGLSGWSPQAQGIIQTLPANPPPASTNRQSRRQPTPL
JX090607_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090608_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090609_LHBs_P-D      GAGACGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTPRQTGRQPTPL
JX090610_LHBs_P-D      GAGSFGMGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090611_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090613_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090615_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPATPPPASTNRQSGRQPTPL
JX090616_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090617_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090618_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090619_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPISTNRQSGRQPTPL
JX090620_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090621_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090622_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090623_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090624_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090625_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JX090626_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090627_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090628_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090629_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090633_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
JX090634_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
JX090635_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANSPPASTNRQSGRQPTPL
JX090636_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQARGILHTVPANPPPASTNRQSGRQPTPV
JX090639_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090640_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090641_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090644_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090646_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090647_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090656_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTRPANPPPASTNRQSGRQPTPL
JX090657_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPATPPPASTNRQSGRQPTPL
JX090658_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090659_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090660_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090662_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090663_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090665_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090666_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090667_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090668_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090670_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQLGRQPTPL
JX090671_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090672_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090673_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090675_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPTPL
JX090676_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090677_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPTPL
JX090678_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090679_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090680_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSRRQPTPL
JX090681_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090682_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQALPANPSPASTNRQSGRQPTPL
JX090683_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090685_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090686_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090687_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090688_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090689_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPTPL
JX090690_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPTPL
JX090693_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090694_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090695_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090696_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090697_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090698_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090700_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090701_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGMMLTLPANPPPASTNRQSGRQPTPL
JX090703_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090705_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090706_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090707_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090708_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090712_LHBs_P-D      GAGAFGQGFTPPHGGLLGWSPQAQGIIHTLPANPPPTSTNRQSGRQPTPL
JX090715_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPTPL
JX090716_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPTPL
JX090719_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090720_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQTGRQPTPL
JX090721_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090723_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090724_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTKRQSGRQPTPL
JX096955_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX310726_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX310727_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTTRQSGRQPTPP
JX310728_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JX310729_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX310733_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX310734_LHBs_P-D      GAGAFGLGITPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX310735_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX470760_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKTGRQPTPL
JX898689_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JX898691_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JX898694_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KC774440_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGLLQTLPENPPPASTNRQSGRQPTPL
KC774444_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC774445_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
KC774462_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KC774477_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPKHPPPASTNRQSGRQPTPL
KC875276_LHBs_P-D      GAGAFGLGFTPRHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPAPL
KC875277_LHBs_P-D      GAGAFGLGFTPPHGGLVGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875278_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875279_LHBs_P-D      GAGAFGLGFTPPHGGRLGWSPQAQGIIQTLRANPPPASTNRQSGRQPTPL
KC875280_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875281_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875282_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875283_LHBs_P-D      GAGAFGLGFAPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875284_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875285_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRESGRQPTPL
KC875286_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875287_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875288_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KC875289_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KC875290_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875291_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875292_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KC875293_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875295_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KC875297_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875298_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875299_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875300_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875301_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875302_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875303_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875304_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875305_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875309_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875310_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILKTLPANPPPASTNRQSGRQSTPL
KC875311_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875313_LHBs_P-D      GAGAFGLGFTPPHGGLLGWGPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875314_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875315_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875316_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875317_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875318_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875320_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875321_LHBs_P-D      GAGPFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875322_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KC875324_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875325_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875326_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875328_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KC875329_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KC875330_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KC875331_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875332_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875333_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KC875334_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIPQTLPANPPPASTNRQSGRQPTPL
KC875335_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875336_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875337_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875340_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
KC875342_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
KF053178_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF061167_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAHPPPASTNRQSGRQPTPL
KF061168_LHBs_P-D      GAGAFGLGFTPPHGGXLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF061169_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAXPPPASTXRQSGRQPTPL
KF061170_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF170755_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF170756_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF170757_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF170760_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF170761_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPPSTNRQSGRQPTPL
KF170763_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF170764_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF170765_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNLQSGRQPTPL
KF170767_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF170768_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSHQAQGILQTVPANPPPASTNRQSGRQPTPL
KF170770_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF170771_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRKPTPL
KF170772_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF170774_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGITQTLPANPPPASTNRQSGRQPTPL
KF170776_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF192830_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
KF192834_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
KF471640_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF471641_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF471642_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF471644_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF471646_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF471647_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF471649_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF471650_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF471654_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF471655_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF471656_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF471657_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF471658_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF471659_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF471660_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF476028_LHBs_P-D      GAGAFGPGFTPPRGGLLGWSPQAQGILHTVPAKPPPASTNRQSGRQPTPL
KF476029_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTVPAKPPPASTNRQSGRQPTPL
KF476030_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF584160_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTXPENPPPASTNRQSGRQPTPL
KF584162_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
KF584163_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGILXTLPENPXPASTNRQSGRQPTPL
KF584165_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGILQTXPENPPPASTNRQSGRQPTPL
KF679989_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANTPPASTNRQSGRQPTPL
KF679990_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF679992_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF679994_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF679997_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF679998_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF779209_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779212_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQTGRQPTPL
KF779214_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF779216_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779217_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779218_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779219_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779220_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF779222_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779225_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779228_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779230_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779289_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779292_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779296_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779301_LHBs_P-D      GAGAFGLGFTPPHVGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779302_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQTGRQPTPL
KF779303_LHBs_P-D      GAGAFGLGFTPPHVGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779340_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGXLQTLPANPPPASTNRQTGRQPTPL
KF779341_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF922432_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPLAQGIMQTLPANPPPASTNRQSGRQPTPL
KJ470889_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGIXXTLPANPPPASTNRQSGRQPTPL
KJ470893_LHBs_P-D      GAGAFGLGFSPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KJ470894_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KJ470895_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KJ470896_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPX
KJ647350_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KJ647352_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KJ647353_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KJ647355_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KJ843187_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KM108591_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
KM108592_LHBs_P-D      GAGAFGLGFTPPHGGLLGWTPQAQGMIQTLPTNPPPASTNRQSGRQPTPL
KM108593_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM108594_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KM108595_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KM108596_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPLASTNRQSGRQPTPL
KM108597_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM108598_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM108599_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM108600_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KM108603_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPSASTNRQTGRQPTPL
KM108605_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM524338_LHBs_P-D      GAGAFGLGFTPPQGGLLGWNPGAQGIIQTLPANPPPASTNRQSGRQPTPL
KM524339_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KM524340_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
KM524341_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQDQGIIQTLPANPPPASTNSQSGRQPTPL
KM524342_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KM524344_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM524345_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
KM524346_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM524347_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM524349_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPTPL
KM524350_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KM524351_LHBs_P-D      GAGAFGLGFTPPHGGLLGRSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM524353_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM524354_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
KM524355_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM524356_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KM524358_LHBs_P-D      GAGAFGPGVIPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM577668_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM577669_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM577670_LHBs_P-D      GAGA----FTPPHGGLLGWSPQAQDILQTLPANPPPASTNRQSGRQPTPL
KM577671_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM606744_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KM606745_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KM606752_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM606754_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM606755_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KP090177_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KP090179_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNPQSGRQPTPL
KP090180_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTKPPPASTNRQSGRQPTPL
KP090181_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTSRQSGRQPTPL
KP168419_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KP995100_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KR139748_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KT151620_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSXQAQGIIQTLPANPPPASTNRQXGRQPTPL
KT347090_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTVPAKPPPASTNRQSGRQPTPL
KT366465_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQSQGIIQTSPANPPPASTNRQSGRHPTPL
KT366491_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KT366494_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KT366496_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRQSGRQPTPL
KT366499_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KT366508_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQNLPANPPPASTNRQSGRQPTPL
KT366510_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KT366511_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KT749821_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KT749827_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGITQTLPANPPPASTNRQSGRQPTPL
KT749828_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KT963508_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668433_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668435_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
KU668436_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668439_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
KU668441_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
KU668442_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KU668444_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668447_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668448_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668449_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KU736924_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KU736926_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGILQSLPTNPPPASTNRQSGRQPTPL
KU736927_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQSLPTNPPPASTNRQSGRQPTPL
KX196208_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KX196209_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196213_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KX196215_LHBs_P-D      GAGAFGLGFTPPHGGLVGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KX196216_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196218_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196219_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196220_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196222_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196224_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KX196226_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196227_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KX196228_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KX196229_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
KX196233_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIPQTLPANPPPASTNRQSGRQPTPL
KX276856_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KX276857_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGMLHTVPANPPPASTNRQSGRQPTPL
KX276998_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPVSTNRQSGRQPTPL
KX276999_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KX357622_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KX357637_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQAGRQPTPL
KX357638_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQAGRQPTPL
KX357639_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGKIQTLPANPPPASTNRQSGRQPTPL
KX827290_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KX827291_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
KX827292_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KY629630_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KY629633_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAYPPPASTNRQSGRQPTPL
L27106_LHBs_P-D        GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
LC519802_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
LC519808_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRRSGRQPTPL
LC519809_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
LC519814_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPTPL
LC519816_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
LT717702_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
LT717703_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
LT992438_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
LT992439_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
LT992444_LHBs_P-D      GVGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
LT992454_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
M32138_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF618343_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF618348_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MF618349_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTTRQSGMQPTPL
MF925363_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MF925364_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MF925366_LHBs_P-D      GVGSFGPGFTPPHGGLLGWSPQAQGILQTVPAAPPPASTNRQSGRQPTPL
MF925379_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MF925383_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
MF925391_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
MF979154_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTTRQSGRQPTPL
MF979155_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979156_LHBs_P-D      GAGAFGLGFTPPHGGLLGXSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979157_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRSGRXPTPL
MF979158_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979161_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979162_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSSQAQGILQTMPANPPPASTNRQSGRQPTPL
MF979163_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979165_LHBs_P-D      GAGAFGLGLTPPHGGLLGXSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979166_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979167_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979168_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTTRRSGRQPTPL
MF979170_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979171_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPM
MF979173_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTTRRSRRQPTPL
MF979174_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979175_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTTRQSGRQPTPL
MF979176_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MG877709_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
MG877718_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MG877719_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MG877720_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MG877726_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MG877728_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464831_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464833_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464834_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPTPL
MH464836_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPTPL
MH464838_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464839_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPTPL
MH464840_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464841_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILXTLPANPPPASTNRQSGRQPTPL
MH464843_LHBs_P-D      GAGAFGLGXTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRXPTPL
MH464844_LHBs_P-D      GAGAFGPGFTPPHGGLLGWNPQAQGMLHTLPANPPPASTNRQSGRQPTPL
MH464847_LHBs_P-D      GAGXFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464848_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464849_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464854_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724216_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
MH724217_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
MH724224_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724226_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724228_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724232_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724233_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIXQTLPANPPPASTNRQSGRQPTPL
MH724235_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724236_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724237_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724238_LHBs_P-D      GAGAFGVGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTKRQSGRQPTPL
MH724241_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MH724242_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724245_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724246_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724247_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MH724249_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724250_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724251_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
MH724252_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH932714_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK052947_LHBs_P-D      GAGAFGLGFTPPHGGLLEWSPQAQGILQTLPTNPPPASTNRQTGRQPTPL
MK052948_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQARGILQTLPTNPPPASASRRPVRQPTPL
MK052949_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPRAQGILQTLPTNPPPASTNRQTGRQPTPL
MK052950_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTTRQSGRQPTPL
MK052951_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPTASTSRRPVRQPTPL
MK052952_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQTGRQPTPL
MK052953_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQTGRQPTPL
MK052954_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPTASTSRRPVRQPTPL
MK052955_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTSPPPASTSRRSGRQPTPL
MK052956_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTSPPPASTSRRSGRQPTPL
MK052959_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTTRQSGRQPTPL
MK052961_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTTRQSGRQPTPL
MK052963_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTSRRPGRQPTPL
MK052966_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTGRRPGRQPTPL
MK052971_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILETLPTNPPPASTSRRPGRQPTPL
MK052972_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQTGRQPTPL
MK052973_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTTRQSGRQPTPL
MK052974_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTSRRSGRQPTPL
MK355500_LHBs_P-D      GAGAFGLGFTPPHGGLLKRSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MK355501_LHBs_P-D      GAGAFGLGFPPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MK507913_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK516278_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK541688_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
MK598636_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK598637_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK598638_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQATPL
MK598639_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK598640_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQALGILQTLPANPPPASTNRQSGRQPTPL
MK598641_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANRPPASTNRQSGRQPTPL
MK598642_LHBs_P-D      GGGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
MK598643_LHBs_P-D      GGGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
MK598644_LHBs_P-D      GGGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
MK598645_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLTTNPHPASTNRQSGRQPTPL
MK598646_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK598647_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK598648_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK598649_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK598650_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILETLPANPPPASTNRQSGRQPTPL
MK598651_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQCIIQTLPANPPPAFINRQSGRQATPL
MK598655_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQCIIQTLPANPPPAFINRQSGRQATPL
MK598657_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQCIIQTLPANPPPAFINRQSGRQATPL
MK598658_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASINRQSGRQPTPL
MK598659_LHBs_P-D      GAGAXGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAAINRQSGRQPTPL
MK598660_LHBs_P-D      GAGAFGVGFTPPHGGLLGWSPQAQGIIQTLQVNPPPASTNRQSGRQPTPL
MK598661_LHBs_P-D      GAGAFGLGFTPSHGGLLGWSPQAQGIIQTLPVNPPPASINRQSGRQPTPL
MK598662_LHBs_P-D      GAGAFGLGFTPSHGGLLGWSPQAQGIIQTLPVNPPPASINRQSGRQPTPL
MK598663_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK598664_LHBs_P-D      GGGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK598665_LHBs_P-D      GAGAFGLGFTPTHGDLLGWSPQAQGIMQTLTANPHPASINRQSGRQPTPL
MK598666_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPACTNRQSGRQPTPL
MK598667_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK598669_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK598670_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAYPPPISTYRQSGRQHTPL
MK598671_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK598672_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK598674_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK598675_LHBs_P-D      GAGAFGLGSTPPHGGLLGWSPQALGIIQTLPANPPPASTNRQSGRQPTPL
MK598676_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTKRQSGRQPTPL
MK598677_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASSNRQSGRQPTPL
MK598678_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPQ
MK598679_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPGASTNRQSGRQPTPL
MK618418_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLAANPAPASTNRQSGRQPTPL
MK618419_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAFTNRQSGRQPTPL
MK618420_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPAPASTNRQSGRQPTPL
MK618422_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK618424_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK618425_LHBs_P-D      GAGAFGLGFTPPHGALLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK618426_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPPNPPPASTNRQSGRQPTPL
MK618427_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK618429_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPSYPPPASTNRQSGRQPTPL
MK618430_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPSYPPPASTNRQSGRQPTPL
MK618431_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKSGRQPTPL
MK618432_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK618433_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK618434_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK618435_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK618436_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
MK618437_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKSGRQPTPL
MK618441_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASANRQSGRQPTPL
MK693107_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK693108_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MK693109_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN310705_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGILXTLPENPXPASTNRQSGRQPTPL
MN310706_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASISRRTGRQPTPL
MN310707_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASISRRTGRQPTPL
MN310708_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN310709_LHBs_P-D      GAGAFGLGFTPPHGGLVGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN310710_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
MN310711_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN310712_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN310713_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN310714_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTXRQSGRQPTPL
MN310715_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPVSTNRQSGRQPTPL
MN507836_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN507837_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MN507838_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQALGILQTLPANPPPASTNRQSGRQPTPL
MN507839_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MN507852_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN585095_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN839643_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MN844881_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPATTNRQSGRQPTPL
MN844882_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT114169_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MT114172_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MT114173_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRTRRQPTPL
MT579898_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MT579899_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRQSGRQPTPL
MT579901_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MT579903_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MT591276_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT591277_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT591279_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT591281_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MT603387_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603388_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTKRQSGRQPTPL
MT603389_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603390_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603391_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTKRQSGRQPTPL
MT603393_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603394_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603395_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603396_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603397_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603398_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603399_LHBs_P-D      GAGAFGLGFTPPHGGLLGWXPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603400_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603404_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGREPTPL
MW082640_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW455166_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
MW601228_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601229_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPVSTNRQSNRQPTPL
MW601231_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601232_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
MW601233_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
MW601234_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
MW601236_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASNNRQSGRQPTPL
MW601237_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601238_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601239_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601242_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
MW601243_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRHPTPL
MW601244_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRHPTPL
MW601245_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601246_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601248_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601249_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
MW601250_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601251_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601252_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGKLQTLPANPPPASTNRQSGRQPTPL
MW601253_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601254_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601255_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPATTNRQSGRQPTPL
MW601256_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601257_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTKRQSGRQPTPL
MW601258_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
MW601259_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIVQTLPANPPPASTNRQSGRQPTPL
MW601262_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPATTNRQSGRQPTPL
MW601263_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601265_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTMPANPPPASTKRQSGRQPTPL
MW601267_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
MW601268_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601269_LHBs_P-D      GAGAFRPGFTPPHGGLLGWSPQAQGIVQTLPANPPPASTNRQLRRQPTPL
MW601271_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601272_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601273_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601275_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601276_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601278_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
MW601279_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601280_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601281_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRRSGRQPTPL
MW601283_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601285_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPTNPPPASTNRQSGRQPTPL
MW601286_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601287_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601288_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601289_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601290_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASANRQSGRQPTPL
MW601291_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
MW601292_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
MW601294_LHBs_P-D      GAGAFGLGFIPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRHPTPL
MW601295_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
MW601297_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQSQGILQTLPANPPPASTNRQSGRQPTPL
MW601298_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601299_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601300_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601302_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601303_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601305_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601306_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601307_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601309_LHBs_P-D      GAGAFGLGFTPPHGGLLGWTPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601311_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601312_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPTPL
MW601314_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601315_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAIPPPASTNRQSGRQPTPL
MW601316_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601318_LHBs_P-D      GAGAFGLGFTPTHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601320_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPAATNRQSGRQPTPL
MW601321_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601323_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601324_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601325_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPVNPPPASTNRQSGRQPTPL
MW601326_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
MW601327_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
MW601328_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMIQSLPANPPPASTNRQSRRQPTPL
MW601329_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601330_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601332_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601333_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPATANRRSGRQPTPL
MW601335_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601336_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601337_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601338_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW601339_LHBs_P-D      GAGAFGLGFTPPHGGLLGWTPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW675897_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
MW675898_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW847931_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTRPTYPPPASTKRQSGRQPTPL
MW999631_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999632_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW999634_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW999635_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999636_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTTRQSGRQPTPL
MW999642_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPV
MW999644_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW999646_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSRRQPTPL
MW999648_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999649_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPTPL
MW999650_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999654_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW999655_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999656_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPP
MW999657_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW999658_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097624_LHBs_P-D      GAGAFGPGLTPPHGGLLGWSPQAQGILHTLPANPPPPTTNRQSGRQPTPL
MZ097625_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097626_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAATNRQSGRQPTPL
MZ097627_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097628_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097630_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097631_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTKRQSGRQPTPP
MZ097632_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTHPPPASTNRQSGRQPTPX
MZ097633_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGIMQTMPANPPPTSTNRQSGRQPTPL
MZ097635_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097636_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097637_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097638_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTMPANPPPASTNRQSGRQPTPL
MZ097639_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097641_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097642_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097643_LHBs_P-D      GAGAFGMGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRSGRQPTPL
MZ097644_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097645_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097646_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097647_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097648_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097650_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTQPPPASTNRQSRRQPTPL
MZ097651_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097653_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097654_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAKPPPASTNRQSGRQPTPL
MZ097655_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAHPPPASTNRQSGRQPTPL
MZ097656_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097657_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTSRQSGRQPTPL
MZ097658_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097659_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097660_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097661_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097662_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097663_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097664_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097665_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPTNPPSASTNRQSGRQPTPL
MZ097668_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097669_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097670_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097672_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILVTLPANPPPASTNRQSGRQPTPL
MZ097673_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097674_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTRPANPPPASTNRQSGRQPTPL
MZ097675_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097676_LHBs_P-D      GAGAFGMGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097677_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097679_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097681_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097682_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097683_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097684_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPTNPPPASTSRQSGRQPTPL
MZ097685_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097686_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097689_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097690_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097692_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097693_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097694_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
MZ097696_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097697_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097698_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097699_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097700_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097701_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097702_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQSQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097704_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAATNRQSGRQPTPL
MZ097705_LHBs_P-D      GAGAFGLGFTPPHGGLLEWSPQAQGMLQTLPTNPPSASTNRQSGRQPTPL
MZ097707_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097709_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097710_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
MZ097711_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097712_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097713_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097715_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097717_LHBs_P-D      GAGAFGLGXTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097718_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPVSTNRQSNRQPTPL
MZ097720_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
MZ097726_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRHPTPL
MZ097730_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097734_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTXRQSGRQPTPL
MZ097743_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097744_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097752_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASANRQSXRQPTPL
MZ097754_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097755_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRRSGRQPTPL
MZ097763_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
MZ097765_LHBs_P-D      GAGAFGLGFIPPHGGLLGWXPQAQGILQTLPTNPPPASTNRQSGRHPTPL
MZ097771_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAXPPPASTNRQSGRQPTPL
MZ097772_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097775_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097776_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097779_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097780_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPAIPPPASTNRQSGRQPTPL
MZ097782_LHBs_P-D      GAGAXGLGFTPXHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097784_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097785_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTMPANPPPASTNRQSGRQPTPL
MZ097787_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097788_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTKRQSGRQPTPL
MZ097789_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQAGRQPTPL
MZ097790_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPVNPPPASTNRQSGRQPTPL
MZ097791_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQXQGILQTLPANPPPASTNRQSRRQPTPL
MZ097794_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMIQSLPANPPPASTNRQSRRQPTPL
MZ097795_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKSGRQPTPL
MZ097797_LHBs_P-D      GAGAFGLGFTXPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097798_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097799_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097800_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097801_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097802_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097803_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSHQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097804_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTTRQSGRQPTPL
MZ097807_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097808_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIXQTLPTNPPPASTNRQSGRQPTPL
MZ097809_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097811_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097812_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097815_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097816_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRSGRQPTPL
MZ097817_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
MZ097818_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097819_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
MZ097820_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097821_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
MZ097823_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097824_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
MZ097825_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097827_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097828_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097829_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRQSKRQPTPL
MZ097830_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097832_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSRRQPTPL
MZ097834_LHBs_P-D      GAGAFGLGVTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097835_LHBs_P-D      GAGAFGVGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097836_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097837_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097839_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097840_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPTPL
MZ097841_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQSLPANPPPASTNRQSGRQPTPL
MZ097842_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097843_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097844_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097845_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097847_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097848_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097849_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097851_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPATTNRQSGRQPTPL
MZ097852_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097853_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAATNRQSGRQPTPL
MZ097855_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPTPL
MZ097856_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097857_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILTTLPANPPPASTNRQSGRQPTPL
MZ097858_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097861_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097863_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097864_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097865_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097866_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097867_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAKPPPASTNRQSGRQPTPL
MZ097868_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097870_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097871_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097872_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097873_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097874_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097875_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097876_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTMPTNPPPASTNRQSRRQPTPL
MZ097877_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTTRQSGRQPTPL
MZ097878_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097879_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097880_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097881_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097882_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097883_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097884_LHBs_P-D      GVGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OK106256_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTVPENPPPASTNRQSGRQPTPL
OK143467_LHBs_P-D      GAGAFGTGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
OK143470_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
OK143472_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
OK143474_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OK143476_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
OK143479_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OK143486_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTVPTNPPPASTNRQSGRQPTPL
OK143489_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OK143490_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OK143496_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OK998519_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OK998520_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPGNPPPASTNRQSGRQPTPL
OK998521_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OK998522_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPACTNRQSGRQPTPL
OK998523_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLTANPHPASINRQSGRQPTPL
OK998524_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OK998525_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQXLPTNPPPASTNRQSXRQPTPL
OK998527_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OM025254_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OM304306_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OM304307_LHBs_P-D      GAGAFGPGFNPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OM304310_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OM304311_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OM304312_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIXQTLPANPPPASTNRQARRQPTPL
OM304313_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OM304314_LHBs_P-D      GAGACGLGFTPPHGGLLGWSPQAQGILQTMPTNPPPASTNRQSNRQPTPL
OM304315_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OM304316_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGITQTLPANPPPASTNRQSGRQPTPL
OM304317_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQNLPANPPPASTNRQSGRQPTPL
OM304318_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OM304322_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPATTNRQSGRQPTPL
OM304323_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OM304324_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OM304325_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OM721310_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OM721311_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OM721312_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
OM721315_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OM721316_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
ON585704_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153940_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153941_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153943_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153945_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153946_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
OP153947_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153951_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQSIIQTLPTNPPPASTNRQSGRQPTPL
OP153952_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
OP153953_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153954_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILHTVPANPPPASANRQSGRQPTPL
OP153955_LHBs_P-D      GAGAFGPGFTPPHGGLLGCSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
OP153956_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153957_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153958_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153959_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153960_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
OP153961_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQCIIQTLPANPPPAFINRQSGRQATPL
OP153964_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTKPPPASTNRQSGRQPTPL
OP153965_LHBs_P-D      GAGAFGLGFTPQNGGLLDWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153966_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153967_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153968_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153969_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153970_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153971_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153973_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
OP153974_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
OP153976_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153977_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153978_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
OP153983_LHBs_P-D      GAGAFGWVFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153985_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
OP153986_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
OP153987_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
OP153988_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAKPPPASTNRQSGRQPTPL
OP153989_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPSSTNRQSGRQPTPL
OP153990_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIXQTLPANPPPSSTNRQSGRQPTPL
OP153991_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153992_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153993_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTMPANPPPASTKRQSGRQPTPL
OP153994_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153996_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
OP153997_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OP153998_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPTPL
OP153999_LHBs_P-D      GAGAFGLGFTPHHGGLLDWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP154000_LHBs_P-D      GAGAFGLGFTPPHGGPLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP154001_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP154002_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP154003_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP154004_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP154006_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP154007_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
OP154008_LHBs_P-D      GAGAFGLGFTPQHGGLLDWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP255998_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP256000_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP256001_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP256002_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP256003_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
OP256004_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGMLLTLPANPPPASTNRQSGRQPTPL
OP256006_LHBs_P-D      EVGAFGLGFTPPHGGLLGXSPQAQGILQTLPANPPPASTTRQSGRQPTPL
OP256007_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP256009_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP256010_LHBs_P-D      GAGAFGLGFTPPHGAFLGWSSQAQGILKPLAANPPPAFTNSQSGRQPTPL
OP256011_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP256012_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPGNPPPASTNRQSGRQPTPL
OP256013_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
OP256014_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP256017_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKTGRQPTPL
OP256018_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPGNPPPASTNRQSGRQPTPL
OP256019_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OR126893_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OR487153_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OR580950_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OR769213_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OR769214_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OR905602_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OR947659_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTSRQSGRQPTPL
OR947660_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OY983050_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OY983051_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OY983063_LHBs_P-D      GAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
X02496_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGILETLPANPPPASTNRQSGRQPTPL
X65258_LHBs_P-D        GAGAFGLGLTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQTGRQPTPL
X80924_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
X97848_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
Z35716_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB078033_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB267090_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AF121240_LHBs_C-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
AF121241_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456660_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
GU456670_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN040792_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JN257151_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
KF170747_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999641_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097671_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097833_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
AB109477_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB110075_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB119254_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB205126_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB210821_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB210822_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB471856_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB471857_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594403_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594413_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594414_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594415_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594421_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875312_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF679996_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KM524352_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KR905424_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KT366495_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KT366506_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KT366509_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KX827301_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
LC488706_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
LC519789_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
LC519793_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MF925358_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MH724231_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MH724244_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MT579900_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW999652_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW999653_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AB119253_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MF925393_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601274_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097750_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
AY721607_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EU594397_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EU787436_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ349230_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904415_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904420_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904421_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904424_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904443_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GQ377589_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700440_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700441_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700442_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700443_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700447_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700450_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700451_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700459_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700464_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700469_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700470_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700471_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700479_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700482_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700484_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700488_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754591_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754592_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754604_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257155_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257171_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257179_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257182_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257185_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642147_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN642167_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090649_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090650_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090651_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090652_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090653_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090654_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF170758_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KP322600_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
LC365689_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK507910_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK507911_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK507914_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601247_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601261_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601282_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW601313_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MW999647_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097666_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097731_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097741_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097756_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097796_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097860_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OM721313_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY721605_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY721606_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY721608_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
FJ904399_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456638_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456646_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GU456648_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HM750152_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754596_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JF754607_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040794_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN040829_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090655_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF471651_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF471652_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KM606753_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KP322599_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX827300_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KY629634_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK618428_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN507851_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097695_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097786_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
Y07587_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KT366498_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KT366500_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KT366501_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KT366502_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AB554023_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPSASTNRQSGRQPTPL
MZ097813_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090684_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097640_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
AY161158_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
AY741795_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPP
JN664911_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN664914_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF170746_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668434_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668437_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668438_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668446_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
LC705462_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF618339_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF618340_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF618341_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OR580949_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
V01460_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
DQ336677_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
GQ183478_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090661_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090674_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724215_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724220_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK507912_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
X65257_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
EU594399_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594418_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594430_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ349205_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ349208_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
HQ700512_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JN604295_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090699_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090713_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090718_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX096957_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF679995_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KP322601_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KR905423_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KU736925_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601301_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097708_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097773_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
X72702_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
X97849_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594427_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594417_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594429_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594431_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594432_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX096958_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601266_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097747_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594420_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
EU594423_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX096956_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP256008_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
FJ692507_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
GQ183451_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183452_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183453_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183454_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183455_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183457_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183462_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183463_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183464_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183466_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183468_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183469_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPTPL
GQ183483_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPTPL
MF618342_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
KF170759_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
KF584161_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
KY382414_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
KM519455_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KR139747_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724214_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724221_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724234_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MN507853_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700446_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
HQ700466_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090702_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX096954_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK598668_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JF439701_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439705_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439710_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JF439711_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF170766_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASANRQSGRQPTPL
JN642156_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN257195_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPX
JN257177_LHBs_P-D      GAGAFGXGXTPPHGGLLGXSPQAQGILXTLPANPPPASTNRQSGRQPTPL
MW999640_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN604313_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
JX898697_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779224_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KM524361_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN792904_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN792907_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN792909_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JN792910_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603392_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603401_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603402_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MT603403_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JQ707478_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707479_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707481_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707482_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707485_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707487_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707488_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707489_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707490_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707494_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707496_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707499_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707500_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707502_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707503_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707505_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707507_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707508_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
JQ707527_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707514_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707516_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707518_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707519_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707520_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707521_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707522_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707523_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707526_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707528_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707530_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707517_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707525_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JQ707684_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707685_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707687_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707688_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707691_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707692_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707694_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707695_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707696_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707698_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707700_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707701_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707704_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707705_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707699_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707702_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JQ707706_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPTPL
JX090612_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
JX090630_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090631_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090632_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090638_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090642_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090643_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090645_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090704_LHBs_P-D      GAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
JX090709_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090710_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601308_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601334_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097805_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OP153950_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
JX090711_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPTPL
JX090717_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPTPL
KC012652_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKTGRQPTPL
JX898692_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KC774459_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196214_LHBs_P-D      GAGAFGLGFTPRHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPAPL
KC875296_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KX196211_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KX196212_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196210_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KC875294_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875306_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875308_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196236_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875319_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196234_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196217_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KC875323_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KX196225_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPTPL
KX196221_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIPQTLPANPPPASTNRQSGRQPTPL
KX196230_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196231_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KX196232_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KF192831_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
KF192832_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPTPL
KF584164_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGILXTLPENPXPASTNRQSGRQPTPL
KY382412_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGILXTLPENPXPASTNRQSGRQPTPL
KF584166_LHBs_P-D      GAGAFGXGFTPPHGGLLGWSPQAQGILQTXPENPPPASTNRQSGRQPTPL
KF679993_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KT366497_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KT366507_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097859_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KF779285_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQTGRQPTPL
KF779288_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779318_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779229_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KF779377_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGXLQTLPANPPPASTNRQTGRQPTPL
KF779376_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPTPL
KM108606_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
KM108607_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
KM108604_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601293_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK598673_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
KP090178_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724218_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724219_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
KU668445_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW601319_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097634_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
OP255999_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MF979160_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MF979164_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MG877727_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464832_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464837_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464845_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464853_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH464842_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724223_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPTPL
MH724225_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724227_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724229_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724230_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MH724248_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MK052958_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTSPPPASTSRRSGRQPTPL
MK052960_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTSPPPASTSRRSGRQPTPL
MK052975_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTTRQSGRQPTPL
OP153942_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASINRQSGRQPTPL
MK618421_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK618423_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MK618443_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASANRQSGRQPTPL
MT579902_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097722_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097725_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
MZ097727_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRHPTPL
MZ097728_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097729_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097732_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097733_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPTPL
MZ097735_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097736_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGKLQTLPANPPPASTNRQSGRQPTPL
MZ097714_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097737_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097738_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097742_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPATTNRQSGRQPTPL
MZ097746_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTMPANPPPASTKRQSGRQPTPL
MZ097748_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097749_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MZ097753_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097757_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097759_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPTNPPPASTNRQSGRQPTPL
MZ097760_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097761_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097764_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
MZ097768_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
MZ097769_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097770_LHBs_P-D      GAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097774_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
MZ097778_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPTPL
MZ097793_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
MZ097751_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
MW999637_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999638_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999639_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999643_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999645_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MW999651_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPTPL
MZ097846_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPTPL
OP153944_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPTPL
MZ097831_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
OK143468_LHBs_P-D      GAGAFGTGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
OK143473_LHBs_P-D      GAGAFGTGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
OK143480_LHBs_P-D      GAGAFGTGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
OK143488_LHBs_P-D      GAGAFGTGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPTPL
OM721314_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPTPL
OP153962_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQCIIQTLPANPPPAFINRQSGRQATPL
OP154005_LHBs_P-D      GAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPTPL
X80926_LHBs_P-D        GAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPTPL
                         *                                               

GU456678_LHBs_P-D      SPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF779382_LHBs_P-D      SPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
DQ399006_LHBs_P-D      TPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
JN257186_LHBs_P-D      SPPLRXTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
AB048701_LHBs_P-D      SPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
AB078031_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB078032_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB090268_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB090270_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRGRGLYFPAGGSSSGTVNPVPTTV
AB104709_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB104710_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB104711_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB104712_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB109475_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB109476_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB109478_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB109479_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB116266_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRSLYFPAGGSSSGTVNPVPTTA
AB119251_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB119252_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB119255_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB120308_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB126581_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB188241_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB188242_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB188244_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB205127_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB205128_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB210820_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGKVNPVPTTA
AB222709_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB222710_LHBs_P-D      SPPLRNTHPQA-QWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB222711_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB222712_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB222713_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB246347_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB246348_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB270539_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB270541_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
AB270542_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTV
AB270543_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB270546_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB270547_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB270548_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB270550_LHBs_P-D      SPPLRDTHPQAMQWNSTTFQQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
AB330367_LHBs_P-D      SPPLRVTHPQAMQWNSTTFHQTLQDSRVRGLYFPAGGSSSGTVNPVPTTV
AB330369_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB330370_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB493846_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB554016_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB554024_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSGSGTVNPVPTTA
AB555496_LHBs_P-D      SPPLRETHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB555497_LHBs_P-D      SPPLRETHPQAMQWKSTNFQQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB555500_LHBs_P-D      SPPLRDTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB555501_LHBs_P-D      SPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AB583680_LHBs_P-D      SPPLRDTHPQAMKWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB674405_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB674406_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTV
AB674407_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTV
AB674408_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB674411_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB674416_LHBs_P-D      TPPLRDTHPQAIQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
AB674419_LHBs_P-D      SPPLRNTHPQAIQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB674420_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTV
AB674422_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB674423_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTV
AB674424_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQNPRVRGLYFPAGGSSSGTVNPVPTTV
AB674425_LHBs_P-D      SPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTANPVPTTV
AB674427_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AB674428_LHBs_P-D      SPPLRDTHPQATQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
AB674431_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVKGLYFPAGGSSSGTVNPVPTTV
AF043593_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVR----PAGGSSSGTVNPVPTTA
AF043594_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AF121239_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AF121242_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AF151735_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AF280817_LHBs_P-D      SPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AJ131956_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
AJ344116_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
AJ627215_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AJ627216_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AJ627218_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AJ627219_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AJ627220_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AJ627222_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AJ627223_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVTPVPTTV
AJ627224_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AM422939_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
AY090452_LHBs_P-D      SPPLRNTHPQAMQWNSTTFQQTLQDPRVKGLFLPAGGSSSGTVNPVPTTA
AY090453_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AY161150_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AY161157_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AY233291_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AY233292_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AY233294_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AY233296_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AY236160_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
AY236162_LHBs_P-D      SPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
AY661792_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AY661793_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AY721612_LHBs_P-D      SPPLRNTHPQAMQWNSTTYHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AY741794_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AY741796_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AY741797_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AY741798_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
AY796030_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AY796031_LHBs_P-D      SPPLRDTHPQAMQWNTTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
AY796032_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
AY945307_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
DQ111986_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
DQ304547_LHBs_P-D      SPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
DQ304548_LHBs_P-D      SPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
DQ304550_LHBs_P-D      SPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSRTVNPVPTTV
DQ304551_LHBs_P-D      SPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSRTVNPVPTTV
DQ315776_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
DQ329356_LHBs_P-D      SQPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
DQ329357_LHBs_P-D      SQPLRNTHPQAMQWNSSTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ336674_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ336675_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ336676_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ336678_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ336679_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ336685_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTA
DQ336686_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ336687_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ336688_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ336689_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSETANPVPTTA
DQ336690_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTA
DQ336691_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTA
DQ336692_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ464168_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSEQVNPVLTTA
DQ464169_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
DQ464170_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
DQ464172_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ464173_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
DQ464174_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
DQ464175_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTA
DQ464176_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTA
DQ464177_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTA
DQ464178_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTA
DQ464182_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGFSSGTVNPVPTTA
DQ486021_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPTTA
DQ486025_LHBs_P-D      SPPLRNTHPQAVQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTA
EF103275_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EF103276_LHBs_P-D      SPPLRNTHPQAMQWNPTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EF103277_LHBs_P-D      SPPLRNTHPQAMQWNSPNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EF103281_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRGEGLYFPAGGSSSGTVNPVPTTV
EU155893_LHBs_P-D      SPPLRNTHPQAMQWNSKTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU155895_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHHTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU414135_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQBPXVRGLYFPAGGSSSGTVNPVPTTV
EU414136_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
EU414138_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU414139_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU414140_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU414141_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU414142_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU414143_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594382_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594396_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
EU594398_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTA
EU594400_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594401_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594402_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSRTVNPVPTTA
EU594404_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594405_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594407_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594408_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTA
EU594409_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594410_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594416_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594419_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594422_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594424_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594425_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594426_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594428_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594433_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU594434_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTA
EU787437_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
EU787438_LHBs_P-D      SPPLRNTHPQA-QWNSTTFHQTLQDPRVRGLTFPAGGSSSGTVNPVPTTV
EU787440_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
EU787441_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
EU787442_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
EU787443_LHBs_P-D      SPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
EU787446_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
EU787447_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
EU919197_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
EU921418_LHBs_P-D      TPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU921419_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU939680_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
EU939681_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPTTV
FJ349206_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
FJ349209_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ349213_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ349214_LHBs_P-D      SPPLRNTHPHAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
FJ349215_LHBs_P-D      SPPLRNTHHQAMKWNSTTFHQTLQDPRVKGLNLPAGGSSSGTGNPVPTTV
FJ349216_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ349218_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ349219_LHBs_P-D      SPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ349220_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ349228_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ349229_LHBs_P-D      SPPLRNPHPGAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ349231_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ349232_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ349233_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ349234_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ349235_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
FJ386590_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ562338_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
FJ692506_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ692532_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ692533_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ899792_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPTTV
FJ904395_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTINPVPTTA
FJ904402_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSXTANPVPTTV
FJ904410_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTA
FJ904412_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ904418_LHBs_P-D      TPPLRNTHPQAMQWNSTPFHQTLQDPKVSDLYFPAGGSSSGTVNPVPTTV
FJ904419_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ904422_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ904426_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ904427_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ904429_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ904431_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ904432_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ904433_LHBs_C-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ904435_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
FJ904438_LHBs_P-D      SPPIRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ904439_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
FJ904445_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GQ167301_LHBs_P-D      SPPLRDTHPQAAQWNSTTFQQTLQDPRVRGLNLPAGGSSSGTVNPVPTTV
GQ167302_LHBs_P-D      SPPLRDTHPQAVQWNSTTFQQTLQDPRVRGLNLPAGGSSSGTVNPVPTTV
GQ183448_LHBs_P-D      SPPLRNTHPQAMQWNSTIFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GQ183449_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GQ183450_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GQ183456_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GQ183458_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GQ183459_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GQ183460_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GQ183461_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GQ183465_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GQ183467_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GQ183470_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GQ183471_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ183472_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ183473_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ183474_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ183475_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ183476_LHBs_P-D      SPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ183477_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ183479_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ183480_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GQ183481_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ183482_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ183485_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ184322_LHBs_P-D      SPPLRDTHPQAVQWNSTTFQQTLQDSRVRGLNLPAGGSSSGTVNPVPTTV
GQ205380_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GQ205382_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTA
GQ205384_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTPA
GQ205385_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTA
GQ205388_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTA
GQ205389_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTA
GQ477452_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ477453_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ477455_LHBs_P-D      TPPLGDTHPLA-QWKSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
GQ477456_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ477457_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ477458_LHBs_P-D      TLPLRHTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GQ477459_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GQ922000_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ922001_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVSTTA
GQ922002_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ922003_LHBs_P-D      SPPLRVTYPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ922004_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAVXXXXXXXNPVPTTA
GQ922005_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
GQ924652_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
GU357846_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456635_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKSLYLPAGGSSSGTVTPVPTTA
GU456636_LHBs_P-D      SPPLRDTHPQAMQWNTTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPTTV
GU456637_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTV
GU456639_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456640_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
GU456641_LHBs_P-D      SPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456643_LHBs_P-D      TPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456645_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456647_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
GU456649_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456650_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456651_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456652_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456653_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTV
GU456654_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTV
GU456655_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTV
GU456656_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456657_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456658_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456659_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456661_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTV
GU456663_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456664_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456665_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456666_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456667_LHBs_P-D      SPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456668_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456669_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456673_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456674_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456675_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456677_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456679_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456680_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456681_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456682_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHRTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456683_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
GU456684_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HM750151_LHBs_P-D      SPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
HM750153_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTV
HM750154_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HM750155_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HM750156_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTPQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ236014_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
HQ236015_LHBs_P-D      SPPLRNTHPQAMQWNSTTIHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
HQ236016_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTA
HQ700444_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700445_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSNSGTVNPVPTTV
HQ700448_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700449_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTXNPVPTTX
HQ700453_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700454_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700455_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700458_LHBs_P-D      SPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
HQ700463_LHBs_P-D      SPPLRNTHPQAMQWNATTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
HQ700472_LHBs_P-D      SPPLRNTHPQAMQWNSTTFRQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
HQ700473_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700474_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700478_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700480_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700481_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
HQ700483_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700487_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ700510_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
HQ700511_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
HQ700513_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
HQ700514_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
HQ700553_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ833465_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ833467_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ833468_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTV
HQ833469_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
HQ833470_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
HQ833471_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF439692_LHBs_P-D      SPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JF439696_LHBs_P-D      SPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JF439699_LHBs_P-D      SPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JF439700_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JF439703_LHBs_P-D      SPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTAA
JF439704_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JF439706_LHBs_P-D      SSPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JF439708_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JF439709_LHBs_P-D      SPPLRSTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JF439718_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JF754588_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754590_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754593_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754594_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTV
JF754595_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754597_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
JF754599_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
JF754600_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754601_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754602_LHBs_P-D      SPPLRNTHPQAIQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754603_LHBs_P-D      SPPLRNTHPQALQWNSTTFHNTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754609_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754610_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPGVRGLHHTAGGSSSGTVNPVPTTV
JF754611_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754612_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754614_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVXGLYSPAGGSSSGTVNPVPTTV
JF754615_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTV
JF754617_LHBs_P-D      SPPLRDTHPQAMQWNTINFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754618_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754619_LHBs_P-D      TPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754623_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNLPAGGSSSGTVNPVPTTV
JF754624_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754626_LHBs_P-D      SPPLRDTHPQAIQWNSRNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754627_LHBs_P-D      SPPLRNTHPQAMYWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754628_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754629_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754631_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754632_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754633_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
JF754634_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JF754635_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040750_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLHAGGSSSETVNPVPTTV
JN040751_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
JN040753_LHBs_P-D      TPPLRDTHPQAMQWNSTTFHQTLQNPRVKGLYIPAGGSSSGTVNPVPTTV
JN040755_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040757_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040758_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTV
JN040759_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040761_LHBs_P-D      SPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040762_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTV
JN040765_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040766_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
JN040767_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040768_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040769_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
JN040770_LHBs_P-D      SPPLRNTHPQAMQWNFTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040771_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTV
JN040773_LHBs_P-D      SPPLRNTHPQAMQWNSATFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040774_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040775_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPNTV
JN040777_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
JN040778_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPGVRGLYFPAGGSSSGTVNPVPTTV
JN040779_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVTGLYFPAGGSSSGTVNPVPTTV
JN040781_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN040782_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPTTV
JN040783_LHBs_P-D      SPPLRNTHPQAMQWNTTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040784_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040785_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040786_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040787_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTV
JN040788_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040790_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
JN040791_LHBs_P-D      SPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040793_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTV
JN040795_LHBs_P-D      SPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040796_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040797_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
JN040799_LHBs_P-D      SPPLRDTHPQAMQWNSKTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040800_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040801_LHBs_P-D      TPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTV
JN040802_LHBs_P-D      SPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040805_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTIV
JN040806_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040807_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040808_LHBs_P-D      SPPLRNTHPQAMQWNSATFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040809_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLHFPAGGSSSGTVNPVPTTV
JN040810_LHBs_P-D      TPPLRDTHPQSMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040811_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040812_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
JN040813_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040814_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040815_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040818_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040819_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040820_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
JN040821_LHBs_P-D      SPPLRNTHPQAMQWNTTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
JN040822_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPVGGSSSGTVNPVPTTV
JN040823_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040824_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
JN040826_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040827_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTTV
JN040828_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN040830_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN257148_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN257149_LHBs_P-D      SPPLRBTHPQAMQWNSTTFHQTLQDPRVXGLYFPAGGSSSGTVNPVPTTV
JN257150_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVXGLXFPAGGSSSGTVNPVPTTV
JN257152_LHBs_P-D      SPPLRNTHPQAMQWSSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN257153_LHBs_P-D      TPPLRDTHPQA-QWXXXXFHQTLQDPRVXGLYXPAGGSSSGTVNPVPTTX
JN257159_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTV
JN257160_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQBPXVRGLYFPAGGSSSGTVNPVPTTV
JN257162_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN257163_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN257165_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVQTTV
JN257169_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTV
JN257170_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
JN257172_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTV
JN257176_LHBs_P-D      SPPLRBTHPQAMQWNXTTFHQTLQDPRVRGLXFPAGGSSSGTVNPVPTTV
JN257181_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN257183_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYXPAGGSSSGTVNPVPTTV
JN257188_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPTTV
JN257190_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN257193_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN257196_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN257199_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTIV
JN257200_LHBs_P-D      SPPLRNTHPQAMQWNSTTFQQTLQDPRVRGLYSPAGGSSSGTVNPVPTTV
JN257201_LHBs_P-D      SPPLRDTHPQAMQWGSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
JN257202_LHBs_P-D      SPPLRETHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
JN257203_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN257205_LHBs_P-D      TPPLRNTHPQAMQWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
JN257209_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN604120_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN604139_LHBs_P-D      SPPLRDSHPQAVQWNSTTFHQTLQNPRVKGLHPPAGGSSSGTVNPVPTTA
JN604152_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTXNPVPTTA
JN604161_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN604170_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JN604174_LHBs_P-D      SPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN604175_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRXLYXPAGGSSSGTVNPVPTTA
JN604189_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN604206_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN604207_LHBs_P-D      SPPLRSTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN604238_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN604239_LHBs_P-D      XPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSXTVNPVPTTV
JN604250_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
JN604259_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN604263_LHBs_P-D      SPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDPVPTTV
JN604265_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN604272_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JN604275_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JN604278_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN604301_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JN604312_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN604318_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
JN642126_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTV
JN642129_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642130_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642131_LHBs_P-D      SPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDPVPTTV
JN642132_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642133_LHBs_P-D      SPPLRNTHPQAVQWNSTAFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
JN642134_LHBs_P-D      SPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642135_LHBs_P-D      TPPLRITHPHTMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642136_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642138_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
JN642140_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642142_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642143_LHBs_P-D      SPPLRETHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN642144_LHBs_P-D      SPPLRNTHPLAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN642145_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
JN642146_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVPTTV
JN642148_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN642149_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTV
JN642150_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPAPTTV
JN642151_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642153_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642154_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642157_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642158_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642159_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN642161_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642163_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN642164_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQPLQDPKVSDQYFPAGGSSSGTVNPVPTTV
JN642165_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN642166_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JN664909_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
JN664910_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN664912_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN664913_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
JN664917_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQAPADPRVRGLYFPAGGSSSGTVNPVLTTA
JN664918_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN664919_LHBs_P-D      SPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN664920_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
JN664921_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN664922_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTA
JN664926_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYLPAGGSTSGTVNPVPTTA
JN664927_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN664930_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN664931_LHBs_P-D      SPPLRITHPQAIQWNSTTFQQSLQDPKVRGLYFPAGGSSSGTVNPVPTTV
JN664932_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN664936_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
JN664937_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
JN664938_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVLTTA
JN664939_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
JN664941_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTPNPVPTTA
JN688678_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN688679_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN688683_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN688685_LHBs_P-D      TPPLRDTHPQA-QWTSSTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
JN688695_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
JN688708_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN688710_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
JN688711_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRLIGLDVSAGGSSSGTVNPVPTTA
JN688712_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN688713_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN792903_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN792905_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN792906_LHBs_P-D      SPPLRNTYPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN792908_LHBs_P-D      SPPLRNTYPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN792911_LHBs_P-D      SPPLRITHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JN792912_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ687530_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSRTVNPVPTTA
JQ687531_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JQ707476_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707480_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707483_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707486_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707493_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707497_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707512_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707513_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707515_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707524_LHBs_P-D      SPPLRNTHPQAMEWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707529_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JQ707682_LHBs_P-D      SPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTA
JQ707683_LHBs_P-D      SPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTA
JQ707686_LHBs_P-D      SPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTA
JQ707689_LHBs_P-D      SPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTA
JQ707690_LHBs_P-D      SPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGFSSGTVNPVPTTA
JQ707693_LHBs_P-D      SPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTA
JQ707697_LHBs_P-D      SPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTA
JQ707703_LHBs_P-D      SPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPTTA
JQ927384_LHBs_P-D      SPPLRDTHPQAIXWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
JX036331_LHBs_P-D      SPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090605_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090606_LHBs_P-D      SQPLRNTHPQAMKWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090607_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTA
JX090608_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTA
JX090609_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTV
JX090610_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090611_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090613_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090615_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVQTTA
JX090616_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090617_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090618_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090619_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090620_LHBs_P-D      SPPLRNTHPQAMQWNSTTFRQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090621_LHBs_P-D      SPPLRBTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090622_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090623_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090624_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090625_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090626_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090627_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090628_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090629_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090633_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPTTV
JX090634_LHBs_P-D      SPPLRNTHPQAMQWNSTTFQQTLQDPRVRGLYFPAGGSSTGTVNPVPTTV
JX090635_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPTTV
JX090636_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPTTV
JX090639_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090640_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTV
JX090641_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTV
JX090644_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090646_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090647_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090656_LHBs_P-D      TPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090657_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090658_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090659_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
JX090660_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090662_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090663_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090665_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090666_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090667_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090668_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090670_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090671_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090672_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090673_LHBs_P-D      TPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090675_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090676_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTTV
JX090677_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090678_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090679_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090680_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090681_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090682_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090683_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090685_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090686_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090687_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090688_LHBs_P-D      SPPLRDTHPQVAQWNFTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090689_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090690_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090693_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTG
JX090694_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090695_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090696_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090697_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090698_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090700_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPTTA
JX090701_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
JX090703_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090705_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090706_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090707_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
JX090708_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090712_LHBs_P-D      SPPLRITHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090715_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090716_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090719_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090720_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX090721_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX090723_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGIVNPVPTTV
JX090724_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTV
JX096955_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX310726_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPITA
JX310727_LHBs_P-D      SPPLRNTHPQAIQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTA
JX310728_LHBs_P-D      SPLLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
JX310729_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSLGTVNPVPTTA
JX310733_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX310734_LHBs_P-D      SPPLRNTHPQAMQWN-TTFRQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
JX310735_LHBs_P-D      SPPLRNTHPQAMQWNSTTFRKTLQDPRVRGLYFPAGGFSSGTVNPVPTTV
JX470760_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JX898689_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JX898691_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
JX898694_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
KC774440_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC774444_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC774445_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC774462_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC774477_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875276_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875277_LHBs_P-D      SPPLRNTHPQAMQLNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTV
KC875278_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875279_LHBs_P-D      SPPLRNTHPQTMQWNSTTFRQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875280_LHBs_P-D      SPPLRNTHPQAMQWNSTTCHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875281_LHBs_P-D      SPPLRNTHPQAMQWNSTTLHQTLQDPRVRALYFPAGGSSSGTVNPVPTTV
KC875282_LHBs_P-D      SPPLRNTHPHAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875283_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875284_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDRRVRGLYFPAGGSSSGTVNPVPTTV
KC875285_LHBs_P-D      SPPLRKTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875286_LHBs_P-D      SPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875287_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSTSGTVNPVPTTV
KC875288_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875289_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
KC875290_LHBs_P-D      SPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875291_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
KC875292_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875293_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875295_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875297_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875298_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLY-PAGGSSSGTVNPVPTTV
KC875299_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
KC875300_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875301_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875302_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
KC875303_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTV
KC875304_LHBs_P-D      TPPLRNTHPQTMQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTV
KC875305_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875309_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875310_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTA
KC875311_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSTSGTVNPVPTTA
KC875313_LHBs_P-D      SPPLRNTHPQAMLWNSTTFHRTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875314_LHBs_P-D      SPPLRNTHPQGMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875315_LHBs_P-D      SPPLRITHPQAMQWNSRTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875316_LHBs_P-D      SPPLRYTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875317_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875318_LHBs_P-D      TPPLRNTHPEAMQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTV
KC875320_LHBs_P-D      SPPLRNSHPQAMQWNSTTFHQTLQDRRVRGLYFPAGGSSSGTVNPVPTTV
KC875321_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875322_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
KC875324_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHHTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875325_LHBs_P-D      SPLLRNTHPQAMQWNSTTLHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
KC875326_LHBs_P-D      SPPLRNTDPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSTSGTVNPVPTTV
KC875328_LHBs_P-D      SPPLRNTHSQAMQWNSTTFHQTLQDSRVRGLYFPAGGSSSGTVNPVPTTV
KC875329_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875330_LHBs_P-D      SPPLRNTHPQGMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875331_LHBs_P-D      SPPLRNTLPQPMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875332_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875333_LHBs_P-D      TPPLRNTHPHAMQWNSTTFHQTLQDPRVRGLYFPAGRSSSGTVNPVPTTV
KC875334_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLRDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875335_LHBs_P-D      SPPLRNTPPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875336_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875337_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KC875340_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTA
KC875342_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQGLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF053178_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTA
KF061167_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDRVPTTV
KF061168_LHBs_P-D      SPPLRXTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDRVPTTV
KF061169_LHBs_P-D      SPPLRXTHPQAMQWXXTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTV
KF061170_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF170755_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF170756_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDHRVRGLYFPAGGSSSGTVNPVPTTV
KF170757_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF170760_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
KF170761_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF170763_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF170764_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF170765_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF170767_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
KF170768_LHBs_P-D      TPPLRNTHPQAIQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
KF170770_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
KF170771_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYSLAGGSSSGTVNPVPTTV
KF170772_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPTTV
KF170774_LHBs_P-D      SPPLRNTHPQAIQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
KF170776_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTV
KF192830_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF192834_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF471640_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVKDLYFPAGGSSSGTVNPVPTTV
KF471641_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQNLQDPRVKGLYFPAGGSSSGTVNPVPTTV
KF471642_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
KF471644_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF471646_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF471647_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF471649_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF471650_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTV
KF471654_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTV
KF471655_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF471656_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGPVNPVPTTV
KF471657_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
KF471658_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF471659_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTV
KF471660_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF476028_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF476029_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF476030_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTA
KF584160_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF584162_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF584163_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF584165_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KF679989_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF679990_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF679992_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF679994_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF679997_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF679998_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779209_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779212_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779214_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779216_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779217_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
KF779218_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
KF779219_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779220_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779222_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779225_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
KF779228_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
KF779230_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779289_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
KF779292_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779296_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779301_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGAVNPVPTTA
KF779302_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGAVNPVPTTA
KF779303_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779340_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KF779341_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
KF922432_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KJ470889_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KJ470893_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KJ470894_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KJ470895_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLXFPAGGSSSGTVNPVPTTV
KJ470896_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KJ647350_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KJ647352_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KJ647353_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KJ647355_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYQPAGGSSSGTVNPVPTTA
KJ843187_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
KM108591_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KM108592_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM108593_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM108594_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KM108595_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KM108596_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KM108597_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTA
KM108598_LHBs_P-D      SPPLRNTHPQAMQWNSTTIHQTLQDPRVRGLFFPAGGSSSGTVNPVPTTA
KM108599_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLSFPAGGSSSGTVNPVPTTA
KM108600_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVKPVPTTV
KM108603_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTV
KM108605_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM524338_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KM524339_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KM524340_LHBs_P-D      SPPLRDTHP-GLRWTSKTFHQALQDPRVRGLYLPAGGSTSGTVNPVPTTA
KM524341_LHBs_P-D      SPPSRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPTTA
KM524342_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KM524344_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM524345_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTA
KM524346_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM524347_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTSA
KM524349_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVLTTA
KM524350_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
KM524351_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM524353_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM524354_LHBs_P-D      SPPLRKTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM524355_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM524356_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM524358_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM577668_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM577669_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM577670_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVTPVPTTA
KM577671_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM606744_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM606745_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM606752_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM606754_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KM606755_LHBs_P-D      SPPLRNTHPHAMQWNSTTFPQTLQDPRVRGLYVPAGGSSSGTVNPVPTTA
KP090177_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPITA
KP090179_LHBs_P-D      SPPLRNTHPQDMGRNSTTFHQTLQDPRVRGLYFRVGGSSSGTVNPVPTTA
KP090180_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KP090181_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KP168419_LHBs_P-D      SPPLRDTHPQAIQWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
KP995100_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
KR139748_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KT151620_LHBs_P-D      SPPLRNTHPQAMQWXXTTFHQTLQDPRVRGLSFPAGGSSSGAVNPVPTTA
KT347090_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KT366465_LHBs_P-D      SPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KT366491_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KT366494_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KT366496_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KT366499_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KT366508_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KT366510_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KT366511_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KT749821_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
KT749827_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTANPVPTTA
KT749828_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KT963508_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KU668433_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
KU668435_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
KU668436_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDLRVRGLYFPAGGSSSGTVNPVLTTA
KU668439_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
KU668441_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KU668442_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
KU668444_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KU668447_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTA
KU668448_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTA
KU668449_LHBs_P-D      SPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KU736924_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KU736926_LHBs_P-D      SPPLRBTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KU736927_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KX196208_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KX196209_LHBs_P-D      SPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KX196213_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
KX196215_LHBs_P-D      SPPLRNTHPQAMQLNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTV
KX196216_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KX196218_LHBs_P-D      SPPLRNTPPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KX196219_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPTTV
KX196220_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSRTVNPVPTTV
KX196222_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KX196224_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTV
KX196226_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KX196227_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KX196228_LHBs_P-D      TPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KX196229_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQGLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KX196233_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLRDPRVRGLYFPAGGSSSGTVNPVPTTV
KX276856_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KX276857_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTA
KX276998_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KX276999_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KX357622_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTA
KX357637_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KX357638_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KX357639_LHBs_P-D      SPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KX827290_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
KX827291_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KX827292_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPTTA
KY629630_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
KY629633_LHBs_P-D      XPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
L27106_LHBs_P-D        TPPLRDTHPQAMHWNYTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
LC519802_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQALQDPKVRGLYLPAGGSTSGTVNPVPTTA
LC519808_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
LC519809_LHBs_P-D      SPPLRDTHPQA-QWNSRTFHQTLQDPRVR----PAGGSSSGTVNPVPTTV
LC519814_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVTGLYFPAGGSSSGTVNPVPTTA
LC519816_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
LT717702_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
LT717703_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGXVNPVPTTA
LT992438_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
LT992439_LHBs_P-D      SPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTA
LT992444_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
LT992454_LHBs_P-D      SPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
M32138_LHBs_P-D        SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTV
MF618343_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTA
MF618348_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF618349_LHBs_P-D      PPPLRITLPQAMQWNSTAFHQVLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF925363_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF925364_LHBs_P-D      SPPLRNTHPQAMQWNSATFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF925366_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF925379_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF925383_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF925391_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVSGLNFPAGGSSSGTVNPVPTTV
MF979154_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979155_LHBs_P-D      SPPLRNTHPQAMQWNFATFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
MF979156_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979157_LHBs_P-D      XPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979158_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979161_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979162_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979163_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVPTTA
MF979165_LHBs_P-D      TPPLRNTHPQALQWNYANFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
MF979166_LHBs_P-D      SPPLRDTHPQAMQWNSATFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
MF979167_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979168_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979170_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979171_LHBs_P-D      SPPLR--DPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979173_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979174_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTA
MF979175_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MF979176_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSVTVNPVPTTA
MG877709_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
MG877718_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
MG877719_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
MG877720_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTA
MG877726_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MG877728_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464831_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464833_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNHVPTTA
MH464834_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464836_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464838_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464839_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464840_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464841_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464843_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYHPAGGSSSGTVNPVPTTA
MH464844_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYPPAGGSSSGTVNPVPTTA
MH464847_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464848_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464849_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH464854_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724216_LHBs_P-D      SPPLRBTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
MH724217_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MH724224_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724226_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724228_LHBs_P-D      SPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724232_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVTGLYFPAGGSSSGTVNPVPTTA
MH724233_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724235_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724236_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724237_LHBs_P-D      SPPLRDTHPQAMQWSSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724238_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724241_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724242_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724245_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724246_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724247_LHBs_P-D      SPPLRXTHPQAMQWNSTTFHQTMQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724249_LHBs_P-D      SPPLRXTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724250_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MH724251_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTA
MH724252_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MH932714_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTA
MK052947_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052948_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052949_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052950_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052951_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLHFPAGGSSSGTVNPVPTTA
MK052952_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052953_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPTTA
MK052954_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052955_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052956_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052959_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052961_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052963_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052966_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052971_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052972_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052973_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK052974_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK355500_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK355501_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPVGGSSSGTVNPVPTTV
MK507913_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK516278_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNLVPTTA
MK541688_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598636_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPSTV
MK598637_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK598638_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK598639_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK598640_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK598641_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK598642_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK598643_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK598644_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK598645_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPTTV
MK598646_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPTTV
MK598647_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPTTV
MK598648_LHBs_P-D      SPPLRNSHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPTTV
MK598649_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSATVNPVPTTV
MK598650_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPTTV
MK598651_LHBs_P-D      SPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598655_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598657_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598658_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598659_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598660_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPTTV
MK598661_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598662_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598663_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTV
MK598664_LHBs_P-D      SPPLRDTHPHAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598665_LHBs_P-D      SPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598666_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDHRVRGLYFPAGGSSSGTVNPVPTTA
MK598667_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTA
MK598669_LHBs_P-D      SPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVN