HBVdb

Dataset for protein LHBs of genotype D

[Download (right click)] [Edit] [Sequences] [Repertoires]

1434 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JN257186_LHBs_P-D      GMGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779382_LHBs_P-D      MGETD----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
KF779228_LHBs_P-D      MGVQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779229_LHBs_P-D      MGVQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779230_LHBs_P-D      MGVQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ477455_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB222710_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU787438_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDAN
JX310734_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524340_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDPWPDAN
KC875298_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257153_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257195_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN688685_LHBs_P-D      -MGQN----LSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDNWPDAN
DQ399006_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU155895_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ184322_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ167301_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ167302_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY236162_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ304547_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ304551_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ304548_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ304550_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX470760_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC012652_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ329356_LHBs_P-D      -MGQN----LSTSNPLGFLPDHQLDPAFRANTGNPDWDFNPNKDTWQDAN
DQ329357_LHBs_P-D      -MGQN----LSTSNPLGFLPDHQLDPAFRANTGNPDWDFNPNKDTWQDAN
DQ336690_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY236160_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336691_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336678_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336679_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336675_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336676_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336677_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336674_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ486021_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ464178_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTAIPDWDFNPNKDTWPDAN
DQ464176_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ464175_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336688_LHBs_P-D      -MGQN----LSTSNPLGFFPDYQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336687_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQSDPAFRANTANPDWDFNPNKDTWPDAN
DQ336686_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336692_LHBs_P-D      -MGQN----LSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336689_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ464172_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ464173_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ464174_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ464177_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ336685_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB205128_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTAHPDWDFNPNKDTWPDAN
AB119255_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ464168_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRAATANPDWDFNPNKDTWPDAN
MK618436_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618434_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618435_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598651_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNRDALPDAN
MK598655_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNRDALPDAN
MK598657_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNRDALPDAN
AY796031_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
AB116266_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPIKDTWPDAK
DQ464170_LHBs_P-D      -MGQN----LSTSNPLGFFPHHQLDPAFRSNTANPDWDFNPNKNTWPDAN
AB188242_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
JQ927384_LHBs_P-D      -MGQN----LSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP168419_LHBs_P-D      -MGQN----LSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ464182_LHBs_P-D      -MGRN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDAN
AB090269_LHBs_P-D      -MGQNMEKNLSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB078032_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAAN
AB078031_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAAN
AB078033_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAAN
AB267090_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPAAN
AB090268_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDGN
AB120308_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY233292_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY233294_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AJ627215_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AJ627216_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AJ627218_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AM422939_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY233296_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AJ627220_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB210820_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB205127_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AJ627222_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB188241_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU414138_LHBs_P-D      -MGXN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU414139_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB330369_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB493846_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY233291_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ315776_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB330370_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB109478_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
JN642144_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB119251_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB119252_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB119253_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598665_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664928_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724238_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX276856_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF925393_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF925383_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604175_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664918_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB109476_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB109477_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB109479_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB110075_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB119254_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB205126_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB210821_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB210822_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB471856_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB471857_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB109475_LHBs_P-D      -MGQN----LSTSNPMGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX310727_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDAN
EU155893_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANQDWDFNPNKDTWPDAN
AB270550_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
X65258_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPASRANTANPDWDFNPNKDTWPDAN
AY090452_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
AB674424_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052954_LHBs_P-D      -MGQN----LSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642154_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604139_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674425_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDAN
AB674416_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDAN
MF979165_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB555500_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052973_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052975_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674406_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDAN
AB048701_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
MK052949_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979173_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
MF925366_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDCWPAAN
JX090680_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456665_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183467_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674428_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674419_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052950_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052959_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052948_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754617_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456636_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EF103276_LHBs_P-D      -MGQN----LSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674420_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
MK355501_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEAN
MK052951_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979168_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170768_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDAN
JX090615_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040769_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754631_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674408_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
AB555496_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618429_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MK618430_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MK052953_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108595_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ486025_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY741798_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB330367_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
AF043593_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF439709_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDAN
JF439706_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDAN
JF439711_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDAN
JF439699_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF439700_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF439701_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF439704_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDAN
JF439705_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDAN
JF439710_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDAN
JF439718_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF439708_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDTWPDAN
JF439692_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF439703_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052947_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979155_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX310735_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANQDWDFNPNKDTWPDAN
JN040753_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754588_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF439696_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183465_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183448_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY090453_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWSDAN
AJ627219_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
AF151735_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674423_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB188244_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052955_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052956_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052958_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052960_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052971_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052963_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052966_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052974_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052961_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK052952_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979166_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
KM108596_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPAAN
KM108592_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAS
JX090690_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642163_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642149_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040775_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456657_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ464169_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPGWDFNPNKDTWPDAN
AB104710_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB090270_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471655_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090712_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090611_LHBs_P-D      -MGQN----LSTSNPMGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090609_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642158_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257201_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754629_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754626_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
GQ477458_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
FJ349215_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
EF103281_LHBs_P-D      -MGQN----LFTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
DQ111986_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY161150_LHBs_P-D      -MGQN----LSISNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AF280817_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB555497_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB126581_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB104711_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979171_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707690_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707683_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707697_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707699_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707702_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707706_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707682_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707684_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707685_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707687_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707688_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707691_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707692_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707693_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707694_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707695_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707696_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707698_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707700_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707701_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707703_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707704_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707705_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707686_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPDKDTWPDAN
KX276857_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
KF471659_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JX096955_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090635_LHBs_P-D      -MGQN----LSSSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090634_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090610_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707689_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN688711_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642133_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604259_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604239_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456678_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183468_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183466_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183464_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183463_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183462_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183458_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183457_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183455_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183454_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183453_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183452_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183451_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183450_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183449_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674411_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB270546_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
AB674431_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
AY741794_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
AY741795_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
AY741796_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
AB222711_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB246347_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
EU414135_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY721607_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB270548_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB270542_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDAN
AB270543_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB222709_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU414136_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
AB104712_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AF121240_LHBs_C-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AF121241_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AJ627224_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
AY741797_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AF121239_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598670_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598661_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTAIPDWDFNPNKDTWPDGN
MK052972_LHBs_P-D      -MGQN----LSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDNWPDAN
MF979157_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF925391_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366465_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664932_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDPWPDAN
JN664931_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664926_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
JN642150_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040782_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040771_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754633_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754611_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ833469_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700444_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDAN
GU456684_LHBs_P-D      -MGQN----LSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456661_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456654_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456645_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456643_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ205384_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
GQ183456_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ899792_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349213_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
EU939681_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY945307_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY796032_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAH
AJ627223_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674427_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674407_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB555501_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB270547_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724236_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF618349_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX827291_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX276998_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDAN
KJ647350_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF053178_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875333_LHBs_P-D      -MGKN----HSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090689_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090677_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090636_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090616_LHBs_P-D      -MGQN----LSVRNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
JN642164_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642131_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642126_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604250_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040822_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040773_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPACRANTANPDWDFNPNKDTWPDAN
GU456679_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456673_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNAN
GU456666_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456653_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
GU456639_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904419_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
FJ349219_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
AJ344116_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AJ131956_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AF043594_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB270539_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB104709_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB222712_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB222713_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674422_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY661792_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY661793_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY721605_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY721606_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY721608_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY721612_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM577670_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
L27106_LHBs_P-D        -MGQS----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX357639_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNAN
KP090179_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524341_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KJ843187_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KJ470896_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
KF471654_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471644_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471640_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170756_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090688_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642157_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDAN
JN642146_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642143_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642140_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642138_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257148_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040823_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040810_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040801_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040790_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040787_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040784_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700472_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPHKDTWPDAN
GU456656_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183459_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904438_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
FJ904418_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY796030_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB246348_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875342_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
KX196229_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
GQ205385_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
GQ205388_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
GQ205389_LHBs_P-D      -MGQN----LSTSNPLGFFPDHRLDPAFRANTRNPDWDFNPNKDTWPDAN
KC875340_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
KM524345_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTKNPDWDFNPNKDTWPDAN
MF618342_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
MK693109_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598675_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNTKKDTWPDAN
MH724241_LHBs_P-D      -MGQN----LSNSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979175_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM606755_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
KM524338_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KJ470893_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
KF679990_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471642_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170774_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAH
KF170771_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090724_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090723_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090629_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090624_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664941_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604318_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604275_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040786_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040779_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040767_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754635_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754612_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
HQ833465_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456682_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
GU456675_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456674_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456669_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456664_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456659_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456652_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456649_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
GQ922000_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEAN
GQ183479_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
GQ183469_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183460_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ562338_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDAN
EU787443_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EF103275_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY161158_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AY161157_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AF121242_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB674405_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
AB583680_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
X80926_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
X80924_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618433_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MK598664_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598662_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTAIPDWDFNPNKDTWPDGN
MK541688_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724251_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
M32138_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
KX196227_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196214_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196208_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668448_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTACPDWDIDPNKDTWPDAN
KP165597_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP143743_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP143742_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779289_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRVNTANPDWDFNPNKDTWPDAN
KF779225_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANMGNPDWDFNPNKDTWPDAN
KF476030_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF061169_LHBs_P-D      -MGQN----LSTXXPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875276_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX310733_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090644_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN792906_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664930_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTAYPDWDFNPNKDTWPDAN
JN664919_LHBs_P-D      -MGQN----LSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604120_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPXAN
JN257165_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257160_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257159_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDAN
JN040812_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040799_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040791_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040788_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040762_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754634_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456635_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
GU357846_LHBs_P-D      -MGQN----PSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ205382_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
FJ349235_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
FJ349218_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTASPDWDFNPNKDTWPDAN
AB270541_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN370954_LHBs_P-D      ---QN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JN604152_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642159_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
MK693108_LHBs_P-D      -MGQN----LFTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618432_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MK598678_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598676_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598666_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598650_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598647_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598641_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598637_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK355500_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLGPAFKANTANPDWDFNPNKDTWPDAN
MF979174_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196233_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196225_LHBs_P-D      -MGQN----LSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196224_LHBs_P-D      -MGQN----LSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT151620_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108599_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KJ647353_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KJ470894_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
KF779222_LHBs_P-D      -MGQN----LSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779219_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQVDPAFRANMGNPDWDFNPNKDTWPDAN
KF476029_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAD
KF471641_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170761_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF061170_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAXRANTANPDWDFNPNKDTWPDAN
KC875328_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875323_LHBs_P-D      -MGQN----LSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875322_LHBs_P-D      -MGQN----LSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875316_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875289_LHBs_P-D      -MGQN----LSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875285_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875282_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFKPNKDTWPDAN
KC875279_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX310726_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPGAN
JX090647_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JX090641_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090622_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX036334_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707529_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707517_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707515_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNAN
JQ707513_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707480_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JN642166_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642161_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642151_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
JN642142_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642135_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642134_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
JN642132_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
JN604301_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257202_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257200_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040830_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
JN040821_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040819_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
JN040809_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040800_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040795_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040770_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040768_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDAN
JN040766_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754623_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754619_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754609_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754603_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754602_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700463_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDAN
HQ236015_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
GU456655_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456650_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ922003_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
GQ477456_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ205380_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
GQ183461_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904395_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
EU594402_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNAN
EU594401_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNAN
JN370953_LHBs_P-D      ---QN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JN370952_LHBs_P-D      ---QN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JN370951_LHBs_P-D      ---QN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JN370950_LHBs_P-D      ---QN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JN370949_LHBs_P-D      ---QN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
MN507838_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618443_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618441_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618437_LHBs_P-D      -MGHN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618431_LHBs_P-D      -MGHN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598679_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598660_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598646_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598645_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTPNPDWDFNPNKDPWPDAN
MK598644_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598643_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598640_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724242_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724235_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979167_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979163_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979162_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979161_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979156_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
LT992439_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDNWPDAN
KX357622_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTHPDWDFNPNKDTWPDAN
KX196228_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196215_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196211_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668435_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
KR139748_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP165604_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
KM524358_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524354_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779376_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779341_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779302_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF679989_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF192834_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
KF192832_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
KF192831_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
KF192830_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
KF170770_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875331_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875329_LHBs_P-D      -MGQN----LSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875315_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875296_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875288_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX898689_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAS
JX090720_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090719_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090708_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090707_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090703_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090701_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090672_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090667_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDLAFRANTANPDWDSNPNKDTWPDAN
JX090656_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTDNPDWDFNPNKDTWPDAN
JX090646_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090619_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090606_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN688712_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDAN
JN688678_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664924_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
JN664922_LHBs_P-D      -MGGC----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642165_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
JN604265_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604263_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604170_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257183_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257172_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
JN040824_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040815_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRAKTANPDWDFNPNKDTWPDAN
JN040814_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040777_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040765_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040758_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700474_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
HQ700458_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
GU456683_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
GU456680_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456668_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456667_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456658_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183476_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
FJ904431_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904410_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
EU787442_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU787441_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594434_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EF103277_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598659_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPGWDFNPNKDTWPDAN
MK598642_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598639_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598636_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724219_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724218_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
LT992454_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
LT992444_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTKNPDWDFNPNKDPWPDAN
KX196222_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196219_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
KX196212_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196209_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU736926_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
KP995100_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP090178_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP090177_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM577669_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524356_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNAN
KM212957_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KJ647355_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779301_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471647_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF061168_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF061167_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875301_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875295_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875292_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
KC875290_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090721_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090700_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090697_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090682_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090640_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090633_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090623_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ687531_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JN792912_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN792905_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN688710_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642136_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040818_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQWDPAFRANTANPDWDFNPNKDTWPDAN
JN040808_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040806_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040761_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040759_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040755_LHBs_P-D      -MGQN----LSTSNPLGFLPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754632_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754628_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JF754614_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754610_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ236016_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349233_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU921418_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU787440_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU787437_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
X02496_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MN507853_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MN507839_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK693107_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPDKDTWPDAN
MK618426_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618425_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618424_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618422_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618419_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598677_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598673_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEAN
MK598663_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598649_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598648_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598638_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK507913_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH932714_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724216_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979176_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF925379_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KY382414_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KY382412_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX276975_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
KX196232_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196230_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196221_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196220_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196218_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196217_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU736927_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
KU668444_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTAYPDWDFNPNKDTWPDAN
KU668441_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
KT963508_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT962022_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT749821_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366510_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
KT366496_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366494_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT347090_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP202944_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP202942_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP202941_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP184498_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP184497_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP184496_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP184495_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM577671_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524355_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPEAN
KM108607_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
KM108606_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
KM108603_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108602_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108591_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
KJ470895_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
KF779377_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779340_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF584164_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF584163_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF584161_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF476028_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNEDTWPDAN
KF471656_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170776_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170772_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170764_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170759_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170757_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDAN
KF170755_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875337_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875335_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875334_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875330_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875326_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLGPAFRANTANPDWDFNPNKDTWPDAN
KC875325_LHBs_P-D      -MGEN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875321_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNNDTWPDAN
KC875320_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875318_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875314_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875313_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875310_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875287_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875284_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875283_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875281_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875277_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX310729_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX096958_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090715_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090681_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPIKDTWPDAN
JX090658_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090621_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX036333_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707530_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707528_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707527_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707526_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707525_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707524_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707523_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707522_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707521_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707520_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707519_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707518_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707516_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707514_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707512_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707508_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707507_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707505_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707503_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707502_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707500_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707499_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707496_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707494_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707493_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707490_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707489_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707488_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707487_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707486_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707485_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707483_LHBs_P-D      -MGQN----LSTNNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ707482_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707481_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707479_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707478_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JQ707476_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPNAN
JN688679_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664917_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642153_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWSDAN
JN642148_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
JN642129_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604278_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257205_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257203_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257176_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDXWPDAN
JN257177_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDXWPDAN
JN257170_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257169_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257149_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040820_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JN040813_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040802_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDAWPDAN
JN040797_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040796_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040793_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040785_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040783_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040774_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JN040751_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040750_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754615_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JF754599_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754594_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ833471_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAX
HQ833467_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700473_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDXWPDAN
HQ700466_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDAN
HQ700453_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDAN
HM750155_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456637_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ477459_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ477453_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183474_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
GQ183473_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
GQ183471_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904445_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904433_LHBs_C-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDPWPDAN
FJ904432_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904402_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTKNPDWDFNPNKDTWPDAN
FJ386590_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349234_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349231_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349229_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349214_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDNWPDAN
FJ349206_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU939680_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU787447_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU787446_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594432_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594431_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594429_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594417_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594416_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594409_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594400_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598674_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598658_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724245_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724237_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724233_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MH724232_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MH724223_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724217_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979170_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
MF979154_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF618343_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX827290_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX276999_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196231_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
KU668449_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668447_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668436_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668433_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTRNPDWDFNPNKDTWPDAN
KT962024_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT962023_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT962021_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP202943_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP202940_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP202939_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP202938_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP202937_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP202936_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP184499_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP090181_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM606745_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524361_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524351_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524346_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108604_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108598_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108597_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108594_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
KJ647352_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF922432_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
KF779285_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779224_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779218_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779217_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779212_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779209_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF679997_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF679994_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF584166_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF584165_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF584160_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTXNXDWDFNPNKDTWPDAN
KF471660_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471658_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
KF471657_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471646_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTVNPDWDFNPNKDPWPDAN
KF170747_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875336_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
KC875305_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875303_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875299_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875286_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX898697_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX898694_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX898692_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX898691_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX310728_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090706_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090705_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090704_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090698_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090693_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090687_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090684_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JX090673_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JX090670_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090665_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090663_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090659_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090645_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090643_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090642_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090638_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090632_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090631_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090630_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090626_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090605_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN688713_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN688708_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN688683_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664938_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664937_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664921_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664912_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTPNPDWDFNPNKDTWPDAN
JN664910_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSANPDWDFNPNKDTWPDAN
JN604313_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604312_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JN604272_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604207_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
JN604174_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
JN257181_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPKKDTWPDAN
JN257163_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257151_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040792_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754618_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JF754601_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ833470_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ833468_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700513_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700478_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HM750154_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HM750153_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456681_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456670_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456660_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456641_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ922004_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
GQ183483_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
GQ183482_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
GQ183477_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
FJ904427_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904422_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349232_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNAN
FJ349220_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
FJ349216_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
EU919197_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU414143_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU414142_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724252_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724247_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX357637_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT749828_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT749827_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP090180_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524349_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524339_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KJ470889_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANSNNPDWDFNPNKDTWPDAN
KF779303_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF679998_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170760_LHBs_P-D      -MGQN----LSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDPWPDAN
KC875324_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875308_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875306_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875302_LHBs_P-D      -MGQN----LSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875294_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875293_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090686_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090685_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPGAN
JX090683_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090676_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JX090671_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090657_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090617_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090613_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090612_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090608_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090607_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN792911_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257209_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257190_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
JN257162_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257152_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700553_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700483_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700481_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700480_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ236014_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HM750151_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTENPDWDFNPNKDTWPDAN
GQ477457_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183485_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183481_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
EU921419_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594404_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594382_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
Z35716_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDYNPNKDTWPDAN
Y07587_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MN507851_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MN507837_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MN507836_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618428_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618427_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618423_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618421_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618420_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK618418_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598672_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598671_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598669_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598667_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK507914_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK507911_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK507910_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724249_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
MH724246_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724244_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724231_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF925364_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF925363_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF925358_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
LT992438_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
LC365689_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KY629634_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KY629633_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX827301_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX827300_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196236_LHBs_P-D      -MGQN----LSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196234_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196226_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196216_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196213_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX196210_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366511_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366509_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366508_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366506_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366502_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
KT366501_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
KT366500_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
KT366499_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366498_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
KT366495_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366491_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KR905424_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP322600_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP322599_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP230541_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP202945_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP165605_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP165602_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP165601_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP165598_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP143745_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM606753_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM606752_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
KM524353_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
KM524352_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524350_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524347_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524342_LHBs_P-D      -MGQN----LSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108600_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779220_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF679996_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF584162_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471652_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471651_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471650_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF471649_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDPWPDAN
KF170766_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170765_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170758_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875332_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875319_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875317_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875312_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875311_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875309_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875304_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875300_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875297_LHBs_P-D      -MGQN----LSTSNPLGFFPNHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875291_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875280_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KC875278_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLVPAFRANTANPDWDFNPNKDTWPDAN
JX090717_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090711_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090695_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090678_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090675_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090668_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090660_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090655_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090654_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090653_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090652_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090651_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090650_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090649_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090627_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
JQ707497_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664927_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642167_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642156_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642147_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642145_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN642130_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
JN604238_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPNAN
JN604206_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604161_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDSWPDAN
JN257199_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257196_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257193_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257188_LHBs_P-D      -MGQN----LSTSNPLGFFPEHQLDPAFRANTANPDWDFNPNKDPWPDAN
JN257185_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257182_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257179_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257171_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257155_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040829_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040828_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040827_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040826_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040811_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040807_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040805_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPDFRANTANPDWDFNPNKDTWPDAN
JN040794_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040778_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040757_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754627_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JF754624_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754607_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754604_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754600_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754596_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754595_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754593_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754592_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754591_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754590_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700488_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700487_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700484_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700482_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700479_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700471_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700470_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700469_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700464_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700459_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700455_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700454_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTXNPDWDFNPNKDTWPDAN
HQ700451_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700450_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700448_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700447_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700446_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700445_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700443_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700442_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700441_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700440_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HM750156_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HM750152_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456677_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456663_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
GU456651_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456648_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456647_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456646_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456640_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GU456638_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ477452_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ377589_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183480_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183475_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTSNPDWDFNPNKDTWPDAN
GQ183472_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183470_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904443_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904435_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
FJ904426_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904424_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904421_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904420_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904415_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904412_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904399_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ692532_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
FJ349230_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349228_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
EU787436_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594428_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594427_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594424_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
EU594422_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594421_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594415_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594414_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594413_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594410_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594407_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594405_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594403_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594397_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594396_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU414141_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
X65257_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
V01460_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK598668_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK507912_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724250_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724248_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MH724234_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724230_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MH724229_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MH724228_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MH724227_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MH724226_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724225_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MH724224_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
MH724221_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724220_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724215_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MH724214_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979164_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979160_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF979158_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF618348_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF618341_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF618340_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MF618339_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KY629630_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX827292_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668446_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668445_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668442_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668439_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
KU668438_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668437_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU668434_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366507_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT366497_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KR139747_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP165603_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP165600_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM606754_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
KM606744_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
KM577668_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM524344_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM519455_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108605_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779318_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779296_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779292_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779288_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779216_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF779214_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF679993_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF679992_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF170767_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDSWPDAN
KF170763_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
KF170746_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX096954_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090716_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090710_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090709_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090702_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090694_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090674_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090666_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFKANTANPDWDFNPNKDTWPDAN
JX090662_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090661_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090639_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090628_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090620_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090618_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN792908_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN688695_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664936_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664920_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664914_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664913_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664911_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664909_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTGNPDWDFNPNKDTWPDAN
JN604189_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN040781_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700514_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700511_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDIWPDAN
HQ700449_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ922005_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
GQ922002_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ922001_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
GQ183478_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ904439_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
FJ692533_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTNNPDWDFNPNKDTWPDAN
FJ692507_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ692506_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349209_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594433_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594426_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
X97849_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
X72702_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MK516278_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KX357638_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU736925_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KR905423_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP322601_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KM108593_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KF679995_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX096957_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090718_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090713_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090699_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX090696_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWSDAN
JX090679_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTTNPDWDFNPNKDTWPDAN
JX090625_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JQ687530_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN664939_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN604295_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JF754597_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700512_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
HQ700510_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349208_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
FJ349205_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594430_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594425_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594418_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594399_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594398_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KU736924_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KT962025_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP165599_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
KP143744_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JX096956_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN257150_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
GQ924652_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
EU594423_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594420_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594419_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU594408_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
X97848_LHBs_P-D        -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
MN507852_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDPWPDAN
JN792910_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN792909_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN792907_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN792904_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
EU414140_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
JN792903_LHBs_P-D      -MGQN----LSTSNPLGFFPDHQLDPAFRANTANPDWDFNPNKDTWPDAN
                                     *:**:* :.     .      .** ..  :    . 

JN257186_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF779382_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF779228_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779229_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779230_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
GQ477455_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB222710_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPT
EU787438_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTIPTHPPPASTNRQSGRQPT
JX310734_LHBs_P-D      KVGAGAFGLGITPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM524340_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
KC875298_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257153_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257195_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN688685_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
DQ399006_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU155895_LHBs_P-D      KVGAGAFGLGFTPPHGSLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ184322_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPPNPPPASTNRQTGRQPT
GQ167301_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLQANPPPASTNRQTGRQPT
GQ167302_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
AY236162_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
DQ304547_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
DQ304551_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
DQ304548_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
DQ304550_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
JX470760_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKTGRQPT
KC012652_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKTGRQPT
DQ329356_LHBs_P-D      KEGAGAFGLGFTQPHGGLLGWSPQVQGMLQTLPANPPPASTNRQSGRQPT
DQ329357_LHBs_P-D      KVGAGAFGLGFTQPHGGLLGWSPQVQGMLQTLPANPPPASTNRQSGRQPT
DQ336690_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
AY236160_LHBs_P-D      KVGAGAFGLGFTQPHGGLLGWSPQVQGMLQTLPANPPPASTNRQSGRQPT
DQ336691_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASNKCQSGRQPT
DQ336678_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336679_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336675_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336676_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336677_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336674_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ486021_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ464178_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ464176_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASSNRQSGRQPT
DQ464175_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336688_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336687_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336686_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336692_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336689_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ464172_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ464173_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ464174_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ464177_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
DQ336685_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB205128_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB119255_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRRSTRQPT
DQ464168_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK618436_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
MK618434_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK618435_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598651_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQCIIQTLPANPPPAFINRQSGRQAT
MK598655_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQCIIQTLPANPPPAFINRQSGRQAT
MK598657_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQCIIQTLPANPPPAFINRQSGRQAT
AY796031_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB116266_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGTSPQAQGIIETLPANPPPASTNRQSGRQPT
DQ464170_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWDPQAQGILQTLPANPPPASTNRQSGRQPT
AB188242_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMTTLPANPPPASTNRKSGRQPT
JQ927384_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KP168419_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
DQ464182_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB090269_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB078032_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTFPANPPPASTNRQSGRQPT
AB078031_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB078033_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB267090_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB090268_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILTTLPANPPPASTNRQSGRQST
AB120308_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AY233292_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPI
AY233294_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AJ627215_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRQSGRQPT
AJ627216_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGVXQTLPANPPPASTNRQSGRQPT
AJ627218_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGVMQTLPANPPPASTNRQSGRQPT
AM422939_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY233296_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AJ627220_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIXQTLPANPPPASTNRQSARQPT
AB210820_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB205127_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AJ627222_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB188241_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQSLPVNPPPASTNRQSGRQPT
EU414138_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU414139_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB330369_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB493846_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY233291_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
DQ315776_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB330370_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB109478_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMTTLPANPPPASTNRQSGRQPT
JN642144_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAPTNRQSRRQPT
AB119251_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB119252_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB119253_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK598665_LHBs_P-D      KVGAGAFGLGFTPTHGDLLGWSPQAQGIMQTLTANPHPASINRQSGRQPT
JN664928_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPPSTNRQSGRQPT
MH724238_LHBs_P-D      KVGAGAFGVGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTKRQSGRQPT
KX276856_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MF925393_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MF925383_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JN604175_LHBs_P-D      KVGAGAFGXGXTPPHGGLLGWSPQAQGIIQTLPANPPPAXTNRXXGRQPT
JN664918_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB109476_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB109477_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB109479_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB110075_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB119254_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB205126_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB210821_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB210822_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB471856_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB471857_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB109475_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX310727_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTTRQSGRQPT
EU155893_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPVSTNRQSRRQPT
AB270550_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
X65258_LHBs_P-D        KDGAGAFGLGLTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQTGRQPT
AY090452_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGITQTLPANPPPASTNRQSGRQPT
AB674424_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
MK052954_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPTASTSRRPVRQPT
JN642154_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN604139_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILHTLPANPPPAQTNRQSGRQPT
AB674425_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB674416_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF979165_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGXSPQAQGILQTLPANPPPASTNRQSGRQPT
AB555500_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
MK052973_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTTRQSGRQPT
MK052975_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTTRQSGRQPT
AB674406_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB048701_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
MK052949_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPRAQGILQTLPTNPPPASTNRQTGRQPT
MF979173_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTTRRSRRQPT
MF925366_LHBs_P-D      KVGVGSFGPGFTPPHGGLLGWSPQAQGILQTVPAAPPPASTNRQSGRQPT
JX090680_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSRRQPT
GU456665_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GQ183467_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
AB674428_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB674419_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQPT
MK052950_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTTRQSGRQPT
MK052959_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTTRQSGRQPT
MK052948_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQARGILQTLPTNPPPASASRRPVRQPT
JF754617_LHBs_P-D      KVGAGAFGMGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456636_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTMPANPPPASTNRQSGRQPT
EF103276_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPP
AB674420_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK355501_LHBs_P-D      KVGAGAFGLGFPPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
MK052951_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPTASTSRRPVRQPT
MF979168_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTTRRSGRQPT
KF170768_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSHQAQGILQTVPANPPPASTNRQSGRQPT
JX090615_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPATPPPASTNRQSGRQPT
JN040769_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANSPPASTNRQSGRQPT
JF754631_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQPRRQPT
AB674408_LHBs_P-D      KVGAGAFGLGFTPPHGGLLEWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB555496_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK618429_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPSYPPPASTNRQSGRQPT
MK618430_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPSYPPPASTNRQSGRQPT
MK052953_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQTGRQPT
KM108595_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
DQ486025_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPT
AY741798_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB330367_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AF043593_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQTGRQPT
JF439709_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439706_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439711_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439699_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439700_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439701_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439704_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439705_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439710_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439718_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439708_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439692_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JF439703_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
MK052947_LHBs_P-D      KVGAGAFGLGFTPPHGGLLEWSPQAQGILQTLPTNPPPASTNRQTGRQPT
MF979155_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX310735_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040753_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTRRQTGRQPT
JF754588_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGALQTLPANPPPASTNRQSGRQPT
JF439696_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
GQ183465_LHBs_P-D      KGGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183448_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
AY090453_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AJ627219_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQSXPANPPPASTNRKSGRQPT
AF151735_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPT
AB674423_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPT
AB188244_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK052955_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTSPPPASTSRRSGRQPT
MK052956_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTSPPPASTSRRSGRQPT
MK052958_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTSPPPASTSRRSGRQPT
MK052960_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTSPPPASTSRRSGRQPT
MK052971_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILETLPTNPPPASTSRRPGRQPT
MK052963_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTSRRPGRQPT
MK052966_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTGRRPGRQPT
MK052974_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTSRRSGRQPT
MK052961_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTTRQSGRQPT
MK052952_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQTGRQPT
MF979166_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM108596_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPLASTNRQSGRQPT
KM108592_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWTPQAQGMIQTLPTNPPPASTNRQSGRQPT
JX090690_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILHTLPANPPPASTNRQSGRQPT
JN642163_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRKPT
JN642149_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRSGRQPT
JN040775_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
GU456657_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
DQ464169_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB104710_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQPT
AB090270_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF471655_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090712_LHBs_P-D      KVGAGAFGQGFTPPHGGLLGWSPQAQGIIHTLPANPPPTSTNRQSGRQPT
JX090611_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090609_LHBs_P-D      KVGAGACGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTPRQTGRQPT
JN642158_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257201_LHBs_P-D      KVGAGAFGMGFTPPHGGLLGWSPQAQGMLQTLPASPPPASTXRQSGRQPT
JF754629_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JF754626_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPATTNRRSGRQPT
GQ477458_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
FJ349215_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWRPQAQGILQTLPTNPPPASTNRQPGRQPT
EF103281_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
DQ111986_LHBs_P-D      KVGAGAFGMGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY161150_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AF280817_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB555497_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB126581_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB104711_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF979171_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JQ707690_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707683_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707697_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707699_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707702_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707706_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707682_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707684_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707685_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707687_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707688_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707691_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707692_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707693_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707694_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707695_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707696_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707698_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707700_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707701_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707703_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707704_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707705_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JQ707686_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
KX276857_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGMLHTVPANPPPASTNRQSGRQPT
KF471659_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX096955_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090635_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANSPPASTNRQSGRQPT
JX090634_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
JX090610_LHBs_P-D      KVGAGSFGMGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JQ707689_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTMQTLPANPPPVSTNRQSGRQPT
JN688711_LHBs_P-D      KVGAGAFGLGXTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642133_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQST
JN604259_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAKPPPATTTRQSGRQPT
JN604239_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTNPPPASTNRQSGRQPT
GU456678_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GQ183468_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183466_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183464_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183463_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183462_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183458_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183457_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183455_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183454_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183453_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183452_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183451_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183450_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183449_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
AB674411_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB270546_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB674431_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AY741794_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AY741795_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AY741796_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AB222711_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB246347_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU414135_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY721607_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB270548_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB270542_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB270543_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB222709_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPT
EU414136_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRHSGRQPT
AB104712_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AF121240_LHBs_C-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AF121241_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AJ627224_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AY741797_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AF121239_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
MK598670_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAYPPPISTYRQSGRQHT
MK598661_LHBs_P-D      KVGAGAFGLGFTPSHGGLLGWSPQAQGIIQTLPVNPPPASINRQSGRQPT
MK052972_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQTGRQPT
MF979157_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRSGRXPT
MF925391_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
KT366465_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQSQGIIQTSPANPPPASTNRQSGRHPT
JN664932_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
JN664931_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTVPANPPPASTTRQSGRQPT
JN664926_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
JN642150_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
JN040782_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040771_LHBs_P-D      KVGAGAFGLGFTPPDGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
JF754633_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRKPT
JF754611_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASPNRKTSRQPT
HQ833469_LHBs_P-D      KVGAGAFGXGXTPPHGGLLGWSPQAQGRLQTLPTNPPPASTNRQSGRQPT
HQ700444_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456684_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456661_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456654_LHBs_P-D      KVGAGAFGPGLTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
GU456645_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRSGRQPT
GU456643_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ205384_LHBs_P-D      KVGAGAFGLGFTPPHGGHLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
GQ183456_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
FJ899792_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
FJ349213_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU939681_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AY945307_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY796032_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AJ627223_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
AB674427_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB674407_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB555501_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB270547_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724236_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF618349_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTTRQSGMQPT
KX827291_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPT
KX276998_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPVSTNRQSGRQPT
KJ647350_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF053178_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875333_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
JX090689_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPT
JX090677_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPT
JX090636_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQARGILHTVPANPPPASTNRQSGRQPT
JX090616_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642164_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642131_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN642126_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN604250_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040822_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040773_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456679_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTNPPPASTNRQSGRQPT
GU456673_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456666_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456653_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456639_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904419_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
FJ349219_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AJ344116_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AJ131956_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
AF043594_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQTGRQPT
AB270539_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AB104709_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB222712_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB222713_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB674422_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY661792_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPTSTNRQSGRQPT
AY661793_LHBs_P-D      KVGAGAFGRGFTPPHGGLLGWSPQAQGILQTLPANPPPTSTNRQSGRQPT
AY721605_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY721606_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY721608_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY721612_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM577670_LHBs_P-D      KVGAGAF----TPPHGGLLGWSPQAQDILQTLPANPPPASTNRQSGRQPT
L27106_LHBs_P-D        KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX357639_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGKIQTLPANPPPASTNRQSGRQPT
KP090179_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNPQSGRQPT
KM524341_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQDQGIIQTLPANPPPASTNSQSGRQPT
KJ843187_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KJ470896_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASTNRQSGRQPT
KF471654_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KF471644_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KF471640_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF170756_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090688_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN642157_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642146_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTNQPPASTKRQSGRQPT
JN642143_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRQSGRQPT
JN642140_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642138_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN257148_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTNPPPASTNRQSGRQPT
JN040823_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
JN040810_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGREPT
JN040801_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPATTNRQSGRQPT
JN040790_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040787_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040784_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700472_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456656_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSSRQPT
GQ183459_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
FJ904438_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
FJ904418_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
AY796030_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTHRQSGRQPT
AB246348_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875342_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
KX196229_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
GQ205385_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
GQ205388_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
GQ205389_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
KC875340_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
KM524345_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
MF618342_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
MK693109_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598675_LHBs_P-D      KVGAGAFGLGSTPPHGGLLGWSPQALGIIQTLPANPPPASTNRQSGRQPT
MH724241_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MF979175_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTTRQSGRQPT
KM606755_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM524338_LHBs_P-D      KVGAGAFGLGFTPPQGGLLGWNPGAQGIIQTLPANPPPASTNRQSGRQPT
KJ470893_LHBs_P-D      KVGAGAFGLGFSPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF679990_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF471642_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KF170774_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGITQTLPANPPPASTNRQSGRQPT
KF170771_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRKPT
JX090724_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTKRQSGRQPT
JX090723_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090629_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090624_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664941_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
JN604318_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN604275_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JN040786_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040779_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQPT
JN040767_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JF754635_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754612_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
HQ833465_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGKLQTLPTNPPPASTNRQSGRQPT
GU456682_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456675_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456674_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456669_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456664_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456659_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456652_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQPT
GU456649_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQST
GQ922000_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ183479_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
GQ183469_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
GQ183460_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTVPANPPPASTNRQSGRQPT
FJ562338_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU787443_LHBs_P-D      KVGVGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EF103275_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY161158_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AY161157_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AF121242_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
AB674405_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
AB583680_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
X80926_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
X80924_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
MK618433_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598664_LHBs_P-D      KVGGGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK598662_LHBs_P-D      KVGAGAFGLGFTPSHGGLLGWSPQAQGIIQTLPVNPPPASINRQSGRQPT
MK541688_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPT
MH724251_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
M32138_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196227_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KX196214_LHBs_P-D      KVGAGAFGLGFTPRHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPA
KX196208_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KU668448_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KP165597_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KP143743_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KP143742_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF779289_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779225_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF476030_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF061169_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPAXPPPASTXRQSGRQPT
KC875276_LHBs_P-D      KVGAGAFGLGFTPRHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPA
JX310733_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090644_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN792906_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664930_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPHAHGIIQTLPANPPPASTNRQSGRQPT
JN664919_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN604120_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRQSGRQPT
JN257165_LHBs_P-D      KVGAGAFGLGFTPPHGGLXGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257160_LHBs_P-D      KVGAGAFGXGXTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
JN257159_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
JN040812_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040799_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040791_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN040788_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040762_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JF754634_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456635_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGSLQTLPANPPPASTNRQSGRQPT
GU357846_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ205382_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
FJ349235_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ349218_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAATNRQSGRQPT
AB270541_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN370954_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRLPT
JN604152_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN642159_LHBs_P-D      KVGAGAFGMGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK693108_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
MK618432_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598678_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK598676_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTKRQSGRQPT
MK598666_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPACTNRQSGRQPT
MK598650_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILETLPANPPPASTNRQSGRQPT
MK598647_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598641_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANRPPASTNRQSGRQPT
MK598637_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK355500_LHBs_P-D      KVGAGAFGLGFTPPHGGLLKRSPQAQGILQTLPTNPPPASTNRQSGRQPT
MF979174_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196233_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIPQTLPANPPPASTNRQSGRQPT
KX196225_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KX196224_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KT151620_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSXQAQGIIQTLPANPPPASTNRQXGRQPT
KM108599_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KJ647353_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KJ470894_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF779222_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779219_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF476029_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILHTVPAKPPPASTNRQSGRQPT
KF471641_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KF170761_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPPSTNRQSGRQPT
KF061170_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875328_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KC875323_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KC875322_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KC875316_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875289_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KC875285_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRESGRQPT
KC875282_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875279_LHBs_P-D      KVGAGAFGLGFTPPHGGRLGWSPQAQGIIQTLRANPPPASTNRQSGRQPT
JX310726_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090647_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090641_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090622_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX036334_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JQ707529_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707517_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707515_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPSPASTNRQSGRQPT
JQ707513_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707480_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSERQPT
JN642166_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642161_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642151_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642142_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642135_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQSGRQPT
JN642134_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642132_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN604301_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JN257202_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRRSGRQPT
JN257200_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040830_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040821_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQTGRQPT
JN040819_LHBs_P-D      KVGAGACGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040809_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040800_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040795_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040770_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040768_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN040766_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JF754623_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754619_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754609_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754603_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754602_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700463_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ236015_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILHTLPTNPPPASTNRQSGRQPT
GU456655_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
GU456650_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ922003_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTDRQSGRQPT
GQ477456_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPANPPPASTNRQSGRQPT
GQ205380_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
GQ183461_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
FJ904395_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594402_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594401_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN370953_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRLPT
JN370952_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRLPT
JN370951_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRLPT
JN370950_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRLPT
JN370949_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRLPT
MN507838_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQALGILQTLPANPPPASTNRQSGRQPT
MK618443_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASANRQSGRQPT
MK618441_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILHTVPANPPPASANRQSGRQPT
MK618437_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKSGRQPT
MK618431_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKSGRQPT
MK598679_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPGASTNRQSGRQPT
MK598660_LHBs_P-D      KVGAGAFGVGFTPPHGGLLGWSPQAQGIIQTLQVNPPPASTNRQSGRQPT
MK598646_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598645_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLTTNPHPASTNRQSGRQPT
MK598644_LHBs_P-D      KVGGGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
MK598643_LHBs_P-D      KVGGGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
MK598640_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQALGILQTLPANPPPASTNRQSGRQPT
MH724242_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724235_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF979167_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF979163_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF979162_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSSQAQGILQTMPANPPPASTNRQSGRQPT
MF979161_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF979156_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGXSPQAQGILQTLPANPPPASTNRQSGRQPT
LT992439_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX357622_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KX196228_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KX196215_LHBs_P-D      KVGAGAFGLGFTPPHGGLVGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KX196211_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KU668435_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
KR139748_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KP165604_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KM524358_LHBs_P-D      KVGAGAFGPGVIPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM524354_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPT
KF779376_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779341_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779302_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQTGRQPT
KF679989_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANTPPASTNRQSGRQPT
KF192834_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
KF192832_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
KF192831_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
KF192830_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
KF170770_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875331_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875329_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KC875315_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875296_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KC875288_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
JX898689_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JX090720_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQTGRQPT
JX090719_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090708_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090707_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090703_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090701_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGMMLTLPANPPPASTNRQSGRQPT
JX090672_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090667_LHBs_P-D      MVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090656_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTRPANPPPASTNRQSGRQPT
JX090646_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090619_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPISTNRQSGRQPT
JX090606_LHBs_P-D      KVGAGAFGLGFTPPHGGLSGWSPQAQGIIQTLPANPPPASTNRQSRRQPT
JN688712_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN688678_LHBs_P-D      KVGAGAFGXGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRKSGRQPT
JN664924_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGYSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664922_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642165_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN604265_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPTNPPPASTNRQSGRQPT
JN604263_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN604170_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JN257183_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257172_LHBs_P-D      KVGAGAFGPGXTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN040824_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN040815_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN040814_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040777_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
JN040765_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN040758_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
HQ700474_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700458_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPAHPPPASTNRQSGRQPT
GU456683_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456680_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456668_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456667_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456658_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GQ183476_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
FJ904431_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904410_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU787442_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRKSGRQPT
EU787441_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
EU594434_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLHTLPANPPPASTNRQSGRQPT
EF103277_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598659_LHBs_P-D      KVGAGAXGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAAINRQSGRQPT
MK598642_LHBs_P-D      KVGGGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPAATNRQSGRQPT
MK598639_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598636_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724219_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724218_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
LT992454_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
LT992444_LHBs_P-D      KVGVGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196222_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196219_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196212_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196209_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KU736926_LHBs_P-D      KVGAGAFGXGFTPPHGGLLGWSPQAQGILQSLPTNPPPASTNRQSGRQPT
KP995100_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KP090178_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KP090177_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM577669_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM524356_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM212957_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KJ647355_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF779301_LHBs_P-D      KVGAGAFGLGFTPPHVGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF471647_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF061168_LHBs_P-D      KVGAGAFGLGFTPPHGGXLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF061167_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAHPPPASTNRQSGRQPT
KC875301_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875295_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KC875292_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KC875290_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090721_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090700_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090697_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090682_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQALPANPSPASTNRQSGRQPT
JX090640_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090633_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTVPANPPPASTNRQSGRQPT
JX090623_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JQ687531_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN792912_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN792905_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN688710_LHBs_P-D      KVGAGAFGLGITPPHGGLLGWSPQAQGILQTLPANPPPASTNRQAGRQPT
JN642136_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN040818_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040808_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040806_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040761_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN040759_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN040755_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754632_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754628_LHBs_P-D      KVGAGAFGLGFTPPHGGILGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JF754614_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JF754610_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ236016_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILHTLPTNPPPASTNRQSGRQPT
FJ349233_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSRRQPT
EU921418_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU787440_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPHASTNRQSGRQPT
EU787437_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
X02496_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGILETLPANPPPASTNRQSGRQPT
MN507853_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MN507839_LHBs_P-D      KIGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK693107_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK618426_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPPNPPPASTNRQSGRQPT
MK618425_LHBs_P-D      KVGAGAFGLGFTPPHGALLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK618424_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK618422_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK618419_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPAFTNRQSGRQPT
MK598677_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASSNRQSGRQPT
MK598673_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK598663_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598649_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598648_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598638_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQAT
MK507913_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH932714_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724216_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
MF979176_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF925379_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KY382414_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
KY382412_LHBs_P-D      KVGAGAFGXGFTPPHGGLLGWSPQAQGILXTLPENPXPASTNRQSGRQPT
KX276975_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196232_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196230_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196221_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIPQTLPANPPPASTNRQSGRQPT
KX196220_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196218_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196217_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KU736927_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQSLPTNPPPASTNRQSGRQPT
KU668444_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KU668441_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
KT963508_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KT962022_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT749821_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT366510_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT366496_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMIQTLPANPPPASTNRQSGRQPT
KT366494_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT347090_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILHTVPAKPPPASTNRQSGRQPT
KP202944_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP202942_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP202941_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP184498_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP184497_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP184496_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP184495_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM577671_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM524355_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM108607_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
KM108606_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
KM108603_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPSASTNRQTGRQPT
KM108602_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPSASTNRQXGRQPT
KM108591_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
KJ470895_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF779377_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGXLQTLPANPPPASTNRQTGRQPT
KF779340_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGXLQTLPANPPPASTNRQTGRQPT
KF584164_LHBs_P-D      KVGAGAFGXGFTPPHGGLLGWSPQAQGILXTLPENPXPASTNRQSGRQPT
KF584163_LHBs_P-D      KVGAGAFGXGFTPPHGGLLGWSPQAQGILXTLPENPXPASTNRQSGRQPT
KF584161_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
KF476028_LHBs_P-D      KVGAGAFGPGFTPPRGGLLGWSPQAQGILHTVPAKPPPASTNRQSGRQPT
KF471656_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF170776_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF170772_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF170764_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KF170759_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
KF170757_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF170755_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875337_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875335_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875334_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIPQTLPANPPPASTNRQSGRQPT
KC875330_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPADPPPASTNRQSGRQPT
KC875326_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875325_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875321_LHBs_P-D      KVGAGPFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875320_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875318_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875314_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875313_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWGPQAQGILQTLPANPPPASTNRQSGRQPT
KC875310_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILKTLPANPPPASTNRQSGRQST
KC875287_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875284_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875283_LHBs_P-D      KVGAGAFGLGFAPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875281_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875277_LHBs_P-D      KVGAGAFGLGFTPPHGGLVGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX310729_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX096958_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090715_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPT
JX090681_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090658_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090621_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX036333_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JQ707530_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707528_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707527_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707526_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707525_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707524_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707523_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707522_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707521_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707520_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707519_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707518_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707516_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707514_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707512_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707508_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707507_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707505_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707503_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707502_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707500_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707499_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707496_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707494_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707493_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707490_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707489_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707488_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707487_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707486_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707485_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707483_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JQ707482_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707481_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707479_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707478_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ707476_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JN688679_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JN664917_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642153_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642148_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN642129_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN604278_LHBs_P-D      KVGAGAFGLGFTPPHGALLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257205_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPTSTNRQSGRQPT
JN257203_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257176_LHBs_P-D      KVGAGAFGXGXTPPHGGLLGXSPQAQGILXTLPANPPPASTNRQSGRQPT
JN257177_LHBs_P-D      KVGAGAFGXGXTPPHGGLLGXSPQAQGILXTLPANPPPASTNRQSGRQPT
JN257170_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257169_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257149_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQXXRQPT
JN040820_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040813_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040802_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040797_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040796_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040793_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040785_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQNLPENPPPASTNRQSGRQPT
JN040783_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGGSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040774_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040751_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAHPPPASTNRQSGRQPT
JN040750_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754615_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754599_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754594_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ833471_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
HQ833467_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
HQ700473_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700466_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700453_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HM750155_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456637_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ477459_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
GQ477453_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
GQ183474_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
GQ183473_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
GQ183471_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
FJ904445_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904433_LHBs_C-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
FJ904432_LHBs_P-D      KVGAGAFGPGITPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904402_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ386590_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
FJ349234_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ349231_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ349229_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ349214_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ349206_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU939680_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU787447_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
EU787446_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU594432_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594431_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594429_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594417_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594416_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594409_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594400_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRHSGRQPT
MK598674_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK598658_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASINRQSGRQPT
MH724245_LHBs_P-D      NVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724237_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724233_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIXQTLPANPPPASTNRQSGRQPT
MH724232_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724223_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPT
MH724217_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPTNPPPASTNRQSGRQPT
MF979170_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF979154_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTTRQSGRQPT
MF618343_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX827290_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KX276999_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KX196231_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KU668449_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KU668447_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KU668436_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KU668433_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KT962024_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KT962023_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KT962021_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KP202943_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KP202940_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KP202939_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KP202938_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KP202937_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KP202936_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASANRQSGRQPT
KP184499_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KP090181_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTSRQSGRQPT
KM606745_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM524361_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM524351_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGRSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM524346_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM108604_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM108598_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM108597_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM108594_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KJ647352_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF922432_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPLAQGIMQTLPANPPPASTNRQSGRQPT
KF779285_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQTGRQPT
KF779224_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779218_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779217_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779212_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGTLQTLPANPPPASTNRQTGRQPT
KF779209_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF679997_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF679994_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF584166_LHBs_P-D      KVGAGAFGXGFTPPHGGLLGWSPQAQGILQTXPENPPPASTNRQSGRQPT
KF584165_LHBs_P-D      KVGAGAFGXGFTPPHGGLLGWSPQAQGILQTXPENPPPASTNRQSGRQPT
KF584160_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTXPENPPPASTNRQSGRQPT
KF471660_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KF471658_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KF471657_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KF471646_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KF170747_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KC875336_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875305_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875303_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875299_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875286_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX898697_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JX898694_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JX898692_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JX898691_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JX310728_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JX090706_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090705_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090704_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090698_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090693_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090687_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090684_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090673_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090670_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQLGRQPT
JX090665_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090663_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090659_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090645_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090643_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090642_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090638_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090632_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090631_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090630_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090626_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090605_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN688713_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN688708_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN688683_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664938_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664937_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664921_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664912_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664910_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN604313_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JN604312_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN604272_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
JN604207_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQLGRQPT
JN604174_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN257181_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257163_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257151_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JN040792_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JF754618_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JF754601_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
HQ833470_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
HQ833468_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
HQ700513_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPHAQGIIQTLPANPPPASTNRQSGRQPT
HQ700478_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HM750154_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
HM750153_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456681_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456670_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456660_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
GU456641_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ922004_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
GQ183483_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
GQ183482_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
GQ183477_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
FJ904427_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904422_LHBs_P-D      KVGAGAFGPGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ349232_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ349220_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
FJ349216_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
EU919197_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
EU414143_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGMLQTLPANPPPASTNRQSGRQPT
EU414142_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MH724252_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724247_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KX357637_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQAGRQPT
KT749828_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT749827_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGITQTLPANPPPASTNRQSGRQPT
KP090180_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTKPPPASTNRQSGRQPT
KM524349_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
KM524339_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KJ470889_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGIXXTLPANPPPASTNRQSGRQPT
KF779303_LHBs_P-D      KVGAGAFGLGFTPPHVGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF679998_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF170760_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875324_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875308_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875306_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875302_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875294_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875293_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090686_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090685_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090683_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090676_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
JX090671_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090657_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPATPPPASTNRQSGRQPT
JX090617_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090613_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090612_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090608_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090607_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN792911_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257209_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257190_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN257162_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257152_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700553_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700483_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700481_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700480_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ236014_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
HM750151_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPVSTNRQSGRQPT
GQ477457_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
GQ183485_LHBs_P-D      KVGAGAFGLGFTPPHGGLFGWNPQAQGILQTLPANPPPASTNRQSGRQPT
GQ183481_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPVNPPPASTNRQSGRQPT
EU921419_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU594404_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594382_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
Z35716_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
Y07587_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MN507851_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MN507837_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MN507836_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK618428_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK618427_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK618423_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK618421_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK618420_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPAPASTNRQSGRQPT
MK618418_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLAANPAPASTNRQSGRQPT
MK598672_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK598671_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK598669_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598667_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK507914_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK507911_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK507910_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724249_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724246_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724244_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MH724231_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MF925364_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MF925363_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MF925358_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
LT992438_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
LC365689_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KY629634_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KY629633_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPAYPPPASTNRQSGRQPT
KX827301_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KX827300_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196236_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196234_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196226_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196216_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KX196213_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KX196210_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT366511_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT366509_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT366508_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQNLPANPPPASTNRQSGRQPT
KT366506_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT366502_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KT366501_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KT366500_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KT366499_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KT366498_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KT366495_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT366491_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KR905424_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP322600_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KP322599_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KP230541_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPANPPPASTNRQSGRQPT
KP202945_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPANPPPASTNRQSGRQPT
KP165605_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP165602_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPANPPPASTNRQSGRQPT
KP165601_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPANPPPASTNRQSGRQPT
KP165598_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPANPPPASTNRQSGRQPT
KP143745_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPANPPPASTNRQSGRQPT
KM606753_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM606752_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM524353_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM524352_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM524350_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM524347_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM524342_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM108600_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF779220_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF679996_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF584162_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPENPPPASTNRQSGRQPT
KF471652_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF471651_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF471650_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF471649_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF170766_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASANRQSGRQPT
KF170765_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNLQSGRQPT
KF170758_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875332_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875319_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875317_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875312_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875311_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875309_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875304_LHBs_P-D      KVGAGAYGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875300_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875297_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KC875291_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875280_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KC875278_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090717_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPT
JX090711_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPT
JX090695_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090678_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090675_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPT
JX090668_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090660_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090655_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090654_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090653_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090652_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090651_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090650_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090649_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090627_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JQ707497_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN664927_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642167_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642156_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642147_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642145_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN642130_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN604238_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN604206_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN604161_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPPSTNRQSGRQPT
JN257199_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257196_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257193_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257188_LHBs_P-D      KVGAGAFGXGFTPPHGGLLGWSPQAQGILXTXPTNPPPASTNRQSGRQPT
JN257185_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257182_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257179_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257171_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN257155_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040829_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040828_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040827_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040826_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040811_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040807_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040805_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040794_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040778_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040757_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754627_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JF754624_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754607_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754604_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754600_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754596_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754595_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754593_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASANRQSGRQPT
JF754592_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754591_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JF754590_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700488_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700487_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700484_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700482_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700479_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700471_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700470_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700469_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700464_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700459_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700455_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700454_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700451_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700450_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700448_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700447_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700446_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700445_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700443_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700442_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700441_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700440_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HM750156_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HM750152_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456677_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQSLPANPPPASTNRQSGRQPT
GU456663_LHBs_P-D      KVGAGAFGPGLTPPHGGLLGWSPQAQGILQTLPANPPPTSTNRQTGRQPT
GU456651_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456648_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456647_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456646_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456640_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GU456638_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ477452_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
GQ377589_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ183480_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ183475_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
GQ183472_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
GQ183470_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904443_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904435_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
FJ904426_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904424_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904421_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904420_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904415_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904412_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPSSTNRQSGRQPT
FJ904399_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ692532_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
FJ349230_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ349228_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU787436_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU594428_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTVPANPPPASTNRQSGRQPT
EU594427_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594424_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594422_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594421_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594415_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594414_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594413_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594410_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594407_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594405_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594403_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594397_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU594396_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
EU414141_LHBs_P-D      KVGAGAFGXGFTPPHGGLLGWSPQAQGIIQTXPANPPPASTNRQSGRQPT
X65257_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
V01460_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MK598668_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK507912_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724250_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724248_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724234_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724230_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724229_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724228_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724227_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724226_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724225_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724224_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724221_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724220_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724215_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MH724214_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF979164_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF979160_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF979158_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF618348_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MF618341_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF618340_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
MF618339_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KY629630_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPTNPPPASTNRQSGRQPT
KX827292_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KU668446_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KU668445_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KU668442_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KU668439_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
KU668438_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KU668437_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KU668434_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KT366507_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KT366497_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KR139747_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KP165603_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP165600_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM606754_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM606744_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM577668_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM524344_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM519455_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KM108605_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF779318_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779296_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779292_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779288_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779216_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQTGRQPT
KF779214_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF679993_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF679992_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
KF170767_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF170763_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF170746_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX096954_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090716_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIRTLPANPPPASTNRQSGRQPT
JX090710_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090709_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090702_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090694_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090674_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090666_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090662_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090661_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090639_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090628_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JX090620_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090618_LHBs_P-D      KXGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN792908_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN688695_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664936_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASANRQSGRQPT
JN664920_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664914_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664913_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664911_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN664909_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN604189_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN040781_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700514_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
HQ700511_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
HQ700449_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ922005_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
GQ922002_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ922001_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNPQSGRQPT
GQ183478_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ904439_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
FJ692533_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
FJ692507_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ692506_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
FJ349209_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU594433_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594426_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
X97849_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
X72702_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MK516278_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KX357638_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQAGRQPT
KU736925_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KR905423_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP322601_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KM108593_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KF679995_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX096957_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090718_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090713_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090699_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090696_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090679_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX090625_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
JQ687530_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN664939_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN604295_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JF754597_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQNLPANPPPASTNRQSGRQPT
HQ700512_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
HQ700510_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQTGRQPT
FJ349208_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
FJ349205_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594430_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594425_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594418_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594399_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594398_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIMQTLPANPPPASTNRQSGRQPT
KU736924_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KT962025_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP165599_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
KP143744_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JX096956_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN257150_LHBs_P-D      KVGAGAFGPGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
GQ924652_LHBs_P-D      KVGAGAFGLGLTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU594423_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594420_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594419_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
EU594408_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
X97848_LHBs_P-D        KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
MN507852_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN792910_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN792909_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN792907_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
JN792904_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
EU414140_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGIIQTLPANPPPASTNRQSGRQPT
JN792903_LHBs_P-D      KVGAGAFGLGFTPPHGGLLGWSPQAQGILQTLPANPPPASTNRQSGRQPT
                         * *.                                            

JN257186_LHBs_P-D      PLSPPLRXTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
KF779382_LHBs_P-D      PLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF779228_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
KF779229_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
KF779230_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ477455_LHBs_P-D      PLTPPLGDTHPLA-QWKSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
AB222710_LHBs_P-D      PLSPPLRNTHPQA-QWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
EU787438_LHBs_P-D      PLSPPLRNTHPQA-QWNSTTFHQTLQDPRVRGLTFPAGGSSSGTVNPVPT
JX310734_LHBs_P-D      PLSPPLRNTHPQAMQWNT-TFRQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KM524340_LHBs_P-D      PLSPPLRDTHPGL-RWTSKTFHQALQDPRVRGLYLPAGGSTSGTVNPVPT
KC875298_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLY-PAGGSSSGTVNPVPT
JN257153_LHBs_P-D      PXTPPLRDTHPQA-QWXXXXFHQTLQDPRVXGLYXPAGGSSSGTVNPVPT
JN257195_LHBs_P-D      PXTPPLRDTHPQA-QWXXXXFHQTLQDPRVXGLYXPAGGSSSGTVNPVPT
JN688685_LHBs_P-D      PLTPPLRDTHPQA-QWTSSTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
DQ399006_LHBs_P-D      PLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
EU155895_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHHTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ184322_LHBs_P-D      PLSPPLRDTHPQAVQWNSTTFQQTLQDSRVRGLNLPAGGSSSGTVNPVPT
GQ167301_LHBs_P-D      PLSPPLRDTHPQAAQWNSTTFQQTLQDPRVRGLNLPAGGSSSGTVNPVPT
GQ167302_LHBs_P-D      PLSPPLRDTHPQAVQWNSTTFQQTLQDPRVRGLNLPAGGSSSGTVNPVPT
AY236162_LHBs_P-D      PLSPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
DQ304547_LHBs_P-D      PLSPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
DQ304551_LHBs_P-D      PLSPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSRTVNPVPT
DQ304548_LHBs_P-D      PLSPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
DQ304550_LHBs_P-D      PLSPPLRNTHPQATKWNSTTFHQTLQDPRVRGLYLPAGGSSSRTVNPVPT
JX470760_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
KC012652_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
DQ329356_LHBs_P-D      PLSQPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
DQ329357_LHBs_P-D      PLSQPLRNTHPQAMQWNSSTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336690_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPT
AY236160_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336691_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPT
DQ336678_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336679_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336675_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336676_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336677_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336674_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ486021_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPT
DQ464178_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPT
DQ464176_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPT
DQ464175_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPT
DQ336688_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336687_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336686_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336692_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ336689_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSETANPVPT
DQ464172_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ464173_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
DQ464174_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
DQ464177_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPT
DQ336685_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETANPVPT
AB205128_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB119255_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
DQ464168_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSEQVNPVLT
MK618436_LHBs_P-D      PLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
MK618434_LHBs_P-D      PLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
MK618435_LHBs_P-D      PLSPPLRDTQPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
MK598651_LHBs_P-D      PLSPPLRDSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598655_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598657_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY796031_LHBs_P-D      PLSPPLRDTHPQAMQWNTTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB116266_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRSLYFPAGGSSSGTVNPVPT
DQ464170_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLT
AB188242_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JQ927384_LHBs_P-D      PLSPPLRDTHPQAIXWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPT
KP168419_LHBs_P-D      PLSPPLRDTHPQAIQWNSTTFQQTLQDPRVRGLYLPAGGSSSGTVNPVPT
DQ464182_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGFSSGTVNPVPT
AB090269_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB078032_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB078031_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB078033_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB267090_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB090268_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB120308_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY233292_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY233294_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AJ627215_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AJ627216_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AJ627218_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AM422939_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLT
AY233296_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AJ627220_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB210820_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGKVNPVPT
AB205127_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AJ627222_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB188241_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
EU414138_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
EU414139_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB330369_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB493846_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY233291_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
DQ315776_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLT
AB330370_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB109478_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642144_LHBs_P-D      PLSPPLRNTHPLAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB119251_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB119252_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB119253_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598665_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN664928_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MH724238_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KX276856_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF925393_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF925383_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN604175_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRXLYXPAGGSSSGTVNPVPT
JN664918_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB109476_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB109477_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB109479_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB110075_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB119254_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB205126_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB210821_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB210822_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB471856_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB471857_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB109475_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX310727_LHBs_P-D      PPSPPLRNTHPQAIQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPT
EU155893_LHBs_P-D      PLSPPLRNTHPQAMQWNSKTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB270550_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFQQTLQDPRVKGLYFPAGGSSSGTVNPVPT
X65258_LHBs_P-D        PLSPPLRDTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY090452_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFQQTLQDPRVKGLFLPAGGSSSGTVNPVPT
AB674424_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQNPRVRGLYFPAGGSSSGTVNPVPT
MK052954_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642154_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN604139_LHBs_P-D      PLSPPLRDSHPQAVQWNSTTFHQTLQNPRVKGLHPPAGGSSSGTVNPVPT
AB674425_LHBs_P-D      PPSPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTANPVPT
AB674416_LHBs_P-D      PLTPPLRDTHPQAIQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
MF979165_LHBs_P-D      PLTPPLRNTHPQALQWNYANFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
AB555500_LHBs_P-D      PLSPPLRDTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052973_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052975_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB674406_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPT
AB048701_LHBs_P-D      PLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
MK052949_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979173_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF925366_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090680_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456665_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ183467_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
AB674428_LHBs_P-D      PLSPPLRDTHPQATQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
AB674419_LHBs_P-D      PLSPPLRNTHPQAIQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052950_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052959_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052948_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JF754617_LHBs_P-D      PLSPPLRDTHPQAMQWNTINFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456636_LHBs_P-D      PLSPPLRDTHPQAMQWNTTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPT
EF103276_LHBs_P-D      PLSPPLRNTHPQAMQWNPTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB674420_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPT
MK355501_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPVGGSSSGTVNPVPT
MK052951_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLHFPAGGSSSGTVNPVPT
MF979168_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF170768_LHBs_P-D      PLTPPLRNTHPQAIQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
JX090615_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVQT
JN040769_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
JF754631_LHBs_P-D      PQSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB674408_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB555496_LHBs_P-D      PLSPPLRETHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK618429_LHBs_P-D      PLSPPLINTHPHAMQWNSTTFHQTLQDPSVRGLYFPAGGSSSGTVNPVPT
MK618430_LHBs_P-D      PLSPPLINTHPHAMQWNSTTFHQTLQDPSVRGLYFPGGGSSSGTVNPVPS
MK052953_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPT
KM108595_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
DQ486025_LHBs_P-D      PLSPPLRNTHPQAVQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
AY741798_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
AB330367_LHBs_P-D      PLSPPLRVTHPQAMQWNSTTFHQTLQDSRVRGLYFPAGGSSSGTVNPVPT
AF043593_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVR----PAGGSSSGTVNPVPT
JF439709_LHBs_P-D      PLSPPLRSTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439706_LHBs_P-D      PLSSPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439711_LHBs_P-D      PLSSPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439699_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439700_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439701_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439704_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439705_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439710_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439718_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439708_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439692_LHBs_P-D      PLSPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JF439703_LHBs_P-D      PLSPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
MK052947_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979155_LHBs_P-D      PLSPPLRNTHPQAMQWNFATFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
JX310735_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFRKTLQDPRVRGLYFPAGGFSSGTVNPVPT
JN040753_LHBs_P-D      PLTPPLRDTHPQAMQWNSTTFHQTLQNPRVKGLYIPAGGSSSGTVNPVPT
JF754588_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JF439696_LHBs_P-D      PLSPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
GQ183465_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183448_LHBs_P-D      PLSPPLRNTHPQAMQWNSTIFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
AY090453_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AJ627219_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AF151735_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB674423_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPT
AB188244_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052955_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052956_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052958_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052960_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052971_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052963_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052966_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052974_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052961_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052952_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979166_LHBs_P-D      PLSPPLRDTHPQAMQWNSATFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
KM108596_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KM108592_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090690_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642163_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642149_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPT
JN040775_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPN
GU456657_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
DQ464169_LHBs_P-D      RLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLT
AB104710_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB090270_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRGRGLYFPAGGSSSGTVNPVPT
KF471655_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090712_LHBs_P-D      PLSPPLRITHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090611_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090609_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPT
JN642158_LHBs_P-D      PPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN257201_LHBs_P-D      PLSPPLRDTHPQAMQWGSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
JF754629_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JF754626_LHBs_P-D      PLSPPLRDTHPQAIQWNSRNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ477458_LHBs_P-D      PPTLPLRHTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
FJ349215_LHBs_P-D      TLSPPLRNTHHQAMKWNSTTFHQTLQDPRVKGLNLPAGGSSSGTGNPVPT
EF103281_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRGEGLYFPAGGSSSGTVNPVPT
DQ111986_LHBs_P-D      PPSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
AY161150_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AF280817_LHBs_P-D      PLSPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB555497_LHBs_P-D      PLSPPLRETHPQAMQWKSTNFQQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB126581_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB104711_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979171_LHBs_P-D      PMSPPLRD--PQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JQ707690_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGFSSGTVNPVPT
JQ707683_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707697_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707699_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707702_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707706_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707682_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707684_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707685_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707687_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707688_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707691_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707692_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707693_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707694_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707695_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707696_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707698_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707700_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707701_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707703_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707704_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707705_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JQ707686_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
KX276857_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPT
KF471659_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPT
JX096955_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090635_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPT
JX090634_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFQQTLQDPRVRGLYFPAGGSSTGTVNPVPT
JX090610_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JQ707689_LHBs_P-D      PLSPPLRNTHPQAIQWNYKTFHQTLQDPKVSGLYFPAGGSSSGTVNPVPT
JN688711_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRLIGLDVSAGGSSSGTVNPVPT
JN642133_LHBs_P-D      PLSPPLRNTHPQAVQWNSTAFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
JN604259_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN604239_LHBs_P-D      PLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSXTVNPVPT
GU456678_LHBs_P-D      PLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ183468_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183466_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183464_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183463_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183462_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183458_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183457_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183455_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183454_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183453_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183452_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183451_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183450_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183449_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
AB674411_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB270546_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB674431_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVKGLYFPAGGSSSGTVNPVPT
AY741794_LHBs_P-D      PPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY741795_LHBs_P-D      PPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY741796_LHBs_P-D      PPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB222711_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB246347_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
EU414135_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQBPXVRGLYFPAGGSSSGTVNPVPT
AY721607_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB270548_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB270542_LHBs_P-D      PXTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPT
AB270543_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB222709_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
EU414136_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB104712_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AF121240_LHBs_C-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AF121241_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AJ627224_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY741797_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AF121239_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598670_LHBs_P-D      PLSPSLTDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598661_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK052972_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979157_LHBs_P-D      PLXPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF925391_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVSGLNFPAGGSSSGTVNPVPT
KT366465_LHBs_P-D      PLSPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN664932_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPT
JN664931_LHBs_P-D      PLSPPLRITHPQAIQWNSTTFQQSLQDPKVRGLYFPAGGSSSGTVNPVPT
JN664926_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYLPAGGSTSGTVNPVPT
JN642150_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPAPT
JN040782_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPT
JN040771_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPT
JF754633_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
JF754611_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
HQ833469_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
HQ700444_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456684_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456661_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLFFPAGGSSSGTVNPVPT
GU456654_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPT
GU456645_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456643_LHBs_P-D      PLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ205384_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPT
GQ183456_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
FJ899792_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPT
FJ349213_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
EU939681_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRDLYLPAGGSSSGTVNPVPT
AY945307_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY796032_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AJ627223_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVTPVPT
AB674427_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB674407_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPT
AB555501_LHBs_P-D      PLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB270547_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MH724236_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF618349_LHBs_P-D      PLPPPLRITLPQAMQWNSTAFHQVLQDPRVRGLYFPAGGSSSGTVNPVPT
KX827291_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KX276998_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KJ647350_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF053178_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPT
KC875333_LHBs_P-D      PLTPPLRNTHPHAMQWNSTTFHQTLQDPRVRGLYFPAGRSSSGTVNPVPT
JX090689_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090677_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090636_LHBs_P-D      PVSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGTVNPVPT
JX090616_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642164_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQPLQDPKVSDQYFPAGGSSSGTVNPVPT
JN642131_LHBs_P-D      PLSPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDPVPT
JN642126_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPT
JN604250_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
JN040822_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPVGGSSSGTVNPVPT
JN040773_LHBs_P-D      PLSPPLRNTHPQAMQWNSATFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456679_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456673_LHBs_P-D      PPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456666_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456653_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPT
GU456639_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
FJ904419_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
FJ349219_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AJ344116_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
AJ131956_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
AF043594_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB270539_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB104709_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB222712_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB222713_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB674422_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY661792_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY661793_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY721605_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY721606_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY721608_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY721612_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTYHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KM577670_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVTPVPT
L27106_LHBs_P-D        PLTPPLRDTHPQAMHWNYTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KX357639_LHBs_P-D      PLSPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KP090179_LHBs_P-D      PLSPPLRNTHPQDMGRNSTTFHQTLQDPRVRGLYFRVGGSSSGTVNPVPT
KM524341_LHBs_P-D      PLSPPSRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPT
KJ843187_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
KJ470896_LHBs_P-D      PXSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF471654_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPT
KF471644_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF471640_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVKDLYFPAGGSSSGTVNPVPT
KF170756_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDHRVRGLYFPAGGSSSGTVNPVPT
JX090688_LHBs_P-D      PLSPPLRDTHPQVAQWNFTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPT
JN642157_LHBs_P-D      PLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642146_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVPT
JN642143_LHBs_P-D      PLSPPLRETHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642140_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642138_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
JN257148_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040823_LHBs_P-D      PPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040810_LHBs_P-D      PLTPPLRDTHPQSMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040801_LHBs_P-D      PLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
JN040790_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
JN040787_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPT
JN040784_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
HQ700472_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFRQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GU456656_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ183459_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
FJ904438_LHBs_P-D      PLSPPIRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
FJ904418_LHBs_P-D      PLTPPLRNTHPQAMQWNSTPFHQTLQDPKVSDLYFPAGGSSSGTVNPVPT
AY796030_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB246348_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875342_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQGLQDPRVRGLYFPAGGSSSGTVNPVPT
KX196229_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQGLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ205385_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPT
GQ205388_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPT
GQ205389_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPT
KC875340_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPT
KM524345_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPT
MF618342_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPT
MK693109_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLT
MK598675_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRERGLYFPAGGSSSGTVNPVPT
MH724241_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979175_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KM606755_LHBs_P-D      PLSPPLRNTHPHAMQWNSTTFPQTLQDPRVRGLYVPAGGSSSGTVNPVPT
KM524338_LHBs_P-D      PLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KJ470893_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF679990_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF471642_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
KF170774_LHBs_P-D      PLSPPLRNTHPQAIQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
KF170771_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYSLAGGSSSGTVNPVPT
JX090724_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPT
JX090723_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRDLYFPAGGSSSGIVNPVPT
JX090629_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090624_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN664941_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTPNPVPT
JN604318_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
JN604275_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JN040786_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040779_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVTGLYFPAGGSSSGTVNPVPT
JN040767_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JF754635_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JF754612_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
HQ833465_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456682_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHRTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456675_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456674_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456669_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456664_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456659_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456652_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456649_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ922000_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ183479_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ183469_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
GQ183460_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
FJ562338_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
EU787443_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPT
EF103275_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY161158_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AY161157_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AF121242_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB674405_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB583680_LHBs_P-D      PLSPPLRDTHPQAMKWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
X80926_LHBs_P-D        PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
X80924_LHBs_P-D        PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK618433_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPS
MK598664_LHBs_P-D      PLSPPLRDTHPHAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598662_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK541688_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MH724251_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
M32138_LHBs_P-D        PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
KX196227_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KX196214_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KX196208_LHBs_P-D      PLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KU668448_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPT
KP165597_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KP143743_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KP143742_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF779289_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
KF779225_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
KF476030_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPT
KF061169_LHBs_P-D      PLSPPLRXTHPQAMQWXXTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPT
KC875276_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX310733_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090644_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN792906_LHBs_P-D      PLSPPLRNTYPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN664930_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN664919_LHBs_P-D      PLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN604120_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN257165_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVQT
JN257160_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQBPXVRGLYFPAGGSSSGTVNPVPT
JN257159_LHBs_P-D      PLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPT
JN040812_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
JN040799_LHBs_P-D      PLSPPLRDTHPQAMQWNSKTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040791_LHBs_P-D      PLSPPLRNTHPQAMQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040788_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040762_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPT
JF754634_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456635_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKSLYLPAGGSSSGTVTPVPT
GU357846_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ205382_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPT
FJ349235_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
FJ349218_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
AB270541_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
JN370954_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN604152_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTXNPVPT
JN642159_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK693108_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK618432_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPT
MK598678_LHBs_P-D      PQSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598676_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598666_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDHRVRGLYFPAGGSSSGTVNPVPT
MK598650_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPT
MK598647_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPT
MK598641_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598637_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK355500_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979174_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPT
KX196233_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLRDPRVRGLYFPAGGSSSGTVNPVPT
KX196225_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
KX196224_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
KT151620_LHBs_P-D      PLSPPLRNTHPQAMQWXXTTFHQTLQDPRVRGLSFPAGGSSSGAVNPVPT
KM108599_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLSFPAGGSSSGTVNPVPT
KJ647353_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KJ470894_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF779222_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF779219_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF476029_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF471641_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQNLQDPRVKGLYFPAGGSSSGTVNPVPT
KF170761_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF061170_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875328_LHBs_P-D      PLSPPLRNTHSQAMQWNSTTFHQTLQDSRVRGLYFPAGGSSSGTVNPVPT
KC875323_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
KC875322_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
KC875316_LHBs_P-D      PLSPPLRYTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875289_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
KC875285_LHBs_P-D      PLSPPLRKTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875282_LHBs_P-D      PLSPPLRNTHPHAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875279_LHBs_P-D      PLSPPLRNTHPQTMQWNSTTFRQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX310726_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPI
JX090647_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090641_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPT
JX090622_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX036334_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLHDPRVRGLYFPAGGSSSGTVNPVPT
JQ707529_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JQ707517_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JQ707515_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JQ707513_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JQ707480_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642166_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642161_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642151_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642142_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642135_LHBs_P-D      PLTPPLRITHPHTMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642134_LHBs_P-D      PLSPPLRNTHPQAVQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN642132_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN604301_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JN257202_LHBs_P-D      PLSPPLRETHPQAMQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPT
JN257200_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFQQTLQDPRVRGLYSPAGGSSSGTVNPVPT
JN040830_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040821_LHBs_P-D      PLSPPLRNTHPQAMQWNTTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
JN040819_LHBs_P-D      PPSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040809_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLHFPAGGSSSGTVNPVPT
JN040800_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040795_LHBs_P-D      PLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040770_LHBs_P-D      PLSPPLRNTHPQAMQWNFTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040768_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040766_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
JF754623_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLNLPAGGSSSGTVNPVPT
JF754619_LHBs_P-D      PLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JF754609_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JF754603_LHBs_P-D      PLSPPLRNTHPQALQWNSTTFHNTLQDPRVRGLYFPAGGSSSGTVNPVPT
JF754602_LHBs_P-D      PLSPPLRNTHPQAIQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
HQ700463_LHBs_P-D      PLSPPLRNTHPQAMQWNATTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
HQ236015_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTIHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456655_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPT
GU456650_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ922003_LHBs_P-D      PLSPPLRVTYPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ477456_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ205380_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ183461_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
FJ904395_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTINPVPT
EU594402_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSRTVNPVPT
EU594401_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN370953_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN370952_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN370951_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN370950_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN370949_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MN507838_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK618443_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
MK618441_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
MK618437_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK618431_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598679_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598660_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPT
MK598646_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDTRVRGLYFPAGGSSSGTVNPVPT
MK598645_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSETVNPVPT
MK598644_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598643_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598640_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MH724242_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MH724235_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979167_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979163_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVPT
MF979162_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979161_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MF979156_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
LT992439_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPT
KX357622_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPT
KX196228_LHBs_P-D      PLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KX196215_LHBs_P-D      PLSPPLRNTHPQAMQLNSTTFHQTLQEPRVRGLYFPAGGSSSGTVNPVPT
KX196211_LHBs_P-D      PLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KU668435_LHBs_P-D      PLSPPLRDTHPQAMQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLT
KR139748_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KP165604_LHBs_P-D      PLSPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KM524358_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KM524354_LHBs_P-D      PLSPPLRKTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF779376_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
KF779341_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
KF779302_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGAVNPVPT
KF679989_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF192834_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF192832_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF192831_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF192830_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF170770_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
KC875331_LHBs_P-D      PLSPPLRNTLPQPMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875329_LHBs_P-D      PLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875315_LHBs_P-D      PLSPPLRITHPQAMQWNSRTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875296_LHBs_P-D      PLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875288_LHBs_P-D      PLTPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX898689_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JX090720_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090719_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090708_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090707_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
JX090703_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090701_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
JX090672_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090667_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090656_LHBs_P-D      PLTPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090646_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090619_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090606_LHBs_P-D      PLSQPLRNTHPQAMKWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN688712_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN688678_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN664924_LHBs_P-D      PLSPPLRNTHPHAMQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPT
JN664922_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPT
JN642165_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN604265_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN604263_LHBs_P-D      PLSPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDPVPT
JN604170_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPT
JN257183_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYXPAGGSSSGTVNPVPT
JN257172_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPT
JN040824_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
JN040815_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040814_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040777_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPT
JN040765_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JN040758_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPT
HQ700474_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
HQ700458_LHBs_P-D      PLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456683_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456680_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPT
GU456668_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456667_LHBs_P-D      PLSPPLRNSHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GU456658_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
GQ183476_LHBs_P-D      PLSPPLRNTHPQAMQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
FJ904431_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
FJ904410_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPT
EU787442_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
EU787441_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
EU594434_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYYPAGGSSSGTVNPVPT
EF103277_LHBs_P-D      PLSPPLRNTHPQAMQWNSPNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598659_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598642_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598639_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
MK598636_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPS
MH724219_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPI
MH724218_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPI
LT992454_LHBs_P-D      PLSPPLRTTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
LT992444_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KX196222_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KX196219_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPT
KX196212_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KX196209_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KU736926_LHBs_P-D      PLSPPLRBTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KP995100_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPT
KP090178_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPI
KP090177_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPI
KM577669_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KM524356_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KM212957_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KJ647355_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYQPAGGSSSGTVNPVPT
KF779301_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSTGAVNPVPT
KF471647_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KF061168_LHBs_P-D      PLSPPLRXTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDRVPT
KF061167_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDRVPT
KC875301_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875295_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875292_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
KC875290_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTLHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090721_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090700_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVHPVPT
JX090697_LHBs_P-D      PLSPPLRNTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090682_LHBs_P-D      PLSPPLRDTHPQAMQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPT
JX090640_LHBs_P-D      PLSPPLRNTHPQAMQWNST