HBVdb

Dataset for protein HBe of genotype all

[Download (right click)] [Alignment] [Repertoires]

10773 sequence(s)

>gnl|hbvpro|AB014370_HBe_P-A Product feature CHAIN AB014370_HBe_P-A of FT:mat_peptide AB014370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB064314_HBe_P-A Product feature CHAIN AB064314_HBe_P-A of FT:mat_peptide AB064314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB076678_HBe_P-A Product feature CHAIN AB076678_HBe_P-A of FT:mat_peptide AB076678_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB076679_HBe_P-A Product feature CHAIN AB076679_HBe_P-A of FT:mat_peptide AB076679_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-Mala35). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELTTLAT
WVGNNLEDHASRDLVVNYVNDNMGLKLRQLLWFHISCLTFGKQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGG
>gnl|hbvpro|AB116076_HBe_P-A Product feature CHAIN AB116076_HBe_P-A of FT:mat_peptide AB116076_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA1911). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|AB116077_HBe_P-A Product feature CHAIN AB116077_HBe_P-A of FT:mat_peptide AB116077_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA2126). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116078_HBe_P-A Product feature CHAIN AB116078_HBe_P-A of FT:mat_peptide AB116078_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-USA712). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116079_HBe_P-A Product feature CHAIN AB116079_HBe_P-A of FT:mat_peptide AB116079_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116080_HBe_P-A Product feature CHAIN AB116080_HBe_P-A of FT:mat_peptide AB116080_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116081_HBe_P-A Product feature CHAIN AB116081_HBe_P-A of FT:mat_peptide AB116081_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TR3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116082_HBe_P-A Product feature CHAIN AB116082_HBe_P-A of FT:mat_peptide AB116082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
CRNRGR
>gnl|hbvpro|AB116083_HBe_P-A Product feature CHAIN AB116083_HBe_P-A of FT:mat_peptide AB116083_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN36). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116084_HBe_P-A Product feature CHAIN AB116084_HBe_P-A of FT:mat_peptide AB116084_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN81). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116085_HBe_P-A Product feature CHAIN AB116085_HBe_P-A of FT:mat_peptide AB116085_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-BAN83). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116086_HBe_P-A Product feature CHAIN AB116086_HBe_P-A of FT:mat_peptide AB116086_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND18). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATADLLSFLPSDFFPSVQDLLDTASALYREALESPVHCSPHHTALRQAILCWGELRTLGT
WVGNNLDDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116087_HBe_P-A Product feature CHAIN AB116087_HBe_P-A of FT:mat_peptide AB116087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-IND8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSRHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVR
RRVRGR
>gnl|hbvpro|AB116088_HBe_P-A Product feature CHAIN AB116088_HBe_P-A of FT:mat_peptide AB116088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP30). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAIVCWGELMTLGT
WVGNNLEDPESRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGRGR
>gnl|hbvpro|AB116089_HBe_P-A Product feature CHAIN AB116089_HBe_P-A of FT:mat_peptide AB116089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP39). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQASLCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116090_HBe_P-A Product feature CHAIN AB116090_HBe_P-A of FT:mat_peptide AB116090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-NEP40). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116091_HBe_P-A Product feature CHAIN AB116091_HBe_P-A of FT:mat_peptide AB116091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116092_HBe_P-A Product feature CHAIN AB116092_HBe_P-A of FT:mat_peptide AB116092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH20). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVAALFRDALESPEHCSAHHTALRQVILCWGELMTLAT
WVGTNLQDPASRDLVVSYVNDNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116093_HBe_P-A Product feature CHAIN AB116093_HBe_P-A of FT:mat_peptide AB116093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB116094_HBe_P-A Product feature CHAIN AB116094_HBe_P-A of FT:mat_peptide AB116094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-PH4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB126580_HBe_P-A Product feature CHAIN AB126580_HBe_P-A of FT:mat_peptide AB126580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-RU204). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB194950_HBe_P-A Product feature CHAIN AB194950_HBe_P-A of FT:mat_peptide AB194950_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB194951_HBe_P-A Product feature CHAIN AB194951_HBe_P-A of FT:mat_peptide AB194951_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB194952_HBe_P-A Product feature CHAIN AB194952_HBe_P-A of FT:mat_peptide AB194952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB205118_HBe_P-A Product feature CHAIN AB205118_HBe_P-A of FT:mat_peptide AB205118_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-TJ1-1-2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB222707_HBe_P-A Product feature CHAIN AB222707_HBe_P-A of FT:mat_peptide AB222707_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB241114_HBe_P-A Product feature CHAIN AB241114_HBe_P-A of FT:mat_peptide AB241114_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB241115_HBe_P-A Product feature CHAIN AB241115_HBe_P-A of FT:mat_peptide AB241115_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB246317_HBe_P-A Product feature CHAIN AB246317_HBe_P-A of FT:mat_peptide AB246317_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TA112). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKVRQLLWFHISCITFGRQTVGEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB246335_HBe_P-A Product feature CHAIN AB246335_HBe_P-A of FT:mat_peptide AB246335_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB246336_HBe_P-A Product feature CHAIN AB246336_HBe_P-A of FT:mat_peptide AB246336_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB246337_HBe_P-A Product feature CHAIN AB246337_HBe_P-A of FT:mat_peptide AB246337_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB246338_HBe_P-A Product feature CHAIN AB246338_HBe_P-A of FT:mat_peptide AB246338_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB300366_HBe_P-A Product feature CHAIN AB300366_HBe_P-A of FT:mat_peptide AB300366_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB300367_HBe_P-A Product feature CHAIN AB300367_HBe_P-A of FT:mat_peptide AB300367_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB362931_HBe_P-A Product feature CHAIN AB362931_HBe_P-A of FT:mat_peptide AB362931_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB453979_HBe_P-A Product feature CHAIN AB453979_HBe_P-A of FT:mat_peptide AB453979_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB453980_HBe_P-A Product feature CHAIN AB453980_HBe_P-A of FT:mat_peptide AB453980_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB453981_HBe_P-A Product feature CHAIN AB453981_HBe_P-A of FT:mat_peptide AB453981_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB453982_HBe_P-A Product feature CHAIN AB453982_HBe_P-A of FT:mat_peptide AB453982_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELTTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|AB453984_HBe_P-A Product feature CHAIN AB453984_HBe_P-A of FT:mat_peptide AB453984_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB453986_HBe_P-A Product feature CHAIN AB453986_HBe_P-A of FT:mat_peptide AB453986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLQDQTSRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB453987_HBe_P-A Product feature CHAIN AB453987_HBe_P-A of FT:mat_peptide AB453987_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB453988_HBe_P-A Product feature CHAIN AB453988_HBe_P-A of FT:mat_peptide AB453988_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB453989_HBe_P-A Product feature CHAIN AB453989_HBe_P-A of FT:mat_peptide AB453989_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRYRGR
>gnl|hbvpro|AB480036_HBe_P-A Product feature CHAIN AB480036_HBe_P-A of FT:mat_peptide AB480036_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB480038_HBe_P-A Product feature CHAIN AB480038_HBe_P-A of FT:mat_peptide AB480038_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB480039_HBe_P-A Product feature CHAIN AB480039_HBe_P-A of FT:mat_peptide AB480039_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB480040_HBe_P-A Product feature CHAIN AB480040_HBe_P-A of FT:mat_peptide AB480040_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB480041_HBe_P-A Product feature CHAIN AB480041_HBe_P-A of FT:mat_peptide AB480041_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB549213_HBe_P-A Product feature CHAIN AB549213_HBe_P-A of FT:mat_peptide AB549213_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697487_HBe_P-A Product feature CHAIN AB697487_HBe_P-A of FT:mat_peptide AB697487_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGAXVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMXLAT
WVGXNLEDPASRXLVVXYVNXNMGLKIRQLLWFHXSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697488_HBe_P-A Product feature CHAIN AB697488_HBe_P-A of FT:mat_peptide AB697488_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697489_HBe_P-A Product feature CHAIN AB697489_HBe_P-A of FT:mat_peptide AB697489_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697491_HBe_P-A Product feature CHAIN AB697491_HBe_P-A of FT:mat_peptide AB697491_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697492_HBe_P-A Product feature CHAIN AB697492_HBe_P-A of FT:mat_peptide AB697492_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697493_HBe_P-A Product feature CHAIN AB697493_HBe_P-A of FT:mat_peptide AB697493_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697495_HBe_P-A Product feature CHAIN AB697495_HBe_P-A of FT:mat_peptide AB697495_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697496_HBe_P-A Product feature CHAIN AB697496_HBe_P-A of FT:mat_peptide AB697496_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697497_HBe_P-A Product feature CHAIN AB697497_HBe_P-A of FT:mat_peptide AB697497_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697499_HBe_P-A Product feature CHAIN AB697499_HBe_P-A of FT:mat_peptide AB697499_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697501_HBe_P-A Product feature CHAIN AB697501_HBe_P-A of FT:mat_peptide AB697501_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697503_HBe_P-A Product feature CHAIN AB697503_HBe_P-A of FT:mat_peptide AB697503_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697504_HBe_P-A Product feature CHAIN AB697504_HBe_P-A of FT:mat_peptide AB697504_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697505_HBe_P-A Product feature CHAIN AB697505_HBe_P-A of FT:mat_peptide AB697505_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697506_HBe_P-A Product feature CHAIN AB697506_HBe_P-A of FT:mat_peptide AB697506_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697507_HBe_P-A Product feature CHAIN AB697507_HBe_P-A of FT:mat_peptide AB697507_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697508_HBe_P-A Product feature CHAIN AB697508_HBe_P-A of FT:mat_peptide AB697508_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697509_HBe_P-A Product feature CHAIN AB697509_HBe_P-A of FT:mat_peptide AB697509_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697511_HBe_P-A Product feature CHAIN AB697511_HBe_P-A of FT:mat_peptide AB697511_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB697512_HBe_P-A Product feature CHAIN AB697512_HBe_P-A of FT:mat_peptide AB697512_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB775198_HBe_P-A Product feature CHAIN AB775198_HBe_P-A of FT:mat_peptide AB775198_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0707). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB775199_HBe_P-A Product feature CHAIN AB775199_HBe_P-A of FT:mat_peptide AB775199_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10-0708). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB775200_HBe_P-A Product feature CHAIN AB775200_HBe_P-A of FT:mat_peptide AB775200_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0925). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB775201_HBe_P-A Product feature CHAIN AB775201_HBe_P-A of FT:mat_peptide AB775201_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12-0929). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB937791_HBe_P-A Product feature CHAIN AB937791_HBe_P-A of FT:mat_peptide AB937791_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05-0890). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB937792_HBe_P-A Product feature CHAIN AB937792_HBe_P-A of FT:mat_peptide AB937792_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1205). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB937793_HBe_P-A Product feature CHAIN AB937793_HBe_P-A of FT:mat_peptide AB937793_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0302). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB937794_HBe_P-A Product feature CHAIN AB937794_HBe_P-A of FT:mat_peptide AB937794_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-0666). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB937795_HBe_P-A Product feature CHAIN AB937795_HBe_P-A of FT:mat_peptide AB937795_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1191). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB937796_HBe_P-A Product feature CHAIN AB937796_HBe_P-A of FT:mat_peptide AB937796_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1196). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB937797_HBe_P-A Product feature CHAIN AB937797_HBe_P-A of FT:mat_peptide AB937797_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13-1204). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVKDLLDTASALYRDALESPEHCSAHHTALRQVSLCWVELMTLAT
WVGNNLQDPASRDQVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVXR
RRDRGR
>gnl|hbvpro|AB937798_HBe_P-A Product feature CHAIN AB937798_HBe_P-A of FT:mat_peptide AB937798_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0383). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF043560_HBe_P-A Product feature CHAIN AF043560_HBe_P-A of FT:mat_peptide AF043560_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF043580_HBe_P-A Product feature CHAIN AF043580_HBe_P-A of FT:mat_peptide AF043580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF090839_HBe_P-A Product feature CHAIN AF090839_HBe_P-A of FT:mat_peptide AF090839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF090840_HBe_P-A Product feature CHAIN AF090840_HBe_P-A of FT:mat_peptide AF090840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF090841_HBe_P-A Product feature CHAIN AF090841_HBe_P-A of FT:mat_peptide AF090841_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF090842_HBe_P-A Product feature CHAIN AF090842_HBe_P-A of FT:mat_peptide AF090842_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF297622_HBe_P-A Product feature CHAIN AF297622_HBe_P-A of FT:mat_peptide AF297622_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF297623_HBe_P-A Product feature CHAIN AF297623_HBe_P-A of FT:mat_peptide AF297623_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 83). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF297624_HBe_P-A Product feature CHAIN AF297624_HBe_P-A of FT:mat_peptide AF297624_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF297625_HBe_P-A Product feature CHAIN AF297625_HBe_P-A of FT:mat_peptide AF297625_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRETILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350080_HBe_P-A Product feature CHAIN AF350080_HBe_P-A of FT:mat_peptide AF350080_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1196). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350081_HBe_P-A Product feature CHAIN AF350081_HBe_P-A of FT:mat_peptide AF350081_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1199). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVPDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTLPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350082_HBe_P-A Product feature CHAIN AF350082_HBe_P-A of FT:mat_peptide AF350082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1213). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350083_HBe_P-A Product feature CHAIN AF350083_HBe_P-A of FT:mat_peptide AF350083_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1314F79). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350084_HBe_P-A Product feature CHAIN AF350084_HBe_P-A of FT:mat_peptide AF350084_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1315F80). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350085_HBe_P-A Product feature CHAIN AF350085_HBe_P-A of FT:mat_peptide AF350085_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1316F79). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350086_HBe_P-A Product feature CHAIN AF350086_HBe_P-A of FT:mat_peptide AF350086_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1330F80). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350087_HBe_P-A Product feature CHAIN AF350087_HBe_P-A of FT:mat_peptide AF350087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1486F125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALNREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350088_HBe_P-A Product feature CHAIN AF350088_HBe_P-A of FT:mat_peptide AF350088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1487F125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350089_HBe_P-A Product feature CHAIN AF350089_HBe_P-A of FT:mat_peptide AF350089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1606). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350090_HBe_P-A Product feature CHAIN AF350090_HBe_P-A of FT:mat_peptide AF350090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1687). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350091_HBe_P-A Product feature CHAIN AF350091_HBe_P-A of FT:mat_peptide AF350091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1730F202). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350092_HBe_P-A Product feature CHAIN AF350092_HBe_P-A of FT:mat_peptide AF350092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1746). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350093_HBe_P-A Product feature CHAIN AF350093_HBe_P-A of FT:mat_peptide AF350093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1747). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350094_HBe_P-A Product feature CHAIN AF350094_HBe_P-A of FT:mat_peptide AF350094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1800). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350095_HBe_P-A Product feature CHAIN AF350095_HBe_P-A of FT:mat_peptide AF350095_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1815F214). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350096_HBe_P-A Product feature CHAIN AF350096_HBe_P-A of FT:mat_peptide AF350096_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1817F214). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350097_HBe_P-A Product feature CHAIN AF350097_HBe_P-A of FT:mat_peptide AF350097_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1835F222). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF350098_HBe_P-A Product feature CHAIN AF350098_HBe_P-A of FT:mat_peptide AF350098_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1841F222). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF419534_HBe_P-A Product feature CHAIN AF419534_HBe_P-A of FT:mat_peptide AF419534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I5-Fam B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHSSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|AF419535_HBe_P-A Product feature CHAIN AF419535_HBe_P-A of FT:mat_peptide AF419535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I6-Fam B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTXCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|AF419536_HBe_P-A Product feature CHAIN AF419536_HBe_P-A of FT:mat_peptide AF419536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I7-Fam B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTVSALYREALESPEHCSPHHTAIRQAILCWGQLMTLAT
WVGNNLQDPASRDLVVNYVNDNMGLMIRQLLWFHSSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRHRGR
>gnl|hbvpro|AF536524_HBe_P-A Product feature CHAIN AF536524_HBe_P-A of FT:mat_peptide AF536524_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASTLYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF537371_HBe_P-A Product feature CHAIN AF537371_HBe_P-A of FT:mat_peptide AF537371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AF537372_HBe_P-A Product feature CHAIN AF537372_HBe_P-A of FT:mat_peptide AF537372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
CRGRGR
>gnl|hbvpro|AJ012207_HBe_P-A Product feature CHAIN AJ012207_HBe_P-A of FT:mat_peptide AJ012207_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AJ309369_HBe_P-A Product feature CHAIN AJ309369_HBe_P-A of FT:mat_peptide AJ309369_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|AJ309370_HBe_P-A Product feature CHAIN AJ309370_HBe_P-A of FT:mat_peptide AJ309370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|AJ309371_HBe_P-A Product feature CHAIN AJ309371_HBe_P-A of FT:mat_peptide AJ309371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient X104). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRIPPPYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|AJ344115_HBe_P-A Product feature CHAIN AJ344115_HBe_P-A of FT:mat_peptide AJ344115_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBsAg negative patient X27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKDTVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVR
RRDRGR
>gnl|hbvpro|AJ627226_HBe_P-A Product feature CHAIN AJ627226_HBe_P-A of FT:mat_peptide AJ627226_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20952). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPPDFFPSARDLLDTASALFRDALESPEHCSAHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHLSCIMFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AJ627228_HBe_P-A Product feature CHAIN AJ627228_HBe_P-A of FT:mat_peptide AJ627228_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 34408). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQCVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPAYRPPNAPILSILPETTVVR
RRDRGR
>gnl|hbvpro|AM180624_HBe_P-A Product feature CHAIN AM180624_HBe_P-A of FT:mat_peptide AM180624_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHGSXHHTAXRQAILCWGXVMTLAT
WVGXNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AM184125_HBe_P-A Product feature CHAIN AM184125_HBe_P-A of FT:mat_peptide AM184125_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AM184126_HBe_P-A Product feature CHAIN AM184126_HBe_P-A of FT:mat_peptide AM184126_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AM282986_HBe_P-A Product feature CHAIN AM282986_HBe_P-A of FT:mat_peptide AM282986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AM295795_HBe_P-A Product feature CHAIN AM295795_HBe_P-A of FT:mat_peptide AM295795_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AM295797_HBe_P-A Product feature CHAIN AM295797_HBe_P-A of FT:mat_peptide AM295797_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AM410963_HBe_P-A Product feature CHAIN AM410963_HBe_P-A of FT:mat_peptide AM410963_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AM494718_HBe_P-A Product feature CHAIN AM494718_HBe_P-A of FT:mat_peptide AM494718_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY034878_HBe_P-A Product feature CHAIN AY034878_HBe_P-A of FT:mat_peptide AY034878_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLDDPASKDLVVNYVNTKHGLKIRQLLWVHTSCLTFGRETVLEYLVSFGVWIRTPPAYRTTNAPILSTLPEATVVR
QRDRRR
>gnl|hbvpro|AY128092_HBe_P-A Product feature CHAIN AY128092_HBe_P-A of FT:mat_peptide AY128092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY152726_HBe_P-A Product feature CHAIN AY152726_HBe_P-A of FT:mat_peptide AY152726_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8.22). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVVR
RRDRGR
>gnl|hbvpro|AY161138_HBe_P-A Product feature CHAIN AY161138_HBe_P-A of FT:mat_peptide AY161138_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY161139_HBe_P-A Product feature CHAIN AY161139_HBe_P-A of FT:mat_peptide AY161139_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY161142_HBe_P-A Product feature CHAIN AY161142_HBe_P-A of FT:mat_peptide AY161142_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVWIRTPPAYRPPNAPILSALPETTVVR
RRDRGR
>gnl|hbvpro|AY161143_HBe_P-A Product feature CHAIN AY161143_HBe_P-A of FT:mat_peptide AY161143_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVWIRTPPAYRPPNAPILSALPETTVVR
RRDRGR
>gnl|hbvpro|AY161144_HBe_P-A Product feature CHAIN AY161144_HBe_P-A of FT:mat_peptide AY161144_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVWIRTPPAYRPPNAPILSALPETTVVR
RRDRGR
>gnl|hbvpro|AY233274_HBe_P-A Product feature CHAIN AY233274_HBe_P-A of FT:mat_peptide AY233274_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233275_HBe_P-A Product feature CHAIN AY233275_HBe_P-A of FT:mat_peptide AY233275_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233276_HBe_P-A Product feature CHAIN AY233276_HBe_P-A of FT:mat_peptide AY233276_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233278_HBe_P-A Product feature CHAIN AY233278_HBe_P-A of FT:mat_peptide AY233278_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233279_HBe_P-A Product feature CHAIN AY233279_HBe_P-A of FT:mat_peptide AY233279_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAHRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233280_HBe_P-A Product feature CHAIN AY233280_HBe_P-A of FT:mat_peptide AY233280_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233281_HBe_P-A Product feature CHAIN AY233281_HBe_P-A of FT:mat_peptide AY233281_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233282_HBe_P-A Product feature CHAIN AY233282_HBe_P-A of FT:mat_peptide AY233282_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233283_HBe_P-A Product feature CHAIN AY233283_HBe_P-A of FT:mat_peptide AY233283_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233284_HBe_P-A Product feature CHAIN AY233284_HBe_P-A of FT:mat_peptide AY233284_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233285_HBe_P-A Product feature CHAIN AY233285_HBe_P-A of FT:mat_peptide AY233285_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAQYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233286_HBe_P-A Product feature CHAIN AY233286_HBe_P-A of FT:mat_peptide AY233286_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233287_HBe_P-A Product feature CHAIN AY233287_HBe_P-A of FT:mat_peptide AY233287_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMALAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233288_HBe_P-A Product feature CHAIN AY233288_HBe_P-A of FT:mat_peptide AY233288_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233289_HBe_P-A Product feature CHAIN AY233289_HBe_P-A of FT:mat_peptide AY233289_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY233290_HBe_P-A Product feature CHAIN AY233290_HBe_P-A of FT:mat_peptide AY233290_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAS
WVGNNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY373428_HBe_P-A Product feature CHAIN AY373428_HBe_P-A of FT:mat_peptide AY373428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY373429_HBe_P-A Product feature CHAIN AY373429_HBe_P-A of FT:mat_peptide AY373429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWSHISCLTFGRETALEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY373432_HBe_P-A Product feature CHAIN AY373432_HBe_P-A of FT:mat_peptide AY373432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY382505_HBe_P-A Product feature CHAIN AY382505_HBe_P-A of FT:mat_peptide AY382505_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Vu46). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTPPETTVVR
RRG
>gnl|hbvpro|AY382506_HBe_P-A Product feature CHAIN AY382506_HBe_P-A of FT:mat_peptide AY382506_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Vu47). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTPPETTVVR
RRG
>gnl|hbvpro|AY382513_HBe_P-A Product feature CHAIN AY382513_HBe_P-A of FT:mat_peptide AY382513_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Vu56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
CNLVPGCLWGMAIDPYKEFGATVELLSFLPSDFLPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPGAYRPPNAPILSTLPETTVVR
RRG
>gnl|hbvpro|AY603429_HBe_P-A Product feature CHAIN AY603429_HBe_P-A of FT:mat_peptide AY603429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 15T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY603430_HBe_P-A Product feature CHAIN AY603430_HBe_P-A of FT:mat_peptide AY603430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 19T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY603431_HBe_P-A Product feature CHAIN AY603431_HBe_P-A of FT:mat_peptide AY603431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY603432_HBe_P-A Product feature CHAIN AY603432_HBe_P-A of FT:mat_peptide AY603432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVLDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY603435_HBe_P-A Product feature CHAIN AY603435_HBe_P-A of FT:mat_peptide AY603435_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 31T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY603436_HBe_P-A Product feature CHAIN AY603436_HBe_P-A of FT:mat_peptide AY603436_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 32T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY603438_HBe_P-A Product feature CHAIN AY603438_HBe_P-A of FT:mat_peptide AY603438_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 36T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY603441_HBe_P-A Product feature CHAIN AY603441_HBe_P-A of FT:mat_peptide AY603441_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 59T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY603446_HBe_P-A Product feature CHAIN AY603446_HBe_P-A of FT:mat_peptide AY603446_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY707087_HBe_P-A Product feature CHAIN AY707087_HBe_P-A of FT:mat_peptide AY707087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-N10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY738139_HBe_P-A Product feature CHAIN AY738139_HBe_P-A of FT:mat_peptide AY738139_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY738140_HBe_P-A Product feature CHAIN AY738140_HBe_P-A of FT:mat_peptide AY738140_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY738141_HBe_P-A Product feature CHAIN AY738141_HBe_P-A of FT:mat_peptide AY738141_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY738142_HBe_P-A Product feature CHAIN AY738142_HBe_P-A of FT:mat_peptide AY738142_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY738143_HBe_P-A Product feature CHAIN AY738143_HBe_P-A of FT:mat_peptide AY738143_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A, 10/97). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY862867_HBe_P-A Product feature CHAIN AY862867_HBe_P-A of FT:mat_peptide AY862867_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCPGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY862868_HBe_P-A Product feature CHAIN AY862868_HBe_P-A of FT:mat_peptide AY862868_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H4-zhus). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY902775_HBe_P-A Product feature CHAIN AY902775_HBe_P-A of FT:mat_peptide AY902775_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY903452_HBe_P-A Product feature CHAIN AY903452_HBe_P-A of FT:mat_peptide AY903452_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRGR
>gnl|hbvpro|AY934763_HBe_P-A Product feature CHAIN AY934763_HBe_P-A of FT:mat_peptide AY934763_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934764_HBe_P-A Product feature CHAIN AY934764_HBe_P-A of FT:mat_peptide AY934764_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934765_HBe_P-A Product feature CHAIN AY934765_HBe_P-A of FT:mat_peptide AY934765_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934766_HBe_P-A Product feature CHAIN AY934766_HBe_P-A of FT:mat_peptide AY934766_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934767_HBe_P-A Product feature CHAIN AY934767_HBe_P-A of FT:mat_peptide AY934767_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934768_HBe_P-A Product feature CHAIN AY934768_HBe_P-A of FT:mat_peptide AY934768_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934769_HBe_P-A Product feature CHAIN AY934769_HBe_P-A of FT:mat_peptide AY934769_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934770_HBe_P-A Product feature CHAIN AY934770_HBe_P-A of FT:mat_peptide AY934770_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934771_HBe_P-A Product feature CHAIN AY934771_HBe_P-A of FT:mat_peptide AY934771_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934772_HBe_P-A Product feature CHAIN AY934772_HBe_P-A of FT:mat_peptide AY934772_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1908). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934773_HBe_P-A Product feature CHAIN AY934773_HBe_P-A of FT:mat_peptide AY934773_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AY934774_HBe_P-A Product feature CHAIN AY934774_HBe_P-A of FT:mat_peptide AY934774_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|DQ020002_HBe_P-A Product feature CHAIN DQ020002_HBe_P-A of FT:mat_peptide DQ020002_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|DQ020003_HBe_P-A Product feature CHAIN DQ020003_HBe_P-A of FT:mat_peptide DQ020003_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|DQ315784_HBe_P-A Product feature CHAIN DQ315784_HBe_P-A of FT:mat_peptide DQ315784_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI03101). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|DQ315786_HBe_P-A Product feature CHAIN DQ315786_HBe_P-A of FT:mat_peptide DQ315786_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI057). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|DQ788725_HBe_P-A Product feature CHAIN DQ788725_HBe_P-A of FT:mat_peptide DQ788725_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate serum 07/92). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EF103278_HBe_P-A Product feature CHAIN EF103278_HBe_P-A of FT:mat_peptide EF103278_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|EF208113_HBe_P-A Product feature CHAIN EF208113_HBe_P-A of FT:mat_peptide EF208113_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient B, serum 05/93). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU054331_HBe_C-A Product feature CHAIN EU054331_HBe_C-A of FT:mat_peptide EU054331_HBe_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU086721_HBe_P-A Product feature CHAIN EU086721_HBe_P-A of FT:mat_peptide EU086721_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO/w4601-2002). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU185746_HBe_P-A Product feature CHAIN EU185746_HBe_P-A of FT:mat_peptide EU185746_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYXPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU185750_HBe_P-A Product feature CHAIN EU185750_HBe_P-A of FT:mat_peptide EU185750_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU185765_HBe_P-A Product feature CHAIN EU185765_HBe_P-A of FT:mat_peptide EU185765_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETAVVR
RRDRGR
>gnl|hbvpro|EU185774_HBe_P-A Product feature CHAIN EU185774_HBe_P-A of FT:mat_peptide EU185774_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLBTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU185775_HBe_P-A Product feature CHAIN EU185775_HBe_P-A of FT:mat_peptide EU185775_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU185776_HBe_P-A Product feature CHAIN EU185776_HBe_P-A of FT:mat_peptide EU185776_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLXTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPPSRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVWIRTPPAYKPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU185777_HBe_P-A Product feature CHAIN EU185777_HBe_P-A of FT:mat_peptide EU185777_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H-IDU4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCXGWLWGMDIDPYKEFGATVELLSFLPSDFFPSXRDLLXTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPPSRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVWIRTPPAYKPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU185786_HBe_P-A Product feature CHAIN EU185786_HBe_P-A of FT:mat_peptide EU185786_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU11). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU185787_HBe_P-A Product feature CHAIN EU185787_HBe_P-A of FT:mat_peptide EU185787_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU185789_HBe_P-A Product feature CHAIN EU185789_HBe_P-A of FT:mat_peptide EU185789_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S-IDU8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU234069_HBe_P-A Product feature CHAIN EU234069_HBe_P-A of FT:mat_peptide EU234069_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 117_PL76). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU234071_HBe_P-A Product feature CHAIN EU234071_HBe_P-A of FT:mat_peptide EU234071_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 221_AB25). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWXMDIDPYKEFGATTELLSFLPSDFFPSARDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGSNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEIXVVR
RRDRGR
>gnl|hbvpro|EU304331_HBe_P-A Product feature CHAIN EU304331_HBe_P-A of FT:mat_peptide EU304331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA84). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRDXVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
QRHRGR
>gnl|hbvpro|EU366129_HBe_P-A Product feature CHAIN EU366129_HBe_P-A of FT:mat_peptide EU366129_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLXDPASRDLVVNYVNTHMGLKIRQLLWFHXSCICFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
CRVRGR
>gnl|hbvpro|EU410082_HBe_P-A Product feature CHAIN EU410082_HBe_P-A of FT:mat_peptide EU410082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ph81). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU414048_HBe_P-A Product feature CHAIN EU414048_HBe_P-A of FT:mat_peptide EU414048_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU414049_HBe_P-A Product feature CHAIN EU414049_HBe_P-A of FT:mat_peptide EU414049_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SXLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWXXXXTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVXR
RRDRGR
>gnl|hbvpro|EU414050_HBe_P-A Product feature CHAIN EU414050_HBe_P-A of FT:mat_peptide EU414050_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLNDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU414052_HBe_P-A Product feature CHAIN EU414052_HBe_P-A of FT:mat_peptide EU414052_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWADVTNLAT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRNRGR
>gnl|hbvpro|EU414133_HBe_P-A Product feature CHAIN EU414133_HBe_P-A of FT:mat_peptide EU414133_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWADVTNLAT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRNRGR
>gnl|hbvpro|EU594383_HBe_P-A Product feature CHAIN EU594383_HBe_P-A of FT:mat_peptide EU594383_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594384_HBe_P-A Product feature CHAIN EU594384_HBe_P-A of FT:mat_peptide EU594384_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594385_HBe_P-A Product feature CHAIN EU594385_HBe_P-A of FT:mat_peptide EU594385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594386_HBe_P-A Product feature CHAIN EU594386_HBe_P-A of FT:mat_peptide EU594386_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594387_HBe_P-A Product feature CHAIN EU594387_HBe_P-A of FT:mat_peptide EU594387_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594388_HBe_P-A Product feature CHAIN EU594388_HBe_P-A of FT:mat_peptide EU594388_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594389_HBe_P-A Product feature CHAIN EU594389_HBe_P-A of FT:mat_peptide EU594389_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594390_HBe_P-A Product feature CHAIN EU594390_HBe_P-A of FT:mat_peptide EU594390_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594391_HBe_P-A Product feature CHAIN EU594391_HBe_P-A of FT:mat_peptide EU594391_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594392_HBe_P-A Product feature CHAIN EU594392_HBe_P-A of FT:mat_peptide EU594392_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594393_HBe_P-A Product feature CHAIN EU594393_HBe_P-A of FT:mat_peptide EU594393_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594394_HBe_P-A Product feature CHAIN EU594394_HBe_P-A of FT:mat_peptide EU594394_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU594395_HBe_P-A Product feature CHAIN EU594395_HBe_P-A of FT:mat_peptide EU594395_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859898_HBe_P-A Product feature CHAIN EU859898_HBe_P-A of FT:mat_peptide EU859898_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859899_HBe_P-A Product feature CHAIN EU859899_HBe_P-A of FT:mat_peptide EU859899_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859900_HBe_P-A Product feature CHAIN EU859900_HBe_P-A of FT:mat_peptide EU859900_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859901_HBe_P-A Product feature CHAIN EU859901_HBe_P-A of FT:mat_peptide EU859901_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859902_HBe_P-A Product feature CHAIN EU859902_HBe_P-A of FT:mat_peptide EU859902_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859903_HBe_P-A Product feature CHAIN EU859903_HBe_P-A of FT:mat_peptide EU859903_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859904_HBe_P-A Product feature CHAIN EU859904_HBe_P-A of FT:mat_peptide EU859904_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859905_HBe_P-A Product feature CHAIN EU859905_HBe_P-A of FT:mat_peptide EU859905_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859906_HBe_P-A Product feature CHAIN EU859906_HBe_P-A of FT:mat_peptide EU859906_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859907_HBe_P-A Product feature CHAIN EU859907_HBe_P-A of FT:mat_peptide EU859907_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859908_HBe_P-A Product feature CHAIN EU859908_HBe_P-A of FT:mat_peptide EU859908_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859909_HBe_P-A Product feature CHAIN EU859909_HBe_P-A of FT:mat_peptide EU859909_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859910_HBe_P-A Product feature CHAIN EU859910_HBe_P-A of FT:mat_peptide EU859910_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859911_HBe_P-A Product feature CHAIN EU859911_HBe_P-A of FT:mat_peptide EU859911_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859912_HBe_P-A Product feature CHAIN EU859912_HBe_P-A of FT:mat_peptide EU859912_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVGR
RRDRGR
>gnl|hbvpro|EU859913_HBe_P-A Product feature CHAIN EU859913_HBe_P-A of FT:mat_peptide EU859913_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859914_HBe_P-A Product feature CHAIN EU859914_HBe_P-A of FT:mat_peptide EU859914_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859915_HBe_P-A Product feature CHAIN EU859915_HBe_P-A of FT:mat_peptide EU859915_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859916_HBe_P-A Product feature CHAIN EU859916_HBe_P-A of FT:mat_peptide EU859916_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859917_HBe_P-A Product feature CHAIN EU859917_HBe_P-A of FT:mat_peptide EU859917_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859918_HBe_P-A Product feature CHAIN EU859918_HBe_P-A of FT:mat_peptide EU859918_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859919_HBe_P-A Product feature CHAIN EU859919_HBe_P-A of FT:mat_peptide EU859919_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVEFLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859920_HBe_P-A Product feature CHAIN EU859920_HBe_P-A of FT:mat_peptide EU859920_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859921_HBe_P-A Product feature CHAIN EU859921_HBe_P-A of FT:mat_peptide EU859921_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859922_HBe_P-A Product feature CHAIN EU859922_HBe_P-A of FT:mat_peptide EU859922_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859923_HBe_P-A Product feature CHAIN EU859923_HBe_P-A of FT:mat_peptide EU859923_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859924_HBe_P-A Product feature CHAIN EU859924_HBe_P-A of FT:mat_peptide EU859924_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859925_HBe_P-A Product feature CHAIN EU859925_HBe_P-A of FT:mat_peptide EU859925_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859926_HBe_P-A Product feature CHAIN EU859926_HBe_P-A of FT:mat_peptide EU859926_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859927_HBe_P-A Product feature CHAIN EU859927_HBe_P-A of FT:mat_peptide EU859927_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859928_HBe_P-A Product feature CHAIN EU859928_HBe_P-A of FT:mat_peptide EU859928_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859929_HBe_P-A Product feature CHAIN EU859929_HBe_P-A of FT:mat_peptide EU859929_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859930_HBe_P-A Product feature CHAIN EU859930_HBe_P-A of FT:mat_peptide EU859930_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859931_HBe_P-A Product feature CHAIN EU859931_HBe_P-A of FT:mat_peptide EU859931_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859932_HBe_P-A Product feature CHAIN EU859932_HBe_P-A of FT:mat_peptide EU859932_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859933_HBe_P-A Product feature CHAIN EU859933_HBe_P-A of FT:mat_peptide EU859933_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859934_HBe_P-A Product feature CHAIN EU859934_HBe_P-A of FT:mat_peptide EU859934_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859935_HBe_P-A Product feature CHAIN EU859935_HBe_P-A of FT:mat_peptide EU859935_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|EU859936_HBe_P-A Product feature CHAIN EU859936_HBe_P-A of FT:mat_peptide EU859936_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|EU859937_HBe_P-A Product feature CHAIN EU859937_HBe_P-A of FT:mat_peptide EU859937_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859939_HBe_P-A Product feature CHAIN EU859939_HBe_P-A of FT:mat_peptide EU859939_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859940_HBe_P-A Product feature CHAIN EU859940_HBe_P-A of FT:mat_peptide EU859940_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859941_HBe_P-A Product feature CHAIN EU859941_HBe_P-A of FT:mat_peptide EU859941_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859942_HBe_P-A Product feature CHAIN EU859942_HBe_P-A of FT:mat_peptide EU859942_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859943_HBe_P-A Product feature CHAIN EU859943_HBe_P-A of FT:mat_peptide EU859943_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859944_HBe_P-A Product feature CHAIN EU859944_HBe_P-A of FT:mat_peptide EU859944_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859945_HBe_P-A Product feature CHAIN EU859945_HBe_P-A of FT:mat_peptide EU859945_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859946_HBe_P-A Product feature CHAIN EU859946_HBe_P-A of FT:mat_peptide EU859946_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859947_HBe_P-A Product feature CHAIN EU859947_HBe_P-A of FT:mat_peptide EU859947_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859948_HBe_P-A Product feature CHAIN EU859948_HBe_P-A of FT:mat_peptide EU859948_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859949_HBe_P-A Product feature CHAIN EU859949_HBe_P-A of FT:mat_peptide EU859949_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859950_HBe_P-A Product feature CHAIN EU859950_HBe_P-A of FT:mat_peptide EU859950_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C64). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859951_HBe_P-A Product feature CHAIN EU859951_HBe_P-A of FT:mat_peptide EU859951_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859952_HBe_P-A Product feature CHAIN EU859952_HBe_P-A of FT:mat_peptide EU859952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859953_HBe_P-A Product feature CHAIN EU859953_HBe_P-A of FT:mat_peptide EU859953_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859954_HBe_P-A Product feature CHAIN EU859954_HBe_P-A of FT:mat_peptide EU859954_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859955_HBe_P-A Product feature CHAIN EU859955_HBe_P-A of FT:mat_peptide EU859955_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|EU859956_HBe_P-A Product feature CHAIN EU859956_HBe_P-A of FT:mat_peptide EU859956_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ349222_HBe_P-A Product feature CHAIN FJ349222_HBe_P-A of FT:mat_peptide FJ349222_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H20). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ349224_HBe_P-A Product feature CHAIN FJ349224_HBe_P-A of FT:mat_peptide FJ349224_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ349296_HBe_P-A Product feature CHAIN FJ349296_HBe_P-A of FT:mat_peptide FJ349296_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLNTASALYREALKSPGHCSPHHTALRQAILCWGELMTLAT
WVGNNLENPASRDLVVNYVNTNMGLKIRQLWGFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|FJ692554_HBe_P-A Product feature CHAIN FJ692554_HBe_P-A of FT:mat_peptide FJ692554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692557_HBe_P-A Product feature CHAIN FJ692557_HBe_P-A of FT:mat_peptide FJ692557_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692558_HBe_P-A Product feature CHAIN FJ692558_HBe_P-A of FT:mat_peptide FJ692558_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPYDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDAASRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692559_HBe_P-A Product feature CHAIN FJ692559_HBe_P-A of FT:mat_peptide FJ692559_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692561_HBe_P-A Product feature CHAIN FJ692561_HBe_P-A of FT:mat_peptide FJ692561_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVR
CRARGR
>gnl|hbvpro|FJ692562_HBe_P-A Product feature CHAIN FJ692562_HBe_P-A of FT:mat_peptide FJ692562_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692563_HBe_P-A Product feature CHAIN FJ692563_HBe_P-A of FT:mat_peptide FJ692563_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692564_HBe_P-A Product feature CHAIN FJ692564_HBe_P-A of FT:mat_peptide FJ692564_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCXTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGRGR
>gnl|hbvpro|FJ692565_HBe_P-A Product feature CHAIN FJ692565_HBe_P-A of FT:mat_peptide FJ692565_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVR
RRXRGR
>gnl|hbvpro|FJ692566_HBe_P-A Product feature CHAIN FJ692566_HBe_P-A of FT:mat_peptide FJ692566_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRESLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692567_HBe_P-A Product feature CHAIN FJ692567_HBe_P-A of FT:mat_peptide FJ692567_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDGLESPEHCXPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
CRNRGR
>gnl|hbvpro|FJ692570_HBe_P-A Product feature CHAIN FJ692570_HBe_P-A of FT:mat_peptide FJ692570_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50010). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692571_HBe_P-A Product feature CHAIN FJ692571_HBe_P-A of FT:mat_peptide FJ692571_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692573_HBe_P-A Product feature CHAIN FJ692573_HBe_P-A of FT:mat_peptide FJ692573_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50014). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSSLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692574_HBe_P-A Product feature CHAIN FJ692574_HBe_P-A of FT:mat_peptide FJ692574_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692575_HBe_P-A Product feature CHAIN FJ692575_HBe_P-A of FT:mat_peptide FJ692575_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692576_HBe_P-A Product feature CHAIN FJ692576_HBe_P-A of FT:mat_peptide FJ692576_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEFLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
GRPRGR
>gnl|hbvpro|FJ692577_HBe_P-A Product feature CHAIN FJ692577_HBe_P-A of FT:mat_peptide FJ692577_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGXXTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRRR
>gnl|hbvpro|FJ692578_HBe_P-A Product feature CHAIN FJ692578_HBe_P-A of FT:mat_peptide FJ692578_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692579_HBe_P-A Product feature CHAIN FJ692579_HBe_P-A of FT:mat_peptide FJ692579_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692580_HBe_P-A Product feature CHAIN FJ692580_HBe_P-A of FT:mat_peptide FJ692580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692581_HBe_P-A Product feature CHAIN FJ692581_HBe_P-A of FT:mat_peptide FJ692581_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692582_HBe_P-A Product feature CHAIN FJ692582_HBe_P-A of FT:mat_peptide FJ692582_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692583_HBe_P-A Product feature CHAIN FJ692583_HBe_P-A of FT:mat_peptide FJ692583_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692584_HBe_P-A Product feature CHAIN FJ692584_HBe_P-A of FT:mat_peptide FJ692584_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692585_HBe_P-A Product feature CHAIN FJ692585_HBe_P-A of FT:mat_peptide FJ692585_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692586_HBe_P-A Product feature CHAIN FJ692586_HBe_P-A of FT:mat_peptide FJ692586_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50099). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLTTLGS
WVGNNLEDQASRALVVNYVDTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRNRGR
>gnl|hbvpro|FJ692587_HBe_P-A Product feature CHAIN FJ692587_HBe_P-A of FT:mat_peptide FJ692587_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50115). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGDVMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRNRGR
>gnl|hbvpro|FJ692588_HBe_P-A Product feature CHAIN FJ692588_HBe_P-A of FT:mat_peptide FJ692588_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=167 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRQGR
>gnl|hbvpro|FJ692590_HBe_P-A Product feature CHAIN FJ692590_HBe_P-A of FT:mat_peptide FJ692590_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692591_HBe_P-A Product feature CHAIN FJ692591_HBe_P-A of FT:mat_peptide FJ692591_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692592_HBe_P-A Product feature CHAIN FJ692592_HBe_P-A of FT:mat_peptide FJ692592_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREGLESPEHCSPHHTALRQAILXWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|FJ692593_HBe_P-A Product feature CHAIN FJ692593_HBe_P-A of FT:mat_peptide FJ692593_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48054). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPVSRDLVVNYVNTNMGLRIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYXPQNAPILSTLPETXVVR
RRGR
>gnl|hbvpro|FJ692595_HBe_P-A Product feature CHAIN FJ692595_HBe_P-A of FT:mat_peptide FJ692595_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNDNMGIKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPLNAPILSTLPETTVVR
QRYRGR
>gnl|hbvpro|FJ692596_HBe_P-A Product feature CHAIN FJ692596_HBe_P-A of FT:mat_peptide FJ692596_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHTSSITFGREXVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692597_HBe_P-A Product feature CHAIN FJ692597_HBe_P-A of FT:mat_peptide FJ692597_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFXEALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNXNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVR
XRXRGR
>gnl|hbvpro|FJ692598_HBe_P-A Product feature CHAIN FJ692598_HBe_P-A of FT:mat_peptide FJ692598_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVMBLGN
WVGNNLEDXASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPPYRPXNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692599_HBe_P-A Product feature CHAIN FJ692599_HBe_P-A of FT:mat_peptide FJ692599_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692600_HBe_P-A Product feature CHAIN FJ692600_HBe_P-A of FT:mat_peptide FJ692600_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDYYPSVRDLLDTASALYRXALESPEHCSPHHTALRQAXLCWGELMTLAT
WVGNNLEDPASRDXVVNYVNXNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRXRGR
>gnl|hbvpro|FJ692601_HBe_P-A Product feature CHAIN FJ692601_HBe_P-A of FT:mat_peptide FJ692601_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692602_HBe_P-A Product feature CHAIN FJ692602_HBe_P-A of FT:mat_peptide FJ692602_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAILCWGDLSTLAT
WVGNNLADPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692603_HBe_P-A Product feature CHAIN FJ692603_HBe_P-A of FT:mat_peptide FJ692603_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDHYKEFGAXVELLSFLPSDFYPSVRDLLDTATALYRXXLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692604_HBe_P-A Product feature CHAIN FJ692604_HBe_P-A of FT:mat_peptide FJ692604_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGNNLEDPASRDLVVNYVNTTTGLRIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692605_HBe_P-A Product feature CHAIN FJ692605_HBe_P-A of FT:mat_peptide FJ692605_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLXDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692606_HBe_P-A Product feature CHAIN FJ692606_HBe_P-A of FT:mat_peptide FJ692606_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692607_HBe_P-A Product feature CHAIN FJ692607_HBe_P-A of FT:mat_peptide FJ692607_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPQNAPILSTLPETTVVR
RGDRGR
>gnl|hbvpro|FJ692608_HBe_P-A Product feature CHAIN FJ692608_HBe_P-A of FT:mat_peptide FJ692608_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692611_HBe_P-A Product feature CHAIN FJ692611_HBe_P-A of FT:mat_peptide FJ692611_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAS
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692612_HBe_P-A Product feature CHAIN FJ692612_HBe_P-A of FT:mat_peptide FJ692612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPXYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ692613_HBe_P-A Product feature CHAIN FJ692613_HBe_P-A of FT:mat_peptide FJ692613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|FJ867946_HBe_P-A Product feature CHAIN FJ867946_HBe_P-A of FT:mat_peptide FJ867946_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ867947_HBe_P-A Product feature CHAIN FJ867947_HBe_P-A of FT:mat_peptide FJ867947_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ867948_HBe_P-A Product feature CHAIN FJ867948_HBe_P-A of FT:mat_peptide FJ867948_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ867949_HBe_P-A Product feature CHAIN FJ867949_HBe_P-A of FT:mat_peptide FJ867949_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ867958_HBe_P-A Product feature CHAIN FJ867958_HBe_P-A of FT:mat_peptide FJ867958_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ867960_HBe_P-A Product feature CHAIN FJ867960_HBe_P-A of FT:mat_peptide FJ867960_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ867961_HBe_P-A Product feature CHAIN FJ867961_HBe_P-A of FT:mat_peptide FJ867961_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ867985_HBe_P-A Product feature CHAIN FJ867985_HBe_P-A of FT:mat_peptide FJ867985_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCMPC19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVR
RRDRGR
>gnl|hbvpro|FJ867986_HBe_P-A Product feature CHAIN FJ867986_HBe_P-A of FT:mat_peptide FJ867986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCMPC26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVR
RRDRGR
>gnl|hbvpro|FJ867994_HBe_P-A Product feature CHAIN FJ867994_HBe_P-A of FT:mat_peptide FJ867994_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCNPC13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ867995_HBe_P-A Product feature CHAIN FJ867995_HBe_P-A of FT:mat_peptide FJ867995_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCNPC29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRELVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ868002_HBe_P-A Product feature CHAIN FJ868002_HBe_P-A of FT:mat_peptide FJ868002_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHMPC58). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHGSPHHTALRQAILCWGELMTLAT
WVGINLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREAVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ868008_HBe_P-A Product feature CHAIN FJ868008_HBe_P-A of FT:mat_peptide FJ868008_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHNPC87). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FJ904434_HBe_P-A Product feature CHAIN FJ904434_HBe_P-A of FT:mat_peptide FJ904434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPRDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQIILCWGDVMTLAT
WVGTNLZDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FM199974_HBe_P-A Product feature CHAIN FM199974_HBe_P-A of FT:mat_peptide FM199974_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMALAS
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|FM199975_HBe_P-A Product feature CHAIN FM199975_HBe_P-A of FT:mat_peptide FM199975_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESXEHCXPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|FM199976_HBe_P-A Product feature CHAIN FM199976_HBe_P-A of FT:mat_peptide FM199976_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQXLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FM199977_HBe_P-A Product feature CHAIN FM199977_HBe_P-A of FT:mat_peptide FM199977_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALQREALESHEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FM199978_HBe_P-A Product feature CHAIN FM199978_HBe_P-A of FT:mat_peptide FM199978_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FM199979_HBe_P-A Product feature CHAIN FM199979_HBe_P-A of FT:mat_peptide FM199979_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FM199980_HBe_P-A Product feature CHAIN FM199980_HBe_P-A of FT:mat_peptide FM199980_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FN545825_HBe_P-A Product feature CHAIN FN545825_HBe_P-A of FT:mat_peptide FN545825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FN545826_HBe_P-A Product feature CHAIN FN545826_HBe_P-A of FT:mat_peptide FN545826_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGNNLEDPASRDLVVNYVNNTTGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FN545828_HBe_P-A Product feature CHAIN FN545828_HBe_P-A of FT:mat_peptide FN545828_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGXLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDQVVDYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPLNAPILSTLPETTVVR
RRDPGR
>gnl|hbvpro|FN545829_HBe_P-A Product feature CHAIN FN545829_HBe_P-A of FT:mat_peptide FN545829_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREGLESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRAR
>gnl|hbvpro|FN545830_HBe_P-A Product feature CHAIN FN545830_HBe_P-A of FT:mat_peptide FN545830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETAVVR
RRDRGR
>gnl|hbvpro|FN545831_HBe_P-A Product feature CHAIN FN545831_HBe_P-A of FT:mat_peptide FN545831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FN545832_HBe_P-A Product feature CHAIN FN545832_HBe_P-A of FT:mat_peptide FN545832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRXALESPEHCTPHHTALRQAILCWGEXMTLAT
WVGNNLDDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGREXVLZYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
XRDRGR
>gnl|hbvpro|FN545833_HBe_P-A Product feature CHAIN FN545833_HBe_P-A of FT:mat_peptide FN545833_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FN545834_HBe_P-A Product feature CHAIN FN545834_HBe_P-A of FT:mat_peptide FN545834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLETASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FN545835_HBe_P-A Product feature CHAIN FN545835_HBe_P-A of FT:mat_peptide FN545835_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FN545836_HBe_P-A Product feature CHAIN FN545836_HBe_P-A of FT:mat_peptide FN545836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|FN545838_HBe_P-A Product feature CHAIN FN545838_HBe_P-A of FT:mat_peptide FN545838_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMSLAT
WVGTNLEDPASREQVVSYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
LRNRGR
>gnl|hbvpro|FN545839_HBe_P-A Product feature CHAIN FN545839_HBe_P-A of FT:mat_peptide FN545839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRXTVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
XRDRGR
>gnl|hbvpro|FN545840_HBe_P-A Product feature CHAIN FN545840_HBe_P-A of FT:mat_peptide FN545840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ161813_HBe_P-A Product feature CHAIN GQ161813_HBe_P-A of FT:mat_peptide GQ161813_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ184323_HBe_P-A Product feature CHAIN GQ184323_HBe_P-A of FT:mat_peptide GQ184323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ184324_HBe_P-A Product feature CHAIN GQ184324_HBe_P-A of FT:mat_peptide GQ184324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATLELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ222208_HBe_P-A Product feature CHAIN GQ222208_HBe_P-A of FT:mat_peptide GQ222208_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1123). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWRELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ331046_HBe_P-A Product feature CHAIN GQ331046_HBe_P-A of FT:mat_peptide GQ331046_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-188). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ331047_HBe_P-A Product feature CHAIN GQ331047_HBe_P-A of FT:mat_peptide GQ331047_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-56). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ414522_HBe_P-A Product feature CHAIN GQ414522_HBe_P-A of FT:mat_peptide GQ414522_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477461_HBe_P-A Product feature CHAIN GQ477461_HBe_P-A of FT:mat_peptide GQ477461_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477462_HBe_P-A Product feature CHAIN GQ477462_HBe_P-A of FT:mat_peptide GQ477462_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTSLGT
WVGNNLDDQASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477463_HBe_P-A Product feature CHAIN GQ477463_HBe_P-A of FT:mat_peptide GQ477463_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTPHHTALRQAILCWVELMTLAS
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477464_HBe_P-A Product feature CHAIN GQ477464_HBe_P-A of FT:mat_peptide GQ477464_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPLDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477465_HBe_P-A Product feature CHAIN GQ477465_HBe_P-A of FT:mat_peptide GQ477465_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVCR
RRVRGR
>gnl|hbvpro|GQ477466_HBe_P-A Product feature CHAIN GQ477466_HBe_P-A of FT:mat_peptide GQ477466_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHLSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|GQ477467_HBe_P-A Product feature CHAIN GQ477467_HBe_P-A of FT:mat_peptide GQ477467_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477468_HBe_P-A Product feature CHAIN GQ477468_HBe_P-A of FT:mat_peptide GQ477468_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGNNLEDLASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477469_HBe_P-A Product feature CHAIN GQ477469_HBe_P-A of FT:mat_peptide GQ477469_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPLDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAVLCWGELMTLAT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSILPETTVIR
RRDRGR
>gnl|hbvpro|GQ477472_HBe_P-A Product feature CHAIN GQ477472_HBe_P-A of FT:mat_peptide GQ477472_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPGVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSILPETTVIR
RRDRGR
>gnl|hbvpro|GQ477473_HBe_P-A Product feature CHAIN GQ477473_HBe_P-A of FT:mat_peptide GQ477473_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPLDFFPSARDLLDTASALYREGLESPEHCSPHHTALRQAILCWGELTALAT
WVGGNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVR
RRDRGR
>gnl|hbvpro|GQ477474_HBe_P-A Product feature CHAIN GQ477474_HBe_P-A of FT:mat_peptide GQ477474_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELISFLPSDFFPSVRDLLDTASALYREALESSEHCSPHHTAIRHVLLCWVELMTLAN
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRDRVR
>gnl|hbvpro|GQ477475_HBe_P-A Product feature CHAIN GQ477475_HBe_P-A of FT:mat_peptide GQ477475_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLRWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTAIRQVVLCWGELMTLAT
WVGNNLQDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477476_HBe_P-A Product feature CHAIN GQ477476_HBe_P-A of FT:mat_peptide GQ477476_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPTDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELSTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHVSCIIFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477478_HBe_P-A Product feature CHAIN GQ477478_HBe_P-A of FT:mat_peptide GQ477478_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDYYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVR
PRGRGR
>gnl|hbvpro|GQ477479_HBe_P-A Product feature CHAIN GQ477479_HBe_P-A of FT:mat_peptide GQ477479_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADYYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477480_HBe_P-A Product feature CHAIN GQ477480_HBe_P-A of FT:mat_peptide GQ477480_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPNVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELMNLAT
WVGSNLQDPASRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRRR
>gnl|hbvpro|GQ477482_HBe_P-A Product feature CHAIN GQ477482_HBe_P-A of FT:mat_peptide GQ477482_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDHYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477484_HBe_P-A Product feature CHAIN GQ477484_HBe_P-A of FT:mat_peptide GQ477484_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMSLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RQHRGR
>gnl|hbvpro|GQ477486_HBe_P-A Product feature CHAIN GQ477486_HBe_P-A of FT:mat_peptide GQ477486_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P57). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477487_HBe_P-A Product feature CHAIN GQ477487_HBe_P-A of FT:mat_peptide GQ477487_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELSTLAT
WVGNNLQDSASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477488_HBe_P-A Product feature CHAIN GQ477488_HBe_P-A of FT:mat_peptide GQ477488_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELMTLAS
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477490_HBe_P-A Product feature CHAIN GQ477490_HBe_P-A of FT:mat_peptide GQ477490_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGSNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477491_HBe_P-A Product feature CHAIN GQ477491_HBe_P-A of FT:mat_peptide GQ477491_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHSSCITFGRDTVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477493_HBe_P-A Product feature CHAIN GQ477493_HBe_P-A of FT:mat_peptide GQ477493_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSARDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVR
CRDRRR
>gnl|hbvpro|GQ477495_HBe_P-A Product feature CHAIN GQ477495_HBe_P-A of FT:mat_peptide GQ477495_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477496_HBe_P-A Product feature CHAIN GQ477496_HBe_P-A of FT:mat_peptide GQ477496_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRVR
>gnl|hbvpro|GQ477497_HBe_P-A Product feature CHAIN GQ477497_HBe_P-A of FT:mat_peptide GQ477497_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLRWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVIR
RRDRGR
>gnl|hbvpro|GQ477498_HBe_P-A Product feature CHAIN GQ477498_HBe_P-A of FT:mat_peptide GQ477498_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P100). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|GQ477500_HBe_P-A Product feature CHAIN GQ477500_HBe_P-A of FT:mat_peptide GQ477500_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVKDLLDTASALYREALESSEHCSPHHTAIRQVILCWGDVMTLGT
WVGNNLEDPASKDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477501_HBe_P-A Product feature CHAIN GQ477501_HBe_P-A of FT:mat_peptide GQ477501_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLNDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETAVVR
RRDRGR
>gnl|hbvpro|GQ477502_HBe_P-A Product feature CHAIN GQ477502_HBe_P-A of FT:mat_peptide GQ477502_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPNVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
PRDRGR
>gnl|hbvpro|GQ477503_HBe_P-A Product feature CHAIN GQ477503_HBe_P-A of FT:mat_peptide GQ477503_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ477504_HBe_P-A Product feature CHAIN GQ477504_HBe_P-A of FT:mat_peptide GQ477504_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELSTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGREVVHEYLVSFGVWIRTPPAYRPINAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GQ921978_HBe_P-A Product feature CHAIN GQ921978_HBe_P-A of FT:mat_peptide GQ921978_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1B1148). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSYHHTALRQAILCWEEVTSLGT
WVGNNLQDPASRDLVVNHVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563545_HBe_P-A Product feature CHAIN GU563545_HBe_P-A of FT:mat_peptide GU563545_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLCDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563546_HBe_P-A Product feature CHAIN GU563546_HBe_P-A of FT:mat_peptide GU563546_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-66). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563547_HBe_P-A Product feature CHAIN GU563547_HBe_P-A of FT:mat_peptide GU563547_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-23). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATTDLLSFLPSDFFPSVRDLRDTTSALYREALESPEHCSSHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHLSCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563548_HBe_P-A Product feature CHAIN GU563548_HBe_P-A of FT:mat_peptide GU563548_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-108). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563550_HBe_P-A Product feature CHAIN GU563550_HBe_P-A of FT:mat_peptide GU563550_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-204). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWVWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563553_HBe_P-A Product feature CHAIN GU563553_HBe_P-A of FT:mat_peptide GU563553_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563554_HBe_P-A Product feature CHAIN GU563554_HBe_P-A of FT:mat_peptide GU563554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563555_HBe_P-A Product feature CHAIN GU563555_HBe_P-A of FT:mat_peptide GU563555_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-35). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563557_HBe_P-A Product feature CHAIN GU563557_HBe_P-A of FT:mat_peptide GU563557_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-78). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563558_HBe_P-A Product feature CHAIN GU563558_HBe_P-A of FT:mat_peptide GU563558_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-90). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU563562_HBe_P-A Product feature CHAIN GU563562_HBe_P-A of FT:mat_peptide GU563562_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV-189). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|GU827640_HBe_P-A Product feature CHAIN GU827640_HBe_P-A of FT:mat_peptide GU827640_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMC25B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTSLGT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|HE576988_HBe_P-A Product feature CHAIN HE576988_HBe_P-A of FT:mat_peptide HE576988_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5.9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|HE576989_HBe_P-A Product feature CHAIN HE576989_HBe_P-A of FT:mat_peptide HE576989_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2.2.11). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|HM214718_HBe_P-A Product feature CHAIN HM214718_HBe_P-A of FT:mat_peptide HM214718_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA83). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|HM214726_HBe_P-A Product feature CHAIN HM214726_HBe_P-A of FT:mat_peptide HM214726_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA62). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|HM214743_HBe_P-A Product feature CHAIN HM214743_HBe_P-A of FT:mat_peptide HM214743_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA80). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|HM363612_HBe_P-A Product feature CHAIN HM363612_HBe_P-A of FT:mat_peptide HM363612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|HM363613_HBe_P-A Product feature CHAIN HM363613_HBe_P-A of FT:mat_peptide HM363613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V103). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|HM535200_HBe_P-A Product feature CHAIN HM535200_HBe_P-A of FT:mat_peptide HM535200_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947 Harare). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLRFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|HM535205_HBe_P-A Product feature CHAIN HM535205_HBe_P-A of FT:mat_peptide HM535205_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72 Mutare). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439720_HBe_P-A Product feature CHAIN JF439720_HBe_P-A of FT:mat_peptide JF439720_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL437). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439721_HBe_P-A Product feature CHAIN JF439721_HBe_P-A of FT:mat_peptide JF439721_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL444). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439722_HBe_P-A Product feature CHAIN JF439722_HBe_P-A of FT:mat_peptide JF439722_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL445). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439723_HBe_P-A Product feature CHAIN JF439723_HBe_P-A of FT:mat_peptide JF439723_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL448). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439724_HBe_P-A Product feature CHAIN JF439724_HBe_P-A of FT:mat_peptide JF439724_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL450). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRGALESPEHCSPHHTALRQDILCWGELMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVR
RRDRGR
>gnl|hbvpro|JF439725_HBe_P-A Product feature CHAIN JF439725_HBe_P-A of FT:mat_peptide JF439725_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL451). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVR
RRDRGR
>gnl|hbvpro|JF439726_HBe_P-A Product feature CHAIN JF439726_HBe_P-A of FT:mat_peptide JF439726_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL452). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439727_HBe_P-A Product feature CHAIN JF439727_HBe_P-A of FT:mat_peptide JF439727_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL453). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439728_HBe_P-A Product feature CHAIN JF439728_HBe_P-A of FT:mat_peptide JF439728_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL454). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVR
RRDRGR
>gnl|hbvpro|JF439729_HBe_P-A Product feature CHAIN JF439729_HBe_P-A of FT:mat_peptide JF439729_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVR
RRDRGR
>gnl|hbvpro|JF439730_HBe_P-A Product feature CHAIN JF439730_HBe_P-A of FT:mat_peptide JF439730_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL456). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439731_HBe_P-A Product feature CHAIN JF439731_HBe_P-A of FT:mat_peptide JF439731_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL458). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439732_HBe_P-A Product feature CHAIN JF439732_HBe_P-A of FT:mat_peptide JF439732_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL459). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439733_HBe_P-A Product feature CHAIN JF439733_HBe_P-A of FT:mat_peptide JF439733_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL460). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439734_HBe_P-A Product feature CHAIN JF439734_HBe_P-A of FT:mat_peptide JF439734_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL461). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439735_HBe_P-A Product feature CHAIN JF439735_HBe_P-A of FT:mat_peptide JF439735_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL462). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439736_HBe_P-A Product feature CHAIN JF439736_HBe_P-A of FT:mat_peptide JF439736_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL463). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439737_HBe_P-A Product feature CHAIN JF439737_HBe_P-A of FT:mat_peptide JF439737_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL465). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMSLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439738_HBe_P-A Product feature CHAIN JF439738_HBe_P-A of FT:mat_peptide JF439738_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL466). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYREFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439740_HBe_P-A Product feature CHAIN JF439740_HBe_P-A of FT:mat_peptide JF439740_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL468). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLGSPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439741_HBe_P-A Product feature CHAIN JF439741_HBe_P-A of FT:mat_peptide JF439741_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL469). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439742_HBe_P-A Product feature CHAIN JF439742_HBe_P-A of FT:mat_peptide JF439742_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL471). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439743_HBe_P-A Product feature CHAIN JF439743_HBe_P-A of FT:mat_peptide JF439743_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL472). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439744_HBe_P-A Product feature CHAIN JF439744_HBe_P-A of FT:mat_peptide JF439744_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL473). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGGLMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVR
RRDRGR
>gnl|hbvpro|JF439746_HBe_P-A Product feature CHAIN JF439746_HBe_P-A of FT:mat_peptide JF439746_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL485). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439747_HBe_P-A Product feature CHAIN JF439747_HBe_P-A of FT:mat_peptide JF439747_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL489). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439748_HBe_P-A Product feature CHAIN JF439748_HBe_P-A of FT:mat_peptide JF439748_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL490). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTAPRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439750_HBe_P-A Product feature CHAIN JF439750_HBe_P-A of FT:mat_peptide JF439750_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL498). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439751_HBe_P-A Product feature CHAIN JF439751_HBe_P-A of FT:mat_peptide JF439751_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL499). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPQTTVVR
RRDRGR
>gnl|hbvpro|JF439752_HBe_P-A Product feature CHAIN JF439752_HBe_P-A of FT:mat_peptide JF439752_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439753_HBe_P-A Product feature CHAIN JF439753_HBe_P-A of FT:mat_peptide JF439753_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439754_HBe_P-A Product feature CHAIN JF439754_HBe_P-A of FT:mat_peptide JF439754_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439755_HBe_P-A Product feature CHAIN JF439755_HBe_P-A of FT:mat_peptide JF439755_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439756_HBe_P-A Product feature CHAIN JF439756_HBe_P-A of FT:mat_peptide JF439756_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439757_HBe_P-A Product feature CHAIN JF439757_HBe_P-A of FT:mat_peptide JF439757_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439758_HBe_P-A Product feature CHAIN JF439758_HBe_P-A of FT:mat_peptide JF439758_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439759_HBe_P-A Product feature CHAIN JF439759_HBe_P-A of FT:mat_peptide JF439759_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439761_HBe_P-A Product feature CHAIN JF439761_HBe_P-A of FT:mat_peptide JF439761_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439762_HBe_P-A Product feature CHAIN JF439762_HBe_P-A of FT:mat_peptide JF439762_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439763_HBe_P-A Product feature CHAIN JF439763_HBe_P-A of FT:mat_peptide JF439763_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439764_HBe_P-A Product feature CHAIN JF439764_HBe_P-A of FT:mat_peptide JF439764_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439765_HBe_P-A Product feature CHAIN JF439765_HBe_P-A of FT:mat_peptide JF439765_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439766_HBe_P-A Product feature CHAIN JF439766_HBe_P-A of FT:mat_peptide JF439766_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439767_HBe_P-A Product feature CHAIN JF439767_HBe_P-A of FT:mat_peptide JF439767_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLRLGWLWGMDIDPYKEFGATVELLSVLPCDFFPSVPDLLHAASTWYQEVLKSPGHCSPHHTALLHAILCWRELMTLAT
WVGDNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439768_HBe_P-A Product feature CHAIN JF439768_HBe_P-A of FT:mat_peptide JF439768_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439769_HBe_P-A Product feature CHAIN JF439769_HBe_P-A of FT:mat_peptide JF439769_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439770_HBe_P-A Product feature CHAIN JF439770_HBe_P-A of FT:mat_peptide JF439770_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B12). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439771_HBe_P-A Product feature CHAIN JF439771_HBe_P-A of FT:mat_peptide JF439771_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439772_HBe_P-A Product feature CHAIN JF439772_HBe_P-A of FT:mat_peptide JF439772_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439773_HBe_P-A Product feature CHAIN JF439773_HBe_P-A of FT:mat_peptide JF439773_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C7). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439774_HBe_P-A Product feature CHAIN JF439774_HBe_P-A of FT:mat_peptide JF439774_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALREAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439775_HBe_P-A Product feature CHAIN JF439775_HBe_P-A of FT:mat_peptide JF439775_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C9). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439777_HBe_P-A Product feature CHAIN JF439777_HBe_P-A of FT:mat_peptide JF439777_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439778_HBe_P-A Product feature CHAIN JF439778_HBe_P-A of FT:mat_peptide JF439778_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439819_HBe_P-A Product feature CHAIN JF439819_HBe_P-A of FT:mat_peptide JF439819_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97A1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439820_HBe_P-A Product feature CHAIN JF439820_HBe_P-A of FT:mat_peptide JF439820_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439821_HBe_P-A Product feature CHAIN JF439821_HBe_P-A of FT:mat_peptide JF439821_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGGLWGRDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYQEALKSPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVFNYVNTNMGLKIRQLLWFHISCLSFGRKTVLEYLVSFGVWIRTPPDYKLPNAPILSTLPETTVVR
RRDRRR
>gnl|hbvpro|JF439822_HBe_P-A Product feature CHAIN JF439822_HBe_P-A of FT:mat_peptide JF439822_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439823_HBe_P-A Product feature CHAIN JF439823_HBe_P-A of FT:mat_peptide JF439823_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439824_HBe_P-A Product feature CHAIN JF439824_HBe_P-A of FT:mat_peptide JF439824_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439825_HBe_P-A Product feature CHAIN JF439825_HBe_P-A of FT:mat_peptide JF439825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439826_HBe_P-A Product feature CHAIN JF439826_HBe_P-A of FT:mat_peptide JF439826_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97E1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGAAVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439827_HBe_P-A Product feature CHAIN JF439827_HBe_P-A of FT:mat_peptide JF439827_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97E2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439828_HBe_P-A Product feature CHAIN JF439828_HBe_P-A of FT:mat_peptide JF439828_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439829_HBe_P-A Product feature CHAIN JF439829_HBe_P-A of FT:mat_peptide JF439829_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHAALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439830_HBe_P-A Product feature CHAIN JF439830_HBe_P-A of FT:mat_peptide JF439830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97G2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMALAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439831_HBe_P-A Product feature CHAIN JF439831_HBe_P-A of FT:mat_peptide JF439831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439832_HBe_P-A Product feature CHAIN JF439832_HBe_P-A of FT:mat_peptide JF439832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPGHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLASFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439833_HBe_P-A Product feature CHAIN JF439833_HBe_P-A of FT:mat_peptide JF439833_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439834_HBe_P-A Product feature CHAIN JF439834_HBe_P-A of FT:mat_peptide JF439834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99A4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SRLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439835_HBe_P-A Product feature CHAIN JF439835_HBe_P-A of FT:mat_peptide JF439835_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439836_HBe_P-A Product feature CHAIN JF439836_HBe_P-A of FT:mat_peptide JF439836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439837_HBe_P-A Product feature CHAIN JF439837_HBe_P-A of FT:mat_peptide JF439837_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439838_HBe_P-A Product feature CHAIN JF439838_HBe_P-A of FT:mat_peptide JF439838_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLYLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439839_HBe_P-A Product feature CHAIN JF439839_HBe_P-A of FT:mat_peptide JF439839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439840_HBe_P-A Product feature CHAIN JF439840_HBe_P-A of FT:mat_peptide JF439840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439841_HBe_P-A Product feature CHAIN JF439841_HBe_P-A of FT:mat_peptide JF439841_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439842_HBe_P-A Product feature CHAIN JF439842_HBe_P-A of FT:mat_peptide JF439842_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439843_HBe_P-A Product feature CHAIN JF439843_HBe_P-A of FT:mat_peptide JF439843_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439844_HBe_P-A Product feature CHAIN JF439844_HBe_P-A of FT:mat_peptide JF439844_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439845_HBe_P-A Product feature CHAIN JF439845_HBe_P-A of FT:mat_peptide JF439845_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439846_HBe_P-A Product feature CHAIN JF439846_HBe_P-A of FT:mat_peptide JF439846_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439847_HBe_P-A Product feature CHAIN JF439847_HBe_P-A of FT:mat_peptide JF439847_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439848_HBe_P-A Product feature CHAIN JF439848_HBe_P-A of FT:mat_peptide JF439848_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439849_HBe_P-A Product feature CHAIN JF439849_HBe_P-A of FT:mat_peptide JF439849_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439850_HBe_P-A Product feature CHAIN JF439850_HBe_P-A of FT:mat_peptide JF439850_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439852_HBe_P-A Product feature CHAIN JF439852_HBe_P-A of FT:mat_peptide JF439852_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439853_HBe_P-A Product feature CHAIN JF439853_HBe_P-A of FT:mat_peptide JF439853_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439854_HBe_P-A Product feature CHAIN JF439854_HBe_P-A of FT:mat_peptide JF439854_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439855_HBe_P-A Product feature CHAIN JF439855_HBe_P-A of FT:mat_peptide JF439855_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVPFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439856_HBe_P-A Product feature CHAIN JF439856_HBe_P-A of FT:mat_peptide JF439856_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439857_HBe_P-A Product feature CHAIN JF439857_HBe_P-A of FT:mat_peptide JF439857_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439858_HBe_P-A Product feature CHAIN JF439858_HBe_P-A of FT:mat_peptide JF439858_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439859_HBe_P-A Product feature CHAIN JF439859_HBe_P-A of FT:mat_peptide JF439859_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLPDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439860_HBe_P-A Product feature CHAIN JF439860_HBe_P-A of FT:mat_peptide JF439860_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439861_HBe_P-A Product feature CHAIN JF439861_HBe_P-A of FT:mat_peptide JF439861_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEGPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439864_HBe_P-A Product feature CHAIN JF439864_HBe_P-A of FT:mat_peptide JF439864_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439865_HBe_P-A Product feature CHAIN JF439865_HBe_P-A of FT:mat_peptide JF439865_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439866_HBe_P-A Product feature CHAIN JF439866_HBe_P-A of FT:mat_peptide JF439866_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05F7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439867_HBe_P-A Product feature CHAIN JF439867_HBe_P-A of FT:mat_peptide JF439867_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05G8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439868_HBe_P-A Product feature CHAIN JF439868_HBe_P-A of FT:mat_peptide JF439868_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439869_HBe_P-A Product feature CHAIN JF439869_HBe_P-A of FT:mat_peptide JF439869_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439870_HBe_P-A Product feature CHAIN JF439870_HBe_P-A of FT:mat_peptide JF439870_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439871_HBe_P-A Product feature CHAIN JF439871_HBe_P-A of FT:mat_peptide JF439871_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439872_HBe_P-A Product feature CHAIN JF439872_HBe_P-A of FT:mat_peptide JF439872_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439873_HBe_P-A Product feature CHAIN JF439873_HBe_P-A of FT:mat_peptide JF439873_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439874_HBe_P-A Product feature CHAIN JF439874_HBe_P-A of FT:mat_peptide JF439874_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439875_HBe_P-A Product feature CHAIN JF439875_HBe_P-A of FT:mat_peptide JF439875_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439876_HBe_P-A Product feature CHAIN JF439876_HBe_P-A of FT:mat_peptide JF439876_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439877_HBe_P-A Product feature CHAIN JF439877_HBe_P-A of FT:mat_peptide JF439877_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439878_HBe_P-A Product feature CHAIN JF439878_HBe_P-A of FT:mat_peptide JF439878_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439879_HBe_P-A Product feature CHAIN JF439879_HBe_P-A of FT:mat_peptide JF439879_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439880_HBe_P-A Product feature CHAIN JF439880_HBe_P-A of FT:mat_peptide JF439880_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439881_HBe_P-A Product feature CHAIN JF439881_HBe_P-A of FT:mat_peptide JF439881_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439882_HBe_P-A Product feature CHAIN JF439882_HBe_P-A of FT:mat_peptide JF439882_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439883_HBe_P-A Product feature CHAIN JF439883_HBe_P-A of FT:mat_peptide JF439883_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439896_HBe_P-A Product feature CHAIN JF439896_HBe_P-A of FT:mat_peptide JF439896_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439897_HBe_P-A Product feature CHAIN JF439897_HBe_P-A of FT:mat_peptide JF439897_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439898_HBe_P-A Product feature CHAIN JF439898_HBe_P-A of FT:mat_peptide JF439898_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439899_HBe_P-A Product feature CHAIN JF439899_HBe_P-A of FT:mat_peptide JF439899_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439900_HBe_P-A Product feature CHAIN JF439900_HBe_P-A of FT:mat_peptide JF439900_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439901_HBe_P-A Product feature CHAIN JF439901_HBe_P-A of FT:mat_peptide JF439901_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439902_HBe_P-A Product feature CHAIN JF439902_HBe_P-A of FT:mat_peptide JF439902_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439903_HBe_P-A Product feature CHAIN JF439903_HBe_P-A of FT:mat_peptide JF439903_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439904_HBe_P-A Product feature CHAIN JF439904_HBe_P-A of FT:mat_peptide JF439904_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439905_HBe_P-A Product feature CHAIN JF439905_HBe_P-A of FT:mat_peptide JF439905_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439906_HBe_P-A Product feature CHAIN JF439906_HBe_P-A of FT:mat_peptide JF439906_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439907_HBe_P-A Product feature CHAIN JF439907_HBe_P-A of FT:mat_peptide JF439907_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439908_HBe_P-A Product feature CHAIN JF439908_HBe_P-A of FT:mat_peptide JF439908_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWWDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439909_HBe_P-A Product feature CHAIN JF439909_HBe_P-A of FT:mat_peptide JF439909_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439910_HBe_P-A Product feature CHAIN JF439910_HBe_P-A of FT:mat_peptide JF439910_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439943_HBe_P-A Product feature CHAIN JF439943_HBe_P-A of FT:mat_peptide JF439943_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439944_HBe_P-A Product feature CHAIN JF439944_HBe_P-A of FT:mat_peptide JF439944_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDMDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439945_HBe_P-A Product feature CHAIN JF439945_HBe_P-A of FT:mat_peptide JF439945_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439946_HBe_P-A Product feature CHAIN JF439946_HBe_P-A of FT:mat_peptide JF439946_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439947_HBe_P-A Product feature CHAIN JF439947_HBe_P-A of FT:mat_peptide JF439947_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439948_HBe_P-A Product feature CHAIN JF439948_HBe_P-A of FT:mat_peptide JF439948_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439949_HBe_P-A Product feature CHAIN JF439949_HBe_P-A of FT:mat_peptide JF439949_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439950_HBe_P-A Product feature CHAIN JF439950_HBe_P-A of FT:mat_peptide JF439950_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439951_HBe_P-A Product feature CHAIN JF439951_HBe_P-A of FT:mat_peptide JF439951_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439952_HBe_P-A Product feature CHAIN JF439952_HBe_P-A of FT:mat_peptide JF439952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439953_HBe_P-A Product feature CHAIN JF439953_HBe_P-A of FT:mat_peptide JF439953_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLGYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439954_HBe_P-A Product feature CHAIN JF439954_HBe_P-A of FT:mat_peptide JF439954_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPDTTVVR
RRDRGR
>gnl|hbvpro|JF439955_HBe_P-A Product feature CHAIN JF439955_HBe_P-A of FT:mat_peptide JF439955_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439956_HBe_P-A Product feature CHAIN JF439956_HBe_P-A of FT:mat_peptide JF439956_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439957_HBe_P-A Product feature CHAIN JF439957_HBe_P-A of FT:mat_peptide JF439957_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439958_HBe_P-A Product feature CHAIN JF439958_HBe_P-A of FT:mat_peptide JF439958_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SRLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWEELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAHRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439959_HBe_P-A Product feature CHAIN JF439959_HBe_P-A of FT:mat_peptide JF439959_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439960_HBe_P-A Product feature CHAIN JF439960_HBe_P-A of FT:mat_peptide JF439960_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439961_HBe_P-A Product feature CHAIN JF439961_HBe_P-A of FT:mat_peptide JF439961_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439962_HBe_P-A Product feature CHAIN JF439962_HBe_P-A of FT:mat_peptide JF439962_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVPFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439965_HBe_P-A Product feature CHAIN JF439965_HBe_P-A of FT:mat_peptide JF439965_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439966_HBe_P-A Product feature CHAIN JF439966_HBe_P-A of FT:mat_peptide JF439966_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c8). Partial genome (Contains: HBe, HBc, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439968_HBe_P-A Product feature CHAIN JF439968_HBe_P-A of FT:mat_peptide JF439968_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439969_HBe_P-A Product feature CHAIN JF439969_HBe_P-A of FT:mat_peptide JF439969_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIGPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLAFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439970_HBe_P-A Product feature CHAIN JF439970_HBe_P-A of FT:mat_peptide JF439970_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439971_HBe_P-A Product feature CHAIN JF439971_HBe_P-A of FT:mat_peptide JF439971_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439972_HBe_P-A Product feature CHAIN JF439972_HBe_P-A of FT:mat_peptide JF439972_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLPFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439973_HBe_P-A Product feature CHAIN JF439973_HBe_P-A of FT:mat_peptide JF439973_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439974_HBe_P-A Product feature CHAIN JF439974_HBe_P-A of FT:mat_peptide JF439974_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439975_HBe_P-A Product feature CHAIN JF439975_HBe_P-A of FT:mat_peptide JF439975_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439976_HBe_P-A Product feature CHAIN JF439976_HBe_P-A of FT:mat_peptide JF439976_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439977_HBe_P-A Product feature CHAIN JF439977_HBe_P-A of FT:mat_peptide JF439977_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439979_HBe_P-A Product feature CHAIN JF439979_HBe_P-A of FT:mat_peptide JF439979_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIPCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439980_HBe_P-A Product feature CHAIN JF439980_HBe_P-A of FT:mat_peptide JF439980_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439981_HBe_P-A Product feature CHAIN JF439981_HBe_P-A of FT:mat_peptide JF439981_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLGTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVKYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439982_HBe_P-A Product feature CHAIN JF439982_HBe_P-A of FT:mat_peptide JF439982_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439983_HBe_P-A Product feature CHAIN JF439983_HBe_P-A of FT:mat_peptide JF439983_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439984_HBe_P-A Product feature CHAIN JF439984_HBe_P-A of FT:mat_peptide JF439984_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439985_HBe_P-A Product feature CHAIN JF439985_HBe_P-A of FT:mat_peptide JF439985_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439986_HBe_P-A Product feature CHAIN JF439986_HBe_P-A of FT:mat_peptide JF439986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYIEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELLTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439987_HBe_P-A Product feature CHAIN JF439987_HBe_P-A of FT:mat_peptide JF439987_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439988_HBe_P-A Product feature CHAIN JF439988_HBe_P-A of FT:mat_peptide JF439988_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439989_HBe_P-A Product feature CHAIN JF439989_HBe_P-A of FT:mat_peptide JF439989_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439990_HBe_P-A Product feature CHAIN JF439990_HBe_P-A of FT:mat_peptide JF439990_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILPTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439991_HBe_P-A Product feature CHAIN JF439991_HBe_P-A of FT:mat_peptide JF439991_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439992_HBe_P-A Product feature CHAIN JF439992_HBe_P-A of FT:mat_peptide JF439992_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYREALESPEHCSPHHTALGQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF439993_HBe_P-A Product feature CHAIN JF439993_HBe_P-A of FT:mat_peptide JF439993_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JF440016_HBe_P-A Product feature CHAIN JF440016_HBe_P-A of FT:mat_peptide JF440016_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B11). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182318_HBe_P-A Product feature CHAIN JN182318_HBe_P-A of FT:mat_peptide JN182318_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182319_HBe_P-A Product feature CHAIN JN182319_HBe_P-A of FT:mat_peptide JN182319_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182320_HBe_P-A Product feature CHAIN JN182320_HBe_P-A of FT:mat_peptide JN182320_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182321_HBe_P-A Product feature CHAIN JN182321_HBe_P-A of FT:mat_peptide JN182321_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182322_HBe_P-A Product feature CHAIN JN182322_HBe_P-A of FT:mat_peptide JN182322_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182323_HBe_P-A Product feature CHAIN JN182323_HBe_P-A of FT:mat_peptide JN182323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSYGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182324_HBe_P-A Product feature CHAIN JN182324_HBe_P-A of FT:mat_peptide JN182324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182325_HBe_P-A Product feature CHAIN JN182325_HBe_P-A of FT:mat_peptide JN182325_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILRWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182326_HBe_P-A Product feature CHAIN JN182326_HBe_P-A of FT:mat_peptide JN182326_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQTILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182327_HBe_P-A Product feature CHAIN JN182327_HBe_P-A of FT:mat_peptide JN182327_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182328_HBe_P-A Product feature CHAIN JN182328_HBe_P-A of FT:mat_peptide JN182328_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCPGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182329_HBe_P-A Product feature CHAIN JN182329_HBe_P-A of FT:mat_peptide JN182329_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182330_HBe_P-A Product feature CHAIN JN182330_HBe_P-A of FT:mat_peptide JN182330_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182331_HBe_P-A Product feature CHAIN JN182331_HBe_P-A of FT:mat_peptide JN182331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182332_HBe_P-A Product feature CHAIN JN182332_HBe_P-A of FT:mat_peptide JN182332_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQRLWFHISCLTFGRETALEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182333_HBe_P-A Product feature CHAIN JN182333_HBe_P-A of FT:mat_peptide JN182333_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JN182334_HBe_P-A Product feature CHAIN JN182334_HBe_P-A of FT:mat_peptide JN182334_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEPMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ023660_HBe_P-A Product feature CHAIN JQ023660_HBe_P-A of FT:mat_peptide JQ023660_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1160). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREDLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPKAPILSTLPETTVVR
RRDRGK
>gnl|hbvpro|JQ023661_HBe_P-A Product feature CHAIN JQ023661_HBe_P-A of FT:mat_peptide JQ023661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREDLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPKAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ038390_HBe_P-A Product feature CHAIN JQ038390_HBe_P-A of FT:mat_peptide JQ038390_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SM16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ038410_HBe_P-A Product feature CHAIN JQ038410_HBe_P-A of FT:mat_peptide JQ038410_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SM36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ687529_HBe_P-A Product feature CHAIN JQ687529_HBe_P-A of FT:mat_peptide JQ687529_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 176). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ687533_HBe_P-A Product feature CHAIN JQ687533_HBe_P-A of FT:mat_peptide JQ687533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb 210). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707299_HBe_P-A Product feature CHAIN JQ707299_HBe_P-A of FT:mat_peptide JQ707299_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707300_HBe_P-A Product feature CHAIN JQ707300_HBe_P-A of FT:mat_peptide JQ707300_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C11). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707301_HBe_P-A Product feature CHAIN JQ707301_HBe_P-A of FT:mat_peptide JQ707301_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C12). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707302_HBe_P-A Product feature CHAIN JQ707302_HBe_P-A of FT:mat_peptide JQ707302_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C13). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707303_HBe_P-A Product feature CHAIN JQ707303_HBe_P-A of FT:mat_peptide JQ707303_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707304_HBe_P-A Product feature CHAIN JQ707304_HBe_P-A of FT:mat_peptide JQ707304_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C15). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707305_HBe_P-A Product feature CHAIN JQ707305_HBe_P-A of FT:mat_peptide JQ707305_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707306_HBe_P-A Product feature CHAIN JQ707306_HBe_P-A of FT:mat_peptide JQ707306_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C17). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707307_HBe_P-A Product feature CHAIN JQ707307_HBe_P-A of FT:mat_peptide JQ707307_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C18). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707308_HBe_P-A Product feature CHAIN JQ707308_HBe_P-A of FT:mat_peptide JQ707308_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C19). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707309_HBe_P-A Product feature CHAIN JQ707309_HBe_P-A of FT:mat_peptide JQ707309_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707310_HBe_P-A Product feature CHAIN JQ707310_HBe_P-A of FT:mat_peptide JQ707310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C20). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707311_HBe_P-A Product feature CHAIN JQ707311_HBe_P-A of FT:mat_peptide JQ707311_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707312_HBe_P-A Product feature CHAIN JQ707312_HBe_P-A of FT:mat_peptide JQ707312_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C22). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFNISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707313_HBe_P-A Product feature CHAIN JQ707313_HBe_P-A of FT:mat_peptide JQ707313_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C23). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707314_HBe_P-A Product feature CHAIN JQ707314_HBe_P-A of FT:mat_peptide JQ707314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C24). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707315_HBe_P-A Product feature CHAIN JQ707315_HBe_P-A of FT:mat_peptide JQ707315_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSGFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707316_HBe_P-A Product feature CHAIN JQ707316_HBe_P-A of FT:mat_peptide JQ707316_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C26). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707317_HBe_P-A Product feature CHAIN JQ707317_HBe_P-A of FT:mat_peptide JQ707317_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707318_HBe_P-A Product feature CHAIN JQ707318_HBe_P-A of FT:mat_peptide JQ707318_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707319_HBe_P-A Product feature CHAIN JQ707319_HBe_P-A of FT:mat_peptide JQ707319_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707320_HBe_P-A Product feature CHAIN JQ707320_HBe_P-A of FT:mat_peptide JQ707320_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C30). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707321_HBe_P-A Product feature CHAIN JQ707321_HBe_P-A of FT:mat_peptide JQ707321_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C31). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707322_HBe_P-A Product feature CHAIN JQ707322_HBe_P-A of FT:mat_peptide JQ707322_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C32). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707323_HBe_P-A Product feature CHAIN JQ707323_HBe_P-A of FT:mat_peptide JQ707323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C33). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707324_HBe_P-A Product feature CHAIN JQ707324_HBe_P-A of FT:mat_peptide JQ707324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C34). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707325_HBe_P-A Product feature CHAIN JQ707325_HBe_P-A of FT:mat_peptide JQ707325_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C35). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707326_HBe_P-A Product feature CHAIN JQ707326_HBe_P-A of FT:mat_peptide JQ707326_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C36). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707327_HBe_P-A Product feature CHAIN JQ707327_HBe_P-A of FT:mat_peptide JQ707327_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C37). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707329_HBe_P-A Product feature CHAIN JQ707329_HBe_P-A of FT:mat_peptide JQ707329_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C39). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSKLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707330_HBe_P-A Product feature CHAIN JQ707330_HBe_P-A of FT:mat_peptide JQ707330_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707331_HBe_P-A Product feature CHAIN JQ707331_HBe_P-A of FT:mat_peptide JQ707331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C40). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
RRDRGR
>gnl|hbvpro|JQ707332_HBe_P-A Product feature CHAIN JQ707332_HBe_P-A of FT:mat_peptide JQ707332_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C41). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707333_HBe_P-A Product feature CHAIN JQ707333_HBe_P-A of FT:mat_peptide JQ707333_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C42). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707334_HBe_P-A Product feature CHAIN JQ707334_HBe_P-A of FT:mat_peptide JQ707334_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C43). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707335_HBe_P-A Product feature CHAIN JQ707335_HBe_P-A of FT:mat_peptide JQ707335_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C44). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707336_HBe_P-A Product feature CHAIN JQ707336_HBe_P-A of FT:mat_peptide JQ707336_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C45). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707337_HBe_P-A Product feature CHAIN JQ707337_HBe_P-A of FT:mat_peptide JQ707337_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C46). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707338_HBe_P-A Product feature CHAIN JQ707338_HBe_P-A of FT:mat_peptide JQ707338_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C47). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707339_HBe_P-A Product feature CHAIN JQ707339_HBe_P-A of FT:mat_peptide JQ707339_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C48). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALGSPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707340_HBe_P-A Product feature CHAIN JQ707340_HBe_P-A of FT:mat_peptide JQ707340_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707341_HBe_P-A Product feature CHAIN JQ707341_HBe_P-A of FT:mat_peptide JQ707341_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C6). Complete genome. [Hepadnaviridae] (length=166 residues).
FKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707342_HBe_P-A Product feature CHAIN JQ707342_HBe_P-A of FT:mat_peptide JQ707342_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C7). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707343_HBe_P-A Product feature CHAIN JQ707343_HBe_P-A of FT:mat_peptide JQ707343_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707344_HBe_P-A Product feature CHAIN JQ707344_HBe_P-A of FT:mat_peptide JQ707344_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1-C9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707345_HBe_P-A Product feature CHAIN JQ707345_HBe_P-A of FT:mat_peptide JQ707345_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELVSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707346_HBe_P-A Product feature CHAIN JQ707346_HBe_P-A of FT:mat_peptide JQ707346_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C12). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQEPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPDYRSPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707347_HBe_P-A Product feature CHAIN JQ707347_HBe_P-A of FT:mat_peptide JQ707347_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C13). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707348_HBe_P-A Product feature CHAIN JQ707348_HBe_P-A of FT:mat_peptide JQ707348_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707349_HBe_P-A Product feature CHAIN JQ707349_HBe_P-A of FT:mat_peptide JQ707349_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C15). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707350_HBe_P-A Product feature CHAIN JQ707350_HBe_P-A of FT:mat_peptide JQ707350_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707351_HBe_P-A Product feature CHAIN JQ707351_HBe_P-A of FT:mat_peptide JQ707351_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707352_HBe_P-A Product feature CHAIN JQ707352_HBe_P-A of FT:mat_peptide JQ707352_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C20). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707353_HBe_P-A Product feature CHAIN JQ707353_HBe_P-A of FT:mat_peptide JQ707353_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707354_HBe_P-A Product feature CHAIN JQ707354_HBe_P-A of FT:mat_peptide JQ707354_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C22-2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707355_HBe_P-A Product feature CHAIN JQ707355_HBe_P-A of FT:mat_peptide JQ707355_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707356_HBe_P-A Product feature CHAIN JQ707356_HBe_P-A of FT:mat_peptide JQ707356_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707357_HBe_P-A Product feature CHAIN JQ707357_HBe_P-A of FT:mat_peptide JQ707357_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C29-2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707358_HBe_P-A Product feature CHAIN JQ707358_HBe_P-A of FT:mat_peptide JQ707358_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C33). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707359_HBe_P-A Product feature CHAIN JQ707359_HBe_P-A of FT:mat_peptide JQ707359_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C35). Complete genome. [Hepadnaviridae] (length=166 residues).
FKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707360_HBe_P-A Product feature CHAIN JQ707360_HBe_P-A of FT:mat_peptide JQ707360_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C36). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707361_HBe_P-A Product feature CHAIN JQ707361_HBe_P-A of FT:mat_peptide JQ707361_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C37). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707362_HBe_P-A Product feature CHAIN JQ707362_HBe_P-A of FT:mat_peptide JQ707362_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C39). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707363_HBe_P-A Product feature CHAIN JQ707363_HBe_P-A of FT:mat_peptide JQ707363_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707364_HBe_P-A Product feature CHAIN JQ707364_HBe_P-A of FT:mat_peptide JQ707364_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C41). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707365_HBe_P-A Product feature CHAIN JQ707365_HBe_P-A of FT:mat_peptide JQ707365_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C43). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707366_HBe_P-A Product feature CHAIN JQ707366_HBe_P-A of FT:mat_peptide JQ707366_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C44). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707367_HBe_P-A Product feature CHAIN JQ707367_HBe_P-A of FT:mat_peptide JQ707367_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C46). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707368_HBe_P-A Product feature CHAIN JQ707368_HBe_P-A of FT:mat_peptide JQ707368_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C47). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPSKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIVSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707369_HBe_P-A Product feature CHAIN JQ707369_HBe_P-A of FT:mat_peptide JQ707369_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C48). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIHTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707370_HBe_P-A Product feature CHAIN JQ707370_HBe_P-A of FT:mat_peptide JQ707370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3-C5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707371_HBe_P-A Product feature CHAIN JQ707371_HBe_P-A of FT:mat_peptide JQ707371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707372_HBe_P-A Product feature CHAIN JQ707372_HBe_P-A of FT:mat_peptide JQ707372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C11). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707373_HBe_P-A Product feature CHAIN JQ707373_HBe_P-A of FT:mat_peptide JQ707373_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707374_HBe_P-A Product feature CHAIN JQ707374_HBe_P-A of FT:mat_peptide JQ707374_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C15). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707375_HBe_P-A Product feature CHAIN JQ707375_HBe_P-A of FT:mat_peptide JQ707375_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C17-2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707376_HBe_P-A Product feature CHAIN JQ707376_HBe_P-A of FT:mat_peptide JQ707376_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707377_HBe_P-A Product feature CHAIN JQ707377_HBe_P-A of FT:mat_peptide JQ707377_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707378_HBe_P-A Product feature CHAIN JQ707378_HBe_P-A of FT:mat_peptide JQ707378_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C22). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707379_HBe_P-A Product feature CHAIN JQ707379_HBe_P-A of FT:mat_peptide JQ707379_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C24-9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707380_HBe_P-A Product feature CHAIN JQ707380_HBe_P-A of FT:mat_peptide JQ707380_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707381_HBe_P-A Product feature CHAIN JQ707381_HBe_P-A of FT:mat_peptide JQ707381_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707382_HBe_P-A Product feature CHAIN JQ707382_HBe_P-A of FT:mat_peptide JQ707382_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVDNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707383_HBe_P-A Product feature CHAIN JQ707383_HBe_P-A of FT:mat_peptide JQ707383_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C31). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707384_HBe_P-A Product feature CHAIN JQ707384_HBe_P-A of FT:mat_peptide JQ707384_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C32). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707385_HBe_P-A Product feature CHAIN JQ707385_HBe_P-A of FT:mat_peptide JQ707385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C33). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707386_HBe_P-A Product feature CHAIN JQ707386_HBe_P-A of FT:mat_peptide JQ707386_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C34). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707387_HBe_P-A Product feature CHAIN JQ707387_HBe_P-A of FT:mat_peptide JQ707387_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C36). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707388_HBe_P-A Product feature CHAIN JQ707388_HBe_P-A of FT:mat_peptide JQ707388_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C37). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLLVNYVNGDMGLKIRQLGRFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707389_HBe_P-A Product feature CHAIN JQ707389_HBe_P-A of FT:mat_peptide JQ707389_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C38). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707390_HBe_P-A Product feature CHAIN JQ707390_HBe_P-A of FT:mat_peptide JQ707390_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C39). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707391_HBe_P-A Product feature CHAIN JQ707391_HBe_P-A of FT:mat_peptide JQ707391_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707392_HBe_P-A Product feature CHAIN JQ707392_HBe_P-A of FT:mat_peptide JQ707392_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C40). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707393_HBe_P-A Product feature CHAIN JQ707393_HBe_P-A of FT:mat_peptide JQ707393_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C42). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707394_HBe_P-A Product feature CHAIN JQ707394_HBe_P-A of FT:mat_peptide JQ707394_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C44). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707395_HBe_P-A Product feature CHAIN JQ707395_HBe_P-A of FT:mat_peptide JQ707395_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C46). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707396_HBe_P-A Product feature CHAIN JQ707396_HBe_P-A of FT:mat_peptide JQ707396_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C47). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYINTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707397_HBe_P-A Product feature CHAIN JQ707397_HBe_P-A of FT:mat_peptide JQ707397_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C48). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707398_HBe_P-A Product feature CHAIN JQ707398_HBe_P-A of FT:mat_peptide JQ707398_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707399_HBe_P-A Product feature CHAIN JQ707399_HBe_P-A of FT:mat_peptide JQ707399_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1-C6). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707400_HBe_P-A Product feature CHAIN JQ707400_HBe_P-A of FT:mat_peptide JQ707400_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707401_HBe_P-A Product feature CHAIN JQ707401_HBe_P-A of FT:mat_peptide JQ707401_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707402_HBe_P-A Product feature CHAIN JQ707402_HBe_P-A of FT:mat_peptide JQ707402_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C11-3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707403_HBe_P-A Product feature CHAIN JQ707403_HBe_P-A of FT:mat_peptide JQ707403_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707404_HBe_P-A Product feature CHAIN JQ707404_HBe_P-A of FT:mat_peptide JQ707404_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C17). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707405_HBe_P-A Product feature CHAIN JQ707405_HBe_P-A of FT:mat_peptide JQ707405_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C18). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707406_HBe_P-A Product feature CHAIN JQ707406_HBe_P-A of FT:mat_peptide JQ707406_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C19). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707407_HBe_P-A Product feature CHAIN JQ707407_HBe_P-A of FT:mat_peptide JQ707407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C20-9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707408_HBe_P-A Product feature CHAIN JQ707408_HBe_P-A of FT:mat_peptide JQ707408_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C23). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707409_HBe_P-A Product feature CHAIN JQ707409_HBe_P-A of FT:mat_peptide JQ707409_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C26-5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707410_HBe_P-A Product feature CHAIN JQ707410_HBe_P-A of FT:mat_peptide JQ707410_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707411_HBe_P-A Product feature CHAIN JQ707411_HBe_P-A of FT:mat_peptide JQ707411_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707412_HBe_P-A Product feature CHAIN JQ707412_HBe_P-A of FT:mat_peptide JQ707412_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C32). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707413_HBe_P-A Product feature CHAIN JQ707413_HBe_P-A of FT:mat_peptide JQ707413_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C34). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707414_HBe_P-A Product feature CHAIN JQ707414_HBe_P-A of FT:mat_peptide JQ707414_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C35). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASTLYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707415_HBe_P-A Product feature CHAIN JQ707415_HBe_P-A of FT:mat_peptide JQ707415_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C40). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707416_HBe_P-A Product feature CHAIN JQ707416_HBe_P-A of FT:mat_peptide JQ707416_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C41). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707417_HBe_P-A Product feature CHAIN JQ707417_HBe_P-A of FT:mat_peptide JQ707417_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C44). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707418_HBe_P-A Product feature CHAIN JQ707418_HBe_P-A of FT:mat_peptide JQ707418_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C47). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707419_HBe_P-A Product feature CHAIN JQ707419_HBe_P-A of FT:mat_peptide JQ707419_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C48). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707420_HBe_P-A Product feature CHAIN JQ707420_HBe_P-A of FT:mat_peptide JQ707420_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3-C6). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707531_HBe_P-A Product feature CHAIN JQ707531_HBe_P-A of FT:mat_peptide JQ707531_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707532_HBe_P-A Product feature CHAIN JQ707532_HBe_P-A of FT:mat_peptide JQ707532_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707533_HBe_P-A Product feature CHAIN JQ707533_HBe_P-A of FT:mat_peptide JQ707533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C11). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707534_HBe_P-A Product feature CHAIN JQ707534_HBe_P-A of FT:mat_peptide JQ707534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C12). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707535_HBe_P-A Product feature CHAIN JQ707535_HBe_P-A of FT:mat_peptide JQ707535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C13). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707536_HBe_P-A Product feature CHAIN JQ707536_HBe_P-A of FT:mat_peptide JQ707536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707537_HBe_P-A Product feature CHAIN JQ707537_HBe_P-A of FT:mat_peptide JQ707537_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C15). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707538_HBe_P-A Product feature CHAIN JQ707538_HBe_P-A of FT:mat_peptide JQ707538_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707539_HBe_P-A Product feature CHAIN JQ707539_HBe_P-A of FT:mat_peptide JQ707539_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C17). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707540_HBe_P-A Product feature CHAIN JQ707540_HBe_P-A of FT:mat_peptide JQ707540_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C18). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707541_HBe_P-A Product feature CHAIN JQ707541_HBe_P-A of FT:mat_peptide JQ707541_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C19). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707542_HBe_P-A Product feature CHAIN JQ707542_HBe_P-A of FT:mat_peptide JQ707542_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707543_HBe_P-A Product feature CHAIN JQ707543_HBe_P-A of FT:mat_peptide JQ707543_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C22). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707544_HBe_P-A Product feature CHAIN JQ707544_HBe_P-A of FT:mat_peptide JQ707544_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C23). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707545_HBe_P-A Product feature CHAIN JQ707545_HBe_P-A of FT:mat_peptide JQ707545_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C24). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707546_HBe_P-A Product feature CHAIN JQ707546_HBe_P-A of FT:mat_peptide JQ707546_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C26). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707547_HBe_P-A Product feature CHAIN JQ707547_HBe_P-A of FT:mat_peptide JQ707547_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707548_HBe_P-A Product feature CHAIN JQ707548_HBe_P-A of FT:mat_peptide JQ707548_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707549_HBe_P-A Product feature CHAIN JQ707549_HBe_P-A of FT:mat_peptide JQ707549_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C29). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707550_HBe_P-A Product feature CHAIN JQ707550_HBe_P-A of FT:mat_peptide JQ707550_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707551_HBe_P-A Product feature CHAIN JQ707551_HBe_P-A of FT:mat_peptide JQ707551_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C30). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707552_HBe_P-A Product feature CHAIN JQ707552_HBe_P-A of FT:mat_peptide JQ707552_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C31). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707553_HBe_P-A Product feature CHAIN JQ707553_HBe_P-A of FT:mat_peptide JQ707553_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C32). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707554_HBe_P-A Product feature CHAIN JQ707554_HBe_P-A of FT:mat_peptide JQ707554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C33). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707555_HBe_P-A Product feature CHAIN JQ707555_HBe_P-A of FT:mat_peptide JQ707555_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C34). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707556_HBe_P-A Product feature CHAIN JQ707556_HBe_P-A of FT:mat_peptide JQ707556_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C35). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707557_HBe_P-A Product feature CHAIN JQ707557_HBe_P-A of FT:mat_peptide JQ707557_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C36). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707558_HBe_P-A Product feature CHAIN JQ707558_HBe_P-A of FT:mat_peptide JQ707558_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C38). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707559_HBe_P-A Product feature CHAIN JQ707559_HBe_P-A of FT:mat_peptide JQ707559_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707560_HBe_P-A Product feature CHAIN JQ707560_HBe_P-A of FT:mat_peptide JQ707560_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C40). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707561_HBe_P-A Product feature CHAIN JQ707561_HBe_P-A of FT:mat_peptide JQ707561_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C41). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707562_HBe_P-A Product feature CHAIN JQ707562_HBe_P-A of FT:mat_peptide JQ707562_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C42). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707563_HBe_P-A Product feature CHAIN JQ707563_HBe_P-A of FT:mat_peptide JQ707563_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C43). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707564_HBe_P-A Product feature CHAIN JQ707564_HBe_P-A of FT:mat_peptide JQ707564_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C44). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707565_HBe_P-A Product feature CHAIN JQ707565_HBe_P-A of FT:mat_peptide JQ707565_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C45). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHSSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707566_HBe_P-A Product feature CHAIN JQ707566_HBe_P-A of FT:mat_peptide JQ707566_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C46). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707567_HBe_P-A Product feature CHAIN JQ707567_HBe_P-A of FT:mat_peptide JQ707567_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C47). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707568_HBe_P-A Product feature CHAIN JQ707568_HBe_P-A of FT:mat_peptide JQ707568_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C48). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707569_HBe_P-A Product feature CHAIN JQ707569_HBe_P-A of FT:mat_peptide JQ707569_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707570_HBe_P-A Product feature CHAIN JQ707570_HBe_P-A of FT:mat_peptide JQ707570_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C6). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707571_HBe_P-A Product feature CHAIN JQ707571_HBe_P-A of FT:mat_peptide JQ707571_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C7). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707572_HBe_P-A Product feature CHAIN JQ707572_HBe_P-A of FT:mat_peptide JQ707572_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707573_HBe_P-A Product feature CHAIN JQ707573_HBe_P-A of FT:mat_peptide JQ707573_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1-C9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707574_HBe_P-A Product feature CHAIN JQ707574_HBe_P-A of FT:mat_peptide JQ707574_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707575_HBe_P-A Product feature CHAIN JQ707575_HBe_P-A of FT:mat_peptide JQ707575_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C13). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707576_HBe_P-A Product feature CHAIN JQ707576_HBe_P-A of FT:mat_peptide JQ707576_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMNIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707577_HBe_P-A Product feature CHAIN JQ707577_HBe_P-A of FT:mat_peptide JQ707577_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C15). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707578_HBe_P-A Product feature CHAIN JQ707578_HBe_P-A of FT:mat_peptide JQ707578_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLLFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707579_HBe_P-A Product feature CHAIN JQ707579_HBe_P-A of FT:mat_peptide JQ707579_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C17). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707580_HBe_P-A Product feature CHAIN JQ707580_HBe_P-A of FT:mat_peptide JQ707580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C18). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707581_HBe_P-A Product feature CHAIN JQ707581_HBe_P-A of FT:mat_peptide JQ707581_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C19). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707582_HBe_P-A Product feature CHAIN JQ707582_HBe_P-A of FT:mat_peptide JQ707582_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|JQ707583_HBe_P-A Product feature CHAIN JQ707583_HBe_P-A of FT:mat_peptide JQ707583_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707584_HBe_P-A Product feature CHAIN JQ707584_HBe_P-A of FT:mat_peptide JQ707584_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C22). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707585_HBe_P-A Product feature CHAIN JQ707585_HBe_P-A of FT:mat_peptide JQ707585_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C23). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707586_HBe_P-A Product feature CHAIN JQ707586_HBe_P-A of FT:mat_peptide JQ707586_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C24). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707587_HBe_P-A Product feature CHAIN JQ707587_HBe_P-A of FT:mat_peptide JQ707587_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707588_HBe_P-A Product feature CHAIN JQ707588_HBe_P-A of FT:mat_peptide JQ707588_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C26). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707589_HBe_P-A Product feature CHAIN JQ707589_HBe_P-A of FT:mat_peptide JQ707589_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707590_HBe_P-A Product feature CHAIN JQ707590_HBe_P-A of FT:mat_peptide JQ707590_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707591_HBe_P-A Product feature CHAIN JQ707591_HBe_P-A of FT:mat_peptide JQ707591_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C29). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707592_HBe_P-A Product feature CHAIN JQ707592_HBe_P-A of FT:mat_peptide JQ707592_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707593_HBe_P-A Product feature CHAIN JQ707593_HBe_P-A of FT:mat_peptide JQ707593_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C33). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLAFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707594_HBe_P-A Product feature CHAIN JQ707594_HBe_P-A of FT:mat_peptide JQ707594_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C34). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|JQ707595_HBe_P-A Product feature CHAIN JQ707595_HBe_P-A of FT:mat_peptide JQ707595_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C35). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707596_HBe_P-A Product feature CHAIN JQ707596_HBe_P-A of FT:mat_peptide JQ707596_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C36). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707597_HBe_P-A Product feature CHAIN JQ707597_HBe_P-A of FT:mat_peptide JQ707597_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C37). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707598_HBe_P-A Product feature CHAIN JQ707598_HBe_P-A of FT:mat_peptide JQ707598_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C38). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|JQ707599_HBe_P-A Product feature CHAIN JQ707599_HBe_P-A of FT:mat_peptide JQ707599_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707600_HBe_P-A Product feature CHAIN JQ707600_HBe_P-A of FT:mat_peptide JQ707600_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C40). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707601_HBe_P-A Product feature CHAIN JQ707601_HBe_P-A of FT:mat_peptide JQ707601_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C41). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707602_HBe_P-A Product feature CHAIN JQ707602_HBe_P-A of FT:mat_peptide JQ707602_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C42). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGKLMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707603_HBe_P-A Product feature CHAIN JQ707603_HBe_P-A of FT:mat_peptide JQ707603_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C43). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707604_HBe_P-A Product feature CHAIN JQ707604_HBe_P-A of FT:mat_peptide JQ707604_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C44). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707605_HBe_P-A Product feature CHAIN JQ707605_HBe_P-A of FT:mat_peptide JQ707605_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C45). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707606_HBe_P-A Product feature CHAIN JQ707606_HBe_P-A of FT:mat_peptide JQ707606_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C48). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707607_HBe_P-A Product feature CHAIN JQ707607_HBe_P-A of FT:mat_peptide JQ707607_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|JQ707608_HBe_P-A Product feature CHAIN JQ707608_HBe_P-A of FT:mat_peptide JQ707608_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3-C9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707609_HBe_P-A Product feature CHAIN JQ707609_HBe_P-A of FT:mat_peptide JQ707609_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707610_HBe_P-A Product feature CHAIN JQ707610_HBe_P-A of FT:mat_peptide JQ707610_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707611_HBe_P-A Product feature CHAIN JQ707611_HBe_P-A of FT:mat_peptide JQ707611_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C11). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707612_HBe_P-A Product feature CHAIN JQ707612_HBe_P-A of FT:mat_peptide JQ707612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C13). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707613_HBe_P-A Product feature CHAIN JQ707613_HBe_P-A of FT:mat_peptide JQ707613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C15). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707614_HBe_P-A Product feature CHAIN JQ707614_HBe_P-A of FT:mat_peptide JQ707614_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C17). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707615_HBe_P-A Product feature CHAIN JQ707615_HBe_P-A of FT:mat_peptide JQ707615_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C18). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707616_HBe_P-A Product feature CHAIN JQ707616_HBe_P-A of FT:mat_peptide JQ707616_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707617_HBe_P-A Product feature CHAIN JQ707617_HBe_P-A of FT:mat_peptide JQ707617_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707618_HBe_P-A Product feature CHAIN JQ707618_HBe_P-A of FT:mat_peptide JQ707618_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C22). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707619_HBe_P-A Product feature CHAIN JQ707619_HBe_P-A of FT:mat_peptide JQ707619_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C23). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707620_HBe_P-A Product feature CHAIN JQ707620_HBe_P-A of FT:mat_peptide JQ707620_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C24). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707621_HBe_P-A Product feature CHAIN JQ707621_HBe_P-A of FT:mat_peptide JQ707621_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C26). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707622_HBe_P-A Product feature CHAIN JQ707622_HBe_P-A of FT:mat_peptide JQ707622_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707623_HBe_P-A Product feature CHAIN JQ707623_HBe_P-A of FT:mat_peptide JQ707623_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEFPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707624_HBe_P-A Product feature CHAIN JQ707624_HBe_P-A of FT:mat_peptide JQ707624_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707625_HBe_P-A Product feature CHAIN JQ707625_HBe_P-A of FT:mat_peptide JQ707625_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C30). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707626_HBe_P-A Product feature CHAIN JQ707626_HBe_P-A of FT:mat_peptide JQ707626_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C31). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707627_HBe_P-A Product feature CHAIN JQ707627_HBe_P-A of FT:mat_peptide JQ707627_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C32). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707628_HBe_P-A Product feature CHAIN JQ707628_HBe_P-A of FT:mat_peptide JQ707628_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C33). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707629_HBe_P-A Product feature CHAIN JQ707629_HBe_P-A of FT:mat_peptide JQ707629_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C34). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707630_HBe_P-A Product feature CHAIN JQ707630_HBe_P-A of FT:mat_peptide JQ707630_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C35). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707631_HBe_P-A Product feature CHAIN JQ707631_HBe_P-A of FT:mat_peptide JQ707631_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C36-6). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707632_HBe_P-A Product feature CHAIN JQ707632_HBe_P-A of FT:mat_peptide JQ707632_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707633_HBe_P-A Product feature CHAIN JQ707633_HBe_P-A of FT:mat_peptide JQ707633_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C41). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707634_HBe_P-A Product feature CHAIN JQ707634_HBe_P-A of FT:mat_peptide JQ707634_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C42). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRELVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707635_HBe_P-A Product feature CHAIN JQ707635_HBe_P-A of FT:mat_peptide JQ707635_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C45). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707636_HBe_P-A Product feature CHAIN JQ707636_HBe_P-A of FT:mat_peptide JQ707636_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C46). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707637_HBe_P-A Product feature CHAIN JQ707637_HBe_P-A of FT:mat_peptide JQ707637_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1-C5-5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707638_HBe_P-A Product feature CHAIN JQ707638_HBe_P-A of FT:mat_peptide JQ707638_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C12). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707639_HBe_P-A Product feature CHAIN JQ707639_HBe_P-A of FT:mat_peptide JQ707639_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C13-9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707640_HBe_P-A Product feature CHAIN JQ707640_HBe_P-A of FT:mat_peptide JQ707640_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707641_HBe_P-A Product feature CHAIN JQ707641_HBe_P-A of FT:mat_peptide JQ707641_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C17). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707642_HBe_P-A Product feature CHAIN JQ707642_HBe_P-A of FT:mat_peptide JQ707642_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707643_HBe_P-A Product feature CHAIN JQ707643_HBe_P-A of FT:mat_peptide JQ707643_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C20-7). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707644_HBe_P-A Product feature CHAIN JQ707644_HBe_P-A of FT:mat_peptide JQ707644_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C22). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707645_HBe_P-A Product feature CHAIN JQ707645_HBe_P-A of FT:mat_peptide JQ707645_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C24). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707646_HBe_P-A Product feature CHAIN JQ707646_HBe_P-A of FT:mat_peptide JQ707646_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C26). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707647_HBe_P-A Product feature CHAIN JQ707647_HBe_P-A of FT:mat_peptide JQ707647_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707648_HBe_P-A Product feature CHAIN JQ707648_HBe_P-A of FT:mat_peptide JQ707648_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707649_HBe_P-A Product feature CHAIN JQ707649_HBe_P-A of FT:mat_peptide JQ707649_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707650_HBe_P-A Product feature CHAIN JQ707650_HBe_P-A of FT:mat_peptide JQ707650_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C30). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707651_HBe_P-A Product feature CHAIN JQ707651_HBe_P-A of FT:mat_peptide JQ707651_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C33). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707652_HBe_P-A Product feature CHAIN JQ707652_HBe_P-A of FT:mat_peptide JQ707652_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C34). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707653_HBe_P-A Product feature CHAIN JQ707653_HBe_P-A of FT:mat_peptide JQ707653_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C38). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707654_HBe_P-A Product feature CHAIN JQ707654_HBe_P-A of FT:mat_peptide JQ707654_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C40). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707655_HBe_P-A Product feature CHAIN JQ707655_HBe_P-A of FT:mat_peptide JQ707655_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C41). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707656_HBe_P-A Product feature CHAIN JQ707656_HBe_P-A of FT:mat_peptide JQ707656_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3-C43). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707658_HBe_P-A Product feature CHAIN JQ707658_HBe_P-A of FT:mat_peptide JQ707658_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707659_HBe_P-A Product feature CHAIN JQ707659_HBe_P-A of FT:mat_peptide JQ707659_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707661_HBe_P-A Product feature CHAIN JQ707661_HBe_P-A of FT:mat_peptide JQ707661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707662_HBe_P-A Product feature CHAIN JQ707662_HBe_P-A of FT:mat_peptide JQ707662_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707663_HBe_P-A Product feature CHAIN JQ707663_HBe_P-A of FT:mat_peptide JQ707663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707664_HBe_P-A Product feature CHAIN JQ707664_HBe_P-A of FT:mat_peptide JQ707664_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707665_HBe_P-A Product feature CHAIN JQ707665_HBe_P-A of FT:mat_peptide JQ707665_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707667_HBe_P-A Product feature CHAIN JQ707667_HBe_P-A of FT:mat_peptide JQ707667_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707669_HBe_P-A Product feature CHAIN JQ707669_HBe_P-A of FT:mat_peptide JQ707669_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707670_HBe_P-A Product feature CHAIN JQ707670_HBe_P-A of FT:mat_peptide JQ707670_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707672_HBe_P-A Product feature CHAIN JQ707672_HBe_P-A of FT:mat_peptide JQ707672_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707674_HBe_P-A Product feature CHAIN JQ707674_HBe_P-A of FT:mat_peptide JQ707674_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707675_HBe_P-A Product feature CHAIN JQ707675_HBe_P-A of FT:mat_peptide JQ707675_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707676_HBe_P-A Product feature CHAIN JQ707676_HBe_P-A of FT:mat_peptide JQ707676_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JQ707681_HBe_P-A Product feature CHAIN JQ707681_HBe_P-A of FT:mat_peptide JQ707681_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9-12). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JX079944_HBe_P-A Product feature CHAIN JX079944_HBe_P-A of FT:mat_peptide JX079944_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FF4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLXETTVVR
RRDRGR
>gnl|hbvpro|JX079945_HBe_P-A Product feature CHAIN JX079945_HBe_P-A of FT:mat_peptide JX079945_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FF6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASMDLVVHYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDR
>gnl|hbvpro|JX096952_HBe_P-A Product feature CHAIN JX096952_HBe_P-A of FT:mat_peptide JX096952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11-10165). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JX096953_HBe_P-A Product feature CHAIN JX096953_HBe_P-A of FT:mat_peptide JX096953_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12-8957). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JX154579_HBe_P-A Product feature CHAIN JX154579_HBe_P-A of FT:mat_peptide JX154579_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JX154580_HBe_P-A Product feature CHAIN JX154580_HBe_P-A of FT:mat_peptide JX154580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JX154581_HBe_P-A Product feature CHAIN JX154581_HBe_P-A of FT:mat_peptide JX154581_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JX154582_HBe_P-A Product feature CHAIN JX154582_HBe_P-A of FT:mat_peptide JX154582_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JX310721_HBe_P-A Product feature CHAIN JX310721_HBe_P-A of FT:mat_peptide JX310721_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JX310722_HBe_P-A Product feature CHAIN JX310722_HBe_P-A of FT:mat_peptide JX310722_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JX310723_HBe_P-A Product feature CHAIN JX310723_HBe_P-A of FT:mat_peptide JX310723_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|JX310725_HBe_P-A Product feature CHAIN JX310725_HBe_P-A of FT:mat_peptide JX310725_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC836831_HBe_P-A Product feature CHAIN KC836831_HBe_P-A of FT:mat_peptide KC836831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC836832_HBe_P-A Product feature CHAIN KC836832_HBe_P-A of FT:mat_peptide KC836832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC836834_HBe_P-A Product feature CHAIN KC836834_HBe_P-A of FT:mat_peptide KC836834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC836846_HBe_P-A Product feature CHAIN KC836846_HBe_P-A of FT:mat_peptide KC836846_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC836849_HBe_P-A Product feature CHAIN KC836849_HBe_P-A of FT:mat_peptide KC836849_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC836854_HBe_P-A Product feature CHAIN KC836854_HBe_P-A of FT:mat_peptide KC836854_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC836858_HBe_P-A Product feature CHAIN KC836858_HBe_P-A of FT:mat_peptide KC836858_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC875251_HBe_P-A Product feature CHAIN KC875251_HBe_P-A of FT:mat_peptide KC875251_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALGSPEHCSPHHPALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC875252_HBe_P-A Product feature CHAIN KC875252_HBe_P-A of FT:mat_peptide KC875252_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIHCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC875253_HBe_P-A Product feature CHAIN KC875253_HBe_P-A of FT:mat_peptide KC875253_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV23). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC875255_HBe_P-A Product feature CHAIN KC875255_HBe_P-A of FT:mat_peptide KC875255_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV24). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVPFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC875256_HBe_P-A Product feature CHAIN KC875256_HBe_P-A of FT:mat_peptide KC875256_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCAPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC875257_HBe_P-A Product feature CHAIN KC875257_HBe_P-A of FT:mat_peptide KC875257_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WAGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC875258_HBe_P-A Product feature CHAIN KC875258_HBe_P-A of FT:mat_peptide KC875258_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV66). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPGYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC875259_HBe_P-A Product feature CHAIN KC875259_HBe_P-A of FT:mat_peptide KC875259_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV73). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYQEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRDRGR
>gnl|hbvpro|KC875260_HBe_P-A Product feature CHAIN KC875260_HBe_P-A of FT:mat_peptide KC875260_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KC999420_HBe_P-A Product feature CHAIN KC999420_HBe_P-A of FT:mat_peptide KC999420_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999422_HBe_P-A Product feature CHAIN KC999422_HBe_P-A of FT:mat_peptide KC999422_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999424_HBe_P-A Product feature CHAIN KC999424_HBe_P-A of FT:mat_peptide KC999424_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999425_HBe_P-A Product feature CHAIN KC999425_HBe_P-A of FT:mat_peptide KC999425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999428_HBe_P-A Product feature CHAIN KC999428_HBe_P-A of FT:mat_peptide KC999428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999430_HBe_P-A Product feature CHAIN KC999430_HBe_P-A of FT:mat_peptide KC999430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999433_HBe_P-A Product feature CHAIN KC999433_HBe_P-A of FT:mat_peptide KC999433_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999434_HBe_P-A Product feature CHAIN KC999434_HBe_P-A of FT:mat_peptide KC999434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999437_HBe_P-A Product feature CHAIN KC999437_HBe_P-A of FT:mat_peptide KC999437_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999438_HBe_P-A Product feature CHAIN KC999438_HBe_P-A of FT:mat_peptide KC999438_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999441_HBe_P-A Product feature CHAIN KC999441_HBe_P-A of FT:mat_peptide KC999441_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAQALFREALESPEHCSSHHTALRQAILCWGELMNLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999442_HBe_P-A Product feature CHAIN KC999442_HBe_P-A of FT:mat_peptide KC999442_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999444_HBe_P-A Product feature CHAIN KC999444_HBe_P-A of FT:mat_peptide KC999444_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGASVELISFLPHDFFPSVRDLLDTASALYREALESAEHCSPHHTALRQCSLCWGELMSLAN
WVGNNLQDPASRDQVVNYVNTNMGLKLRQLLWFHISCLTFGRQTVVDYLVSFGVWIRTPPAYRPPNAPILSMLPETTVVR
RRD
>gnl|hbvpro|KC999445_HBe_P-A Product feature CHAIN KC999445_HBe_P-A of FT:mat_peptide KC999445_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999447_HBe_P-A Product feature CHAIN KC999447_HBe_P-A of FT:mat_peptide KC999447_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999448_HBe_P-A Product feature CHAIN KC999448_HBe_P-A of FT:mat_peptide KC999448_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg37). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999449_HBe_P-A Product feature CHAIN KC999449_HBe_P-A of FT:mat_peptide KC999449_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFFPSAKDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELTTLAT
WVGNNLQDAASRDQVVTYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVR
RRD
>gnl|hbvpro|KC999451_HBe_P-A Product feature CHAIN KC999451_HBe_P-A of FT:mat_peptide KC999451_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999452_HBe_P-A Product feature CHAIN KC999452_HBe_P-A of FT:mat_peptide KC999452_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTAAALFREALESPDHCTPHHTALRQAVVCWGEVMTLAT
WVGSNLQDQASRDLVVNYVNINMGLKMRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999454_HBe_P-A Product feature CHAIN KC999454_HBe_P-A of FT:mat_peptide KC999454_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999457_HBe_P-A Product feature CHAIN KC999457_HBe_P-A of FT:mat_peptide KC999457_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg49). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWDMDIDLYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999459_HBe_P-A Product feature CHAIN KC999459_HBe_P-A of FT:mat_peptide KC999459_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg52). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KC999460_HBe_P-A Product feature CHAIN KC999460_HBe_P-A of FT:mat_peptide KC999460_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRD
>gnl|hbvpro|KF214657_HBe_P-A Product feature CHAIN KF214657_HBe_P-A of FT:mat_peptide KF214657_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF214658_HBe_P-A Product feature CHAIN KF214658_HBe_P-A of FT:mat_peptide KF214658_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-6). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SQLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF214659_HBe_P-A Product feature CHAIN KF214659_HBe_P-A of FT:mat_peptide KF214659_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2009-2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF214660_HBe_P-A Product feature CHAIN KF214660_HBe_P-A of FT:mat_peptide KF214660_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLQDTASALYREALESPEHCSHHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF214661_HBe_P-A Product feature CHAIN KF214661_HBe_P-A of FT:mat_peptide KF214661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRRAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF214662_HBe_P-A Product feature CHAIN KF214662_HBe_P-A of FT:mat_peptide KF214662_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF214663_HBe_P-A Product feature CHAIN KF214663_HBe_P-A of FT:mat_peptide KF214663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2007-11). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF214665_HBe_P-A Product feature CHAIN KF214665_HBe_P-A of FT:mat_peptide KF214665_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2008-3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF214666_HBe_P-A Product feature CHAIN KF214666_HBe_P-A of FT:mat_peptide KF214666_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND-2010-7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELTTLAG
WVGHNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KF779213_HBe_P-A Product feature CHAIN KF779213_HBe_P-A of FT:mat_peptide KF779213_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5744). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVDR
RRDRGR
>gnl|hbvpro|KF779215_HBe_P-A Product feature CHAIN KF779215_HBe_P-A of FT:mat_peptide KF779215_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5763). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVDR
RRDRGR
>gnl|hbvpro|KF779227_HBe_P-A Product feature CHAIN KF779227_HBe_P-A of FT:mat_peptide KF779227_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779231_HBe_P-A Product feature CHAIN KF779231_HBe_P-A of FT:mat_peptide KF779231_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779232_HBe_P-A Product feature CHAIN KF779232_HBe_P-A of FT:mat_peptide KF779232_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6088). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779234_HBe_P-A Product feature CHAIN KF779234_HBe_P-A of FT:mat_peptide KF779234_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6104). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779238_HBe_P-A Product feature CHAIN KF779238_HBe_P-A of FT:mat_peptide KF779238_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6119). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779239_HBe_P-A Product feature CHAIN KF779239_HBe_P-A of FT:mat_peptide KF779239_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6120). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779240_HBe_P-A Product feature CHAIN KF779240_HBe_P-A of FT:mat_peptide KF779240_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6123). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779243_HBe_P-A Product feature CHAIN KF779243_HBe_P-A of FT:mat_peptide KF779243_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779244_HBe_P-A Product feature CHAIN KF779244_HBe_P-A of FT:mat_peptide KF779244_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6152). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779245_HBe_P-A Product feature CHAIN KF779245_HBe_P-A of FT:mat_peptide KF779245_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6156). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779246_HBe_P-A Product feature CHAIN KF779246_HBe_P-A of FT:mat_peptide KF779246_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6163). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779247_HBe_P-A Product feature CHAIN KF779247_HBe_P-A of FT:mat_peptide KF779247_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6164). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779248_HBe_P-A Product feature CHAIN KF779248_HBe_P-A of FT:mat_peptide KF779248_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6168). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779249_HBe_P-A Product feature CHAIN KF779249_HBe_P-A of FT:mat_peptide KF779249_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6173). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779251_HBe_P-A Product feature CHAIN KF779251_HBe_P-A of FT:mat_peptide KF779251_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779252_HBe_P-A Product feature CHAIN KF779252_HBe_P-A of FT:mat_peptide KF779252_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3809). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779253_HBe_P-A Product feature CHAIN KF779253_HBe_P-A of FT:mat_peptide KF779253_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3817). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779254_HBe_P-A Product feature CHAIN KF779254_HBe_P-A of FT:mat_peptide KF779254_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3820). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPFVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779255_HBe_P-A Product feature CHAIN KF779255_HBe_P-A of FT:mat_peptide KF779255_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3825). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779256_HBe_P-A Product feature CHAIN KF779256_HBe_P-A of FT:mat_peptide KF779256_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3829). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779257_HBe_P-A Product feature CHAIN KF779257_HBe_P-A of FT:mat_peptide KF779257_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3857). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779258_HBe_P-A Product feature CHAIN KF779258_HBe_P-A of FT:mat_peptide KF779258_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3864). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779259_HBe_P-A Product feature CHAIN KF779259_HBe_P-A of FT:mat_peptide KF779259_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3892). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779260_HBe_P-A Product feature CHAIN KF779260_HBe_P-A of FT:mat_peptide KF779260_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3894). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLNIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779261_HBe_P-A Product feature CHAIN KF779261_HBe_P-A of FT:mat_peptide KF779261_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3896). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779262_HBe_P-A Product feature CHAIN KF779262_HBe_P-A of FT:mat_peptide KF779262_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3898). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779263_HBe_P-A Product feature CHAIN KF779263_HBe_P-A of FT:mat_peptide KF779263_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3903). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779264_HBe_P-A Product feature CHAIN KF779264_HBe_P-A of FT:mat_peptide KF779264_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3945). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779265_HBe_P-A Product feature CHAIN KF779265_HBe_P-A of FT:mat_peptide KF779265_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3946). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779266_HBe_P-A Product feature CHAIN KF779266_HBe_P-A of FT:mat_peptide KF779266_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3949). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779268_HBe_P-A Product feature CHAIN KF779268_HBe_P-A of FT:mat_peptide KF779268_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3966). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779269_HBe_P-A Product feature CHAIN KF779269_HBe_P-A of FT:mat_peptide KF779269_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4207). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779270_HBe_P-A Product feature CHAIN KF779270_HBe_P-A of FT:mat_peptide KF779270_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4219). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779271_HBe_P-A Product feature CHAIN KF779271_HBe_P-A of FT:mat_peptide KF779271_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4233). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779272_HBe_P-A Product feature CHAIN KF779272_HBe_P-A of FT:mat_peptide KF779272_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4236). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779273_HBe_P-A Product feature CHAIN KF779273_HBe_P-A of FT:mat_peptide KF779273_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4237). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779274_HBe_P-A Product feature CHAIN KF779274_HBe_P-A of FT:mat_peptide KF779274_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4259). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779275_HBe_P-A Product feature CHAIN KF779275_HBe_P-A of FT:mat_peptide KF779275_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4283). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779276_HBe_P-A Product feature CHAIN KF779276_HBe_P-A of FT:mat_peptide KF779276_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4314). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779277_HBe_P-A Product feature CHAIN KF779277_HBe_P-A of FT:mat_peptide KF779277_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4322). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779279_HBe_P-A Product feature CHAIN KF779279_HBe_P-A of FT:mat_peptide KF779279_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4359). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779281_HBe_P-A Product feature CHAIN KF779281_HBe_P-A of FT:mat_peptide KF779281_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4390). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779282_HBe_P-A Product feature CHAIN KF779282_HBe_P-A of FT:mat_peptide KF779282_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4392). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779283_HBe_P-A Product feature CHAIN KF779283_HBe_P-A of FT:mat_peptide KF779283_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4394). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779284_HBe_P-A Product feature CHAIN KF779284_HBe_P-A of FT:mat_peptide KF779284_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0574). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779286_HBe_P-A Product feature CHAIN KF779286_HBe_P-A of FT:mat_peptide KF779286_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0606). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779290_HBe_P-A Product feature CHAIN KF779290_HBe_P-A of FT:mat_peptide KF779290_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779291_HBe_P-A Product feature CHAIN KF779291_HBe_P-A of FT:mat_peptide KF779291_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0765). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779293_HBe_P-A Product feature CHAIN KF779293_HBe_P-A of FT:mat_peptide KF779293_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779294_HBe_P-A Product feature CHAIN KF779294_HBe_P-A of FT:mat_peptide KF779294_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0796). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779295_HBe_P-A Product feature CHAIN KF779295_HBe_P-A of FT:mat_peptide KF779295_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0854). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779297_HBe_P-A Product feature CHAIN KF779297_HBe_P-A of FT:mat_peptide KF779297_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0874). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779298_HBe_P-A Product feature CHAIN KF779298_HBe_P-A of FT:mat_peptide KF779298_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0908). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779299_HBe_P-A Product feature CHAIN KF779299_HBe_P-A of FT:mat_peptide KF779299_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0943). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779304_HBe_P-A Product feature CHAIN KF779304_HBe_P-A of FT:mat_peptide KF779304_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1039). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779305_HBe_P-A Product feature CHAIN KF779305_HBe_P-A of FT:mat_peptide KF779305_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1043). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779306_HBe_P-A Product feature CHAIN KF779306_HBe_P-A of FT:mat_peptide KF779306_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1093). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779307_HBe_P-A Product feature CHAIN KF779307_HBe_P-A of FT:mat_peptide KF779307_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1227). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779308_HBe_P-A Product feature CHAIN KF779308_HBe_P-A of FT:mat_peptide KF779308_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1293). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779309_HBe_P-A Product feature CHAIN KF779309_HBe_P-A of FT:mat_peptide KF779309_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1294). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779310_HBe_P-A Product feature CHAIN KF779310_HBe_P-A of FT:mat_peptide KF779310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3845). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779311_HBe_P-A Product feature CHAIN KF779311_HBe_P-A of FT:mat_peptide KF779311_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3863). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779312_HBe_P-A Product feature CHAIN KF779312_HBe_P-A of FT:mat_peptide KF779312_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3907). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779313_HBe_P-A Product feature CHAIN KF779313_HBe_P-A of FT:mat_peptide KF779313_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3958). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779314_HBe_P-A Product feature CHAIN KF779314_HBe_P-A of FT:mat_peptide KF779314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3985). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779315_HBe_P-A Product feature CHAIN KF779315_HBe_P-A of FT:mat_peptide KF779315_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4204). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779316_HBe_P-A Product feature CHAIN KF779316_HBe_P-A of FT:mat_peptide KF779316_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4247). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779317_HBe_P-A Product feature CHAIN KF779317_HBe_P-A of FT:mat_peptide KF779317_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779319_HBe_P-A Product feature CHAIN KF779319_HBe_P-A of FT:mat_peptide KF779319_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4323). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779320_HBe_P-A Product feature CHAIN KF779320_HBe_P-A of FT:mat_peptide KF779320_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779321_HBe_P-A Product feature CHAIN KF779321_HBe_P-A of FT:mat_peptide KF779321_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4362). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779322_HBe_P-A Product feature CHAIN KF779322_HBe_P-A of FT:mat_peptide KF779322_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4406). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779323_HBe_P-A Product feature CHAIN KF779323_HBe_P-A of FT:mat_peptide KF779323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4414). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779324_HBe_P-A Product feature CHAIN KF779324_HBe_P-A of FT:mat_peptide KF779324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4416). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779325_HBe_P-A Product feature CHAIN KF779325_HBe_P-A of FT:mat_peptide KF779325_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4422). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779326_HBe_P-A Product feature CHAIN KF779326_HBe_P-A of FT:mat_peptide KF779326_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4424). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779328_HBe_P-A Product feature CHAIN KF779328_HBe_P-A of FT:mat_peptide KF779328_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4532). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779329_HBe_P-A Product feature CHAIN KF779329_HBe_P-A of FT:mat_peptide KF779329_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4540). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779330_HBe_P-A Product feature CHAIN KF779330_HBe_P-A of FT:mat_peptide KF779330_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4541). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779331_HBe_P-A Product feature CHAIN KF779331_HBe_P-A of FT:mat_peptide KF779331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4543). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779332_HBe_P-A Product feature CHAIN KF779332_HBe_P-A of FT:mat_peptide KF779332_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4549). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779333_HBe_P-A Product feature CHAIN KF779333_HBe_P-A of FT:mat_peptide KF779333_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4661). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779334_HBe_P-A Product feature CHAIN KF779334_HBe_P-A of FT:mat_peptide KF779334_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4673). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779335_HBe_P-A Product feature CHAIN KF779335_HBe_P-A of FT:mat_peptide KF779335_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4687). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779336_HBe_P-A Product feature CHAIN KF779336_HBe_P-A of FT:mat_peptide KF779336_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4730). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779337_HBe_P-A Product feature CHAIN KF779337_HBe_P-A of FT:mat_peptide KF779337_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4733). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779338_HBe_P-A Product feature CHAIN KF779338_HBe_P-A of FT:mat_peptide KF779338_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779339_HBe_P-A Product feature CHAIN KF779339_HBe_P-A of FT:mat_peptide KF779339_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4804). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779342_HBe_P-A Product feature CHAIN KF779342_HBe_P-A of FT:mat_peptide KF779342_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4865). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGLWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779344_HBe_P-A Product feature CHAIN KF779344_HBe_P-A of FT:mat_peptide KF779344_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4928). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779345_HBe_P-A Product feature CHAIN KF779345_HBe_P-A of FT:mat_peptide KF779345_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4936). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779346_HBe_P-A Product feature CHAIN KF779346_HBe_P-A of FT:mat_peptide KF779346_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4938). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779347_HBe_P-A Product feature CHAIN KF779347_HBe_P-A of FT:mat_peptide KF779347_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4950). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779348_HBe_P-A Product feature CHAIN KF779348_HBe_P-A of FT:mat_peptide KF779348_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4951). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779349_HBe_P-A Product feature CHAIN KF779349_HBe_P-A of FT:mat_peptide KF779349_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4999). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779350_HBe_P-A Product feature CHAIN KF779350_HBe_P-A of FT:mat_peptide KF779350_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5005). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779351_HBe_P-A Product feature CHAIN KF779351_HBe_P-A of FT:mat_peptide KF779351_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5017). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779352_HBe_P-A Product feature CHAIN KF779352_HBe_P-A of FT:mat_peptide KF779352_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779354_HBe_P-A Product feature CHAIN KF779354_HBe_P-A of FT:mat_peptide KF779354_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779355_HBe_P-A Product feature CHAIN KF779355_HBe_P-A of FT:mat_peptide KF779355_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779356_HBe_P-A Product feature CHAIN KF779356_HBe_P-A of FT:mat_peptide KF779356_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5185). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779358_HBe_P-A Product feature CHAIN KF779358_HBe_P-A of FT:mat_peptide KF779358_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5263). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779359_HBe_P-A Product feature CHAIN KF779359_HBe_P-A of FT:mat_peptide KF779359_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5268). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779360_HBe_P-A Product feature CHAIN KF779360_HBe_P-A of FT:mat_peptide KF779360_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5279). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779361_HBe_P-A Product feature CHAIN KF779361_HBe_P-A of FT:mat_peptide KF779361_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5291). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNFEDPASRDLVVNYVNTNMGLKIRQLSRFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779362_HBe_P-A Product feature CHAIN KF779362_HBe_P-A of FT:mat_peptide KF779362_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779363_HBe_P-A Product feature CHAIN KF779363_HBe_P-A of FT:mat_peptide KF779363_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779364_HBe_P-A Product feature CHAIN KF779364_HBe_P-A of FT:mat_peptide KF779364_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5374). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779365_HBe_P-A Product feature CHAIN KF779365_HBe_P-A of FT:mat_peptide KF779365_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5380). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779366_HBe_P-A Product feature CHAIN KF779366_HBe_P-A of FT:mat_peptide KF779366_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5383). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779367_HBe_P-A Product feature CHAIN KF779367_HBe_P-A of FT:mat_peptide KF779367_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5403). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779368_HBe_P-A Product feature CHAIN KF779368_HBe_P-A of FT:mat_peptide KF779368_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5421). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779369_HBe_P-A Product feature CHAIN KF779369_HBe_P-A of FT:mat_peptide KF779369_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5521). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779370_HBe_P-A Product feature CHAIN KF779370_HBe_P-A of FT:mat_peptide KF779370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5594). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779371_HBe_P-A Product feature CHAIN KF779371_HBe_P-A of FT:mat_peptide KF779371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5608). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLRFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779372_HBe_P-A Product feature CHAIN KF779372_HBe_P-A of FT:mat_peptide KF779372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5654). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779373_HBe_P-A Product feature CHAIN KF779373_HBe_P-A of FT:mat_peptide KF779373_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5680). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779374_HBe_P-A Product feature CHAIN KF779374_HBe_P-A of FT:mat_peptide KF779374_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5743). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779375_HBe_P-A Product feature CHAIN KF779375_HBe_P-A of FT:mat_peptide KF779375_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5760). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779378_HBe_P-A Product feature CHAIN KF779378_HBe_P-A of FT:mat_peptide KF779378_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6064). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779379_HBe_P-A Product feature CHAIN KF779379_HBe_P-A of FT:mat_peptide KF779379_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779381_HBe_P-A Product feature CHAIN KF779381_HBe_P-A of FT:mat_peptide KF779381_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6268). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779383_HBe_P-A Product feature CHAIN KF779383_HBe_P-A of FT:mat_peptide KF779383_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779384_HBe_P-A Product feature CHAIN KF779384_HBe_P-A of FT:mat_peptide KF779384_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779385_HBe_P-A Product feature CHAIN KF779385_HBe_P-A of FT:mat_peptide KF779385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0098). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF779386_HBe_P-A Product feature CHAIN KF779386_HBe_P-A of FT:mat_peptide KF779386_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0138). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798265_HBe_P-A Product feature CHAIN KF798265_HBe_P-A of FT:mat_peptide KF798265_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVR
RRDRGR
>gnl|hbvpro|KF798266_HBe_P-A Product feature CHAIN KF798266_HBe_P-A of FT:mat_peptide KF798266_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798267_HBe_P-A Product feature CHAIN KF798267_HBe_P-A of FT:mat_peptide KF798267_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798271_HBe_P-A Product feature CHAIN KF798271_HBe_P-A of FT:mat_peptide KF798271_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
RRDRGR
>gnl|hbvpro|KF798278_HBe_P-A Product feature CHAIN KF798278_HBe_P-A of FT:mat_peptide KF798278_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798279_HBe_P-A Product feature CHAIN KF798279_HBe_P-A of FT:mat_peptide KF798279_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798285_HBe_P-A Product feature CHAIN KF798285_HBe_P-A of FT:mat_peptide KF798285_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798286_HBe_P-A Product feature CHAIN KF798286_HBe_P-A of FT:mat_peptide KF798286_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798289_HBe_P-A Product feature CHAIN KF798289_HBe_P-A of FT:mat_peptide KF798289_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798290_HBe_P-A Product feature CHAIN KF798290_HBe_P-A of FT:mat_peptide KF798290_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798291_HBe_P-A Product feature CHAIN KF798291_HBe_P-A of FT:mat_peptide KF798291_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798292_HBe_P-A Product feature CHAIN KF798292_HBe_P-A of FT:mat_peptide KF798292_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798302_HBe_P-A Product feature CHAIN KF798302_HBe_P-A of FT:mat_peptide KF798302_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798308_HBe_P-A Product feature CHAIN KF798308_HBe_P-A of FT:mat_peptide KF798308_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-50). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798309_HBe_P-A Product feature CHAIN KF798309_HBe_P-A of FT:mat_peptide KF798309_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-51). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798310_HBe_P-A Product feature CHAIN KF798310_HBe_P-A of FT:mat_peptide KF798310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-52). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798311_HBe_P-A Product feature CHAIN KF798311_HBe_P-A of FT:mat_peptide KF798311_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF798314_HBe_P-A Product feature CHAIN KF798314_HBe_P-A of FT:mat_peptide KF798314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB-56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF922406_HBe_P-A Product feature CHAIN KF922406_HBe_P-A of FT:mat_peptide KF922406_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v1). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF922407_HBe_P-A Product feature CHAIN KF922407_HBe_P-A of FT:mat_peptide KF922407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v2). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF922408_HBe_P-A Product feature CHAIN KF922408_HBe_P-A of FT:mat_peptide KF922408_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v3). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCPTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF922409_HBe_P-A Product feature CHAIN KF922409_HBe_P-A of FT:mat_peptide KF922409_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v4). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF922414_HBe_P-A Product feature CHAIN KF922414_HBe_P-A of FT:mat_peptide KF922414_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v1). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVR
RRGRDR
>gnl|hbvpro|KF922415_HBe_P-A Product feature CHAIN KF922415_HBe_P-A of FT:mat_peptide KF922415_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v2). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVR
RRGRGR
>gnl|hbvpro|KF922416_HBe_P-A Product feature CHAIN KF922416_HBe_P-A of FT:mat_peptide KF922416_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v3). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVR
RRGRGR
>gnl|hbvpro|KF922418_HBe_P-A Product feature CHAIN KF922418_HBe_P-A of FT:mat_peptide KF922418_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v5). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVR
RRGRGR
>gnl|hbvpro|KF922419_HBe_P-A Product feature CHAIN KF922419_HBe_P-A of FT:mat_peptide KF922419_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v6). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVR
RRGRGR
>gnl|hbvpro|KF922420_HBe_P-A Product feature CHAIN KF922420_HBe_P-A of FT:mat_peptide KF922420_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v7). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVVR
RRGRGR
>gnl|hbvpro|KF922421_HBe_P-A Product feature CHAIN KF922421_HBe_P-A of FT:mat_peptide KF922421_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v8). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYGPPNAPILSSLPETTVVR
RRGRGR
>gnl|hbvpro|KF922424_HBe_P-A Product feature CHAIN KF922424_HBe_P-A of FT:mat_peptide KF922424_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF922425_HBe_P-A Product feature CHAIN KF922425_HBe_P-A of FT:mat_peptide KF922425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF922426_HBe_P-A Product feature CHAIN KF922426_HBe_P-A of FT:mat_peptide KF922426_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v1). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF922427_HBe_P-A Product feature CHAIN KF922427_HBe_P-A of FT:mat_peptide KF922427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v2). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF922428_HBe_P-A Product feature CHAIN KF922428_HBe_P-A of FT:mat_peptide KF922428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v3). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KF922429_HBe_P-A Product feature CHAIN KF922429_HBe_P-A of FT:mat_peptide KF922429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v1). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGRGR
>gnl|hbvpro|KF922430_HBe_P-A Product feature CHAIN KF922430_HBe_P-A of FT:mat_peptide KF922430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v2). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMIFAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGRGR
>gnl|hbvpro|KF922431_HBe_P-A Product feature CHAIN KF922431_HBe_P-A of FT:mat_peptide KF922431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v3). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGRGR
>gnl|hbvpro|KJ010776_HBe_P-A Product feature CHAIN KJ010776_HBe_P-A of FT:mat_peptide KJ010776_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v1). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ010777_HBe_P-A Product feature CHAIN KJ010777_HBe_P-A of FT:mat_peptide KJ010777_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v2). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ010778_HBe_P-A Product feature CHAIN KJ010778_HBe_P-A of FT:mat_peptide KJ010778_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v3). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ586809_HBe_P-A Product feature CHAIN KJ586809_HBe_P-A of FT:mat_peptide KJ586809_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLNTASALYREALESPEHCSPHHTALRQAILCWGELMTLST
WVGNNLEDPASRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843166_HBe_P-A Product feature CHAIN KJ843166_HBe_P-A of FT:mat_peptide KJ843166_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag04). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843172_HBe_P-A Product feature CHAIN KJ843172_HBe_P-A of FT:mat_peptide KJ843172_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEITVVR
RRDRGR
>gnl|hbvpro|KJ843173_HBe_P-A Product feature CHAIN KJ843173_HBe_P-A of FT:mat_peptide KJ843173_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag11). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843182_HBe_P-A Product feature CHAIN KJ843182_HBe_P-A of FT:mat_peptide KJ843182_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843183_HBe_P-A Product feature CHAIN KJ843183_HBe_P-A of FT:mat_peptide KJ843183_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag22). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843184_HBe_P-A Product feature CHAIN KJ843184_HBe_P-A of FT:mat_peptide KJ843184_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag23). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIXTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843186_HBe_P-A Product feature CHAIN KJ843186_HBe_P-A of FT:mat_peptide KJ843186_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843188_HBe_P-A Product feature CHAIN KJ843188_HBe_P-A of FT:mat_peptide KJ843188_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843192_HBe_P-A Product feature CHAIN KJ843192_HBe_P-A of FT:mat_peptide KJ843192_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag31). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843214_HBe_P-A Product feature CHAIN KJ843214_HBe_P-A of FT:mat_peptide KJ843214_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag55). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843215_HBe_P-A Product feature CHAIN KJ843215_HBe_P-A of FT:mat_peptide KJ843215_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag56). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843216_HBe_P-A Product feature CHAIN KJ843216_HBe_P-A of FT:mat_peptide KJ843216_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag57). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843217_HBe_P-A Product feature CHAIN KJ843217_HBe_P-A of FT:mat_peptide KJ843217_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag62). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ843218_HBe_P-A Product feature CHAIN KJ843218_HBe_P-A of FT:mat_peptide KJ843218_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag63). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854685_HBe_P-A Product feature CHAIN KJ854685_HBe_P-A of FT:mat_peptide KJ854685_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116-SE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMAIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELSTLGT
WVGNNLQDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854686_HBe_P-A Product feature CHAIN KJ854686_HBe_P-A of FT:mat_peptide KJ854686_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1356-SE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854687_HBe_P-A Product feature CHAIN KJ854687_HBe_P-A of FT:mat_peptide KJ854687_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1377-SE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854688_HBe_P-A Product feature CHAIN KJ854688_HBe_P-A of FT:mat_peptide KJ854688_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1379-SE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854689_HBe_P-A Product feature CHAIN KJ854689_HBe_P-A of FT:mat_peptide KJ854689_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16202-NE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854690_HBe_P-A Product feature CHAIN KJ854690_HBe_P-A of FT:mat_peptide KJ854690_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16338-NE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTSSALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854691_HBe_P-A Product feature CHAIN KJ854691_HBe_P-A of FT:mat_peptide KJ854691_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16650-NE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854692_HBe_P-A Product feature CHAIN KJ854692_HBe_P-A of FT:mat_peptide KJ854692_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17372-NE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854693_HBe_P-A Product feature CHAIN KJ854693_HBe_P-A of FT:mat_peptide KJ854693_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17545-NE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854694_HBe_P-A Product feature CHAIN KJ854694_HBe_P-A of FT:mat_peptide KJ854694_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17822-NE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854696_HBe_P-A Product feature CHAIN KJ854696_HBe_P-A of FT:mat_peptide KJ854696_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 18158-SE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854697_HBe_P-A Product feature CHAIN KJ854697_HBe_P-A of FT:mat_peptide KJ854697_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1969-SE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854698_HBe_P-A Product feature CHAIN KJ854698_HBe_P-A of FT:mat_peptide KJ854698_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1993-N-BRA). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854699_HBe_P-A Product feature CHAIN KJ854699_HBe_P-A of FT:mat_peptide KJ854699_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2340-N-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854700_HBe_P-A Product feature CHAIN KJ854700_HBe_P-A of FT:mat_peptide KJ854700_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 313-N-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRXVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854701_HBe_P-A Product feature CHAIN KJ854701_HBe_P-A of FT:mat_peptide KJ854701_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 349-SE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPTARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDILTLGT
WVGNNLEDQTSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854702_HBe_P-A Product feature CHAIN KJ854702_HBe_P-A of FT:mat_peptide KJ854702_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 41-CW-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854703_HBe_P-A Product feature CHAIN KJ854703_HBe_P-A of FT:mat_peptide KJ854703_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 65-SE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDFDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLXXNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854704_HBe_P-A Product feature CHAIN KJ854704_HBe_P-A of FT:mat_peptide KJ854704_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 66-CW-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854705_HBe_P-A Product feature CHAIN KJ854705_HBe_P-A of FT:mat_peptide KJ854705_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 67-CW-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854706_HBe_P-A Product feature CHAIN KJ854706_HBe_P-A of FT:mat_peptide KJ854706_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 753-CW-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854707_HBe_P-A Product feature CHAIN KJ854707_HBe_P-A of FT:mat_peptide KJ854707_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 895-N-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854708_HBe_P-A Product feature CHAIN KJ854708_HBe_P-A of FT:mat_peptide KJ854708_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16-S-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854709_HBe_P-A Product feature CHAIN KJ854709_HBe_P-A of FT:mat_peptide KJ854709_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24-S-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KJ854710_HBe_P-A Product feature CHAIN KJ854710_HBe_P-A of FT:mat_peptide KJ854710_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 274-SE-BRA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM243029_HBe_P-A Product feature CHAIN KM243029_HBe_P-A of FT:mat_peptide KM243029_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TAC455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM519452_HBe_P-A Product feature CHAIN KM519452_HBe_P-A of FT:mat_peptide KM519452_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_G1862T_Mutant_SA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM519453_HBe_P-A Product feature CHAIN KM519453_HBe_P-A of FT:mat_peptide KM519453_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_Wild_SA). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM519454_HBe_P-A Product feature CHAIN KM519454_HBe_P-A of FT:mat_peptide KM519454_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_WT_BEL). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606647_HBe_P-A Product feature CHAIN KM606647_HBe_P-A of FT:mat_peptide KM606647_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba10a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDHYKEFGATVELLSFLPLDFFPSARDLLETASALYRESLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRDTVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606648_HBe_P-A Product feature CHAIN KM606648_HBe_P-A of FT:mat_peptide KM606648_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606649_HBe_P-A Product feature CHAIN KM606649_HBe_P-A of FT:mat_peptide KM606649_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba15a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606650_HBe_P-A Product feature CHAIN KM606650_HBe_P-A of FT:mat_peptide KM606650_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba16a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606652_HBe_P-A Product feature CHAIN KM606652_HBe_P-A of FT:mat_peptide KM606652_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba20a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606653_HBe_P-A Product feature CHAIN KM606653_HBe_P-A of FT:mat_peptide KM606653_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba21a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQEILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606656_HBe_P-A Product feature CHAIN KM606656_HBe_P-A of FT:mat_peptide KM606656_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba26a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606658_HBe_P-A Product feature CHAIN KM606658_HBe_P-A of FT:mat_peptide KM606658_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba31a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
RRDRGR
>gnl|hbvpro|KM606660_HBe_P-A Product feature CHAIN KM606660_HBe_P-A of FT:mat_peptide KM606660_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba34a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606661_HBe_P-A Product feature CHAIN KM606661_HBe_P-A of FT:mat_peptide KM606661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba35a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606663_HBe_P-A Product feature CHAIN KM606663_HBe_P-A of FT:mat_peptide KM606663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba38a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606665_HBe_P-A Product feature CHAIN KM606665_HBe_P-A of FT:mat_peptide KM606665_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba40a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606666_HBe_P-A Product feature CHAIN KM606666_HBe_P-A of FT:mat_peptide KM606666_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba41a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606668_HBe_P-A Product feature CHAIN KM606668_HBe_P-A of FT:mat_peptide KM606668_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba44a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|KM606669_HBe_P-A Product feature CHAIN KM606669_HBe_P-A of FT:mat_peptide KM606669_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba45a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606672_HBe_P-A Product feature CHAIN KM606672_HBe_P-A of FT:mat_peptide KM606672_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba54a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTPPETTVVR
RRDRGR
>gnl|hbvpro|KM606673_HBe_P-A Product feature CHAIN KM606673_HBe_P-A of FT:mat_peptide KM606673_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba55a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606674_HBe_P-A Product feature CHAIN KM606674_HBe_P-A of FT:mat_peptide KM606674_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606676_HBe_P-A Product feature CHAIN KM606676_HBe_P-A of FT:mat_peptide KM606676_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba59a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606677_HBe_P-A Product feature CHAIN KM606677_HBe_P-A of FT:mat_peptide KM606677_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba60a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606678_HBe_P-A Product feature CHAIN KM606678_HBe_P-A of FT:mat_peptide KM606678_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba61a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606679_HBe_P-A Product feature CHAIN KM606679_HBe_P-A of FT:mat_peptide KM606679_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba62a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606680_HBe_P-A Product feature CHAIN KM606680_HBe_P-A of FT:mat_peptide KM606680_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba66a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606683_HBe_P-A Product feature CHAIN KM606683_HBe_P-A of FT:mat_peptide KM606683_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba69a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606684_HBe_P-A Product feature CHAIN KM606684_HBe_P-A of FT:mat_peptide KM606684_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba71a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606685_HBe_P-A Product feature CHAIN KM606685_HBe_P-A of FT:mat_peptide KM606685_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba72a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606687_HBe_P-A Product feature CHAIN KM606687_HBe_P-A of FT:mat_peptide KM606687_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba75a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606688_HBe_P-A Product feature CHAIN KM606688_HBe_P-A of FT:mat_peptide KM606688_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba78a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606691_HBe_P-A Product feature CHAIN KM606691_HBe_P-A of FT:mat_peptide KM606691_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba82a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606694_HBe_P-A Product feature CHAIN KM606694_HBe_P-A of FT:mat_peptide KM606694_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba85a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606695_HBe_P-A Product feature CHAIN KM606695_HBe_P-A of FT:mat_peptide KM606695_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba86a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
YKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGELMTLAT
WAGNNLEDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606696_HBe_P-A Product feature CHAIN KM606696_HBe_P-A of FT:mat_peptide KM606696_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba89a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATTELVSFLPSDFFPNTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGSNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|KM606700_HBe_P-A Product feature CHAIN KM606700_HBe_P-A of FT:mat_peptide KM606700_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba100a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606737_HBe_P-A Product feature CHAIN KM606737_HBe_P-A of FT:mat_peptide KM606737_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba13a). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606742_HBe_P-A Product feature CHAIN KM606742_HBe_P-A of FT:mat_peptide KM606742_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPFDFFPSVRDFLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606746_HBe_P-A Product feature CHAIN KM606746_HBe_P-A of FT:mat_peptide KM606746_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KM606749_HBe_P-A Product feature CHAIN KM606749_HBe_P-A of FT:mat_peptide KM606749_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168423_HBe_P-A Product feature CHAIN KP168423_HBe_P-A of FT:mat_peptide KP168423_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB517). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168424_HBe_P-A Product feature CHAIN KP168424_HBe_P-A of FT:mat_peptide KP168424_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM571). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168425_HBe_P-A Product feature CHAIN KP168425_HBe_P-A of FT:mat_peptide KP168425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS119). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIFWWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168426_HBe_P-A Product feature CHAIN KP168426_HBe_P-A of FT:mat_peptide KP168426_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM05). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168427_HBe_P-A Product feature CHAIN KP168427_HBe_P-A of FT:mat_peptide KP168427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB201). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168428_HBe_P-A Product feature CHAIN KP168428_HBe_P-A of FT:mat_peptide KP168428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN195). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELMTLAT
WVGNNLDDXASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168429_HBe_P-A Product feature CHAIN KP168429_HBe_P-A of FT:mat_peptide KP168429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN033). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLXSDFFPSVRDLLDTXSALYREALESPEHCSPHHTALRQAILWWXELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168430_HBe_P-A Product feature CHAIN KP168430_HBe_P-A of FT:mat_peptide KP168430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168432_HBe_P-A Product feature CHAIN KP168432_HBe_P-A of FT:mat_peptide KP168432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB213). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168433_HBe_P-A Product feature CHAIN KP168433_HBe_P-A of FT:mat_peptide KP168433_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB04). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168434_HBe_P-A Product feature CHAIN KP168434_HBe_P-A of FT:mat_peptide KP168434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM564). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP168435_HBe_P-A Product feature CHAIN KP168435_HBe_P-A of FT:mat_peptide KP168435_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS117). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP243434_HBe_P-A Product feature CHAIN KP243434_HBe_P-A of FT:mat_peptide KP243434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 898037_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDR
>gnl|hbvpro|KP274925_HBe_P-A Product feature CHAIN KP274925_HBe_P-A of FT:mat_peptide KP274925_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP274927_HBe_P-A Product feature CHAIN KP274927_HBe_P-A of FT:mat_peptide KP274927_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP274928_HBe_P-A Product feature CHAIN KP274928_HBe_P-A of FT:mat_peptide KP274928_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS-4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718085_HBe_P-A Product feature CHAIN KP718085_HBe_P-A of FT:mat_peptide KP718085_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-12-1-26). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718086_HBe_P-A Product feature CHAIN KP718086_HBe_P-A of FT:mat_peptide KP718086_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-03-02-1-60). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718087_HBe_P-A Product feature CHAIN KP718087_HBe_P-A of FT:mat_peptide KP718087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1897). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718088_HBe_P-A Product feature CHAIN KP718088_HBe_P-A of FT:mat_peptide KP718088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1162). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718089_HBe_P-A Product feature CHAIN KP718089_HBe_P-A of FT:mat_peptide KP718089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1249). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEXPEHCSPHHTALRQAIXCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718090_HBe_P-A Product feature CHAIN KP718090_HBe_P-A of FT:mat_peptide KP718090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1348). Complete genome. [Hepadnaviridae] (length=166 residues).
XKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718091_HBe_P-A Product feature CHAIN KP718091_HBe_P-A of FT:mat_peptide KP718091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1771). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718092_HBe_P-A Product feature CHAIN KP718092_HBe_P-A of FT:mat_peptide KP718092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1891). Complete genome. [Hepadnaviridae] (length=166 residues).
XKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718093_HBe_P-A Product feature CHAIN KP718093_HBe_P-A of FT:mat_peptide KP718093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-01-1202). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718094_HBe_P-A Product feature CHAIN KP718094_HBe_P-A of FT:mat_peptide KP718094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8757_TR). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGVKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718095_HBe_P-A Product feature CHAIN KP718095_HBe_P-A of FT:mat_peptide KP718095_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8809_TR). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGRGR
>gnl|hbvpro|KP718096_HBe_P-A Product feature CHAIN KP718096_HBe_P-A of FT:mat_peptide KP718096_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA-0004). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718097_HBe_P-A Product feature CHAIN KP718097_HBe_P-A of FT:mat_peptide KP718097_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-1943). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718098_HBe_P-A Product feature CHAIN KP718098_HBe_P-A of FT:mat_peptide KP718098_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3106_HIV). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718099_HBe_P-A Product feature CHAIN KP718099_HBe_P-A of FT:mat_peptide KP718099_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13-378). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718100_HBe_P-A Product feature CHAIN KP718100_HBe_P-A of FT:mat_peptide KP718100_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 137_HIV). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDXLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP718101_HBe_P-A Product feature CHAIN KP718101_HBe_P-A of FT:mat_peptide KP718101_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP11-3018). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPHPRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP857058_HBe_P-A Product feature CHAIN KP857058_HBe_P-A of FT:mat_peptide KP857058_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP857059_HBe_P-A Product feature CHAIN KP857059_HBe_P-A of FT:mat_peptide KP857059_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDLVLEYLVSFGVWIRTPPPYRPQNAPILSTLPETAVVR
GSNRGR
>gnl|hbvpro|KP857060_HBe_P-A Product feature CHAIN KP857060_HBe_P-A of FT:mat_peptide KP857060_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSARDLLDTAAALFREALESPEHCSPHHTALRQASLCWVELMTLAT
WVGNNLQDTASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETTVIR
RRDRGR
>gnl|hbvpro|KP857061_HBe_P-A Product feature CHAIN KP857061_HBe_P-A of FT:mat_peptide KP857061_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
QRGRGR
>gnl|hbvpro|KP857062_HBe_P-A Product feature CHAIN KP857062_HBe_P-A of FT:mat_peptide KP857062_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP857063_HBe_P-A Product feature CHAIN KP857063_HBe_P-A of FT:mat_peptide KP857063_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP857064_HBe_P-A Product feature CHAIN KP857064_HBe_P-A of FT:mat_peptide KP857064_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALEAPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVLR
RRDRGR
>gnl|hbvpro|KP857065_HBe_P-A Product feature CHAIN KP857065_HBe_P-A of FT:mat_peptide KP857065_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSAHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
GRARGR
>gnl|hbvpro|KP857066_HBe_P-A Product feature CHAIN KP857066_HBe_P-A of FT:mat_peptide KP857066_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVKDLYDTALALHREALESPEHCTHHHTALRQAILCWGDLMNLAN
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPLNAPILSTLPECTVVR
QRGRGR
>gnl|hbvpro|KP857067_HBe_P-A Product feature CHAIN KP857067_HBe_P-A of FT:mat_peptide KP857067_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESAEHCSPHHTALRQAILCWGDVMTLGT
WVGNNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLISFGVWIRTPPAYRPPNAPILSTLPETTVXR
RRDRGR
>gnl|hbvpro|KP857068_HBe_P-A Product feature CHAIN KP857068_HBe_P-A of FT:mat_peptide KP857068_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQIVLCWGDVMNLAT
WVGSNLQDPASRDQVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVVEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVR
CRDRRR
>gnl|hbvpro|KP857069_HBe_P-A Product feature CHAIN KP857069_HBe_P-A of FT:mat_peptide KP857069_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSSHHTALRQAILCWGELTTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
RRDRGR
>gnl|hbvpro|KP857070_HBe_P-A Product feature CHAIN KP857070_HBe_P-A of FT:mat_peptide KP857070_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDLTTLGS
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVR
SRNRGR
>gnl|hbvpro|KP857071_HBe_P-A Product feature CHAIN KP857071_HBe_P-A of FT:mat_peptide KP857071_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREXLESPEHCSPHHTALRQAILCWGDLTTLGS
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPVNAPILSTLPETTVVR
SRNRGR
>gnl|hbvpro|KP857072_HBe_P-A Product feature CHAIN KP857072_HBe_P-A of FT:mat_peptide KP857072_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALFREALESPEHGSSHHTALRQAILCWQEVTTLAS
WVGTNLDDPSSRDQVVHYVNTNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|KP857073_HBe_P-A Product feature CHAIN KP857073_HBe_P-A of FT:mat_peptide KP857073_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFYPSVRDLLDTATALYREALESPEHCSAHHTAIRQAILCWGELMTLAS
WVGANLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRHTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGG
>gnl|hbvpro|KP857074_HBe_P-A Product feature CHAIN KP857074_HBe_P-A of FT:mat_peptide KP857074_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPNDFYPSVKDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLAT
WVGNNLEDQASRNLVVDYVNNNVGLRLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP857075_HBe_P-A Product feature CHAIN KP857075_HBe_P-A of FT:mat_peptide KP857075_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSPHHTALRQAALCWWELTTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLISFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|KP857076_HBe_P-A Product feature CHAIN KP857076_HBe_P-A of FT:mat_peptide KP857076_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVTXLAT
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPTYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP857077_HBe_P-A Product feature CHAIN KP857077_HBe_P-A of FT:mat_peptide KP857077_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPIDFYPSVRDLIETASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP857078_HBe_P-A Product feature CHAIN KP857078_HBe_P-A of FT:mat_peptide KP857078_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSTKDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLGT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
PRHRGR
>gnl|hbvpro|KP857079_HBe_P-A Product feature CHAIN KP857079_HBe_P-A of FT:mat_peptide KP857079_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHXSPHHTALRQAILCWGXVMTLGT
WVGBNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPXNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KP857080_HBe_P-A Product feature CHAIN KP857080_HBe_P-A of FT:mat_peptide KP857080_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
XRDRGR
>gnl|hbvpro|KP857091_HBe_P-A Product feature CHAIN KP857091_HBe_P-A of FT:mat_peptide KP857091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=165 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELTTLAT
WVGTNLDDPGSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGGR
>gnl|hbvpro|KP857092_HBe_P-A Product feature CHAIN KP857092_HBe_P-A of FT:mat_peptide KP857092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWVELXTLAT
WVGNNLEDPASRDQVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|KP995108_HBe_P-A Product feature CHAIN KP995108_HBe_P-A of FT:mat_peptide KP995108_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 203-Cirrhosis). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDTYKEFGATVELLSFLPSDFYPSVRDLVDTASALYREALESPEHGSPHHTALRQAIVCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KR905425_HBe_P-A Product feature CHAIN KR905425_HBe_P-A of FT:mat_peptide KR905425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-24). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVR
RRDRGR
>gnl|hbvpro|KR905426_HBe_P-A Product feature CHAIN KR905426_HBe_P-A of FT:mat_peptide KR905426_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KR905427_HBe_P-A Product feature CHAIN KR905427_HBe_P-A of FT:mat_peptide KR905427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-30). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEAPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|KR905429_HBe_P-A Product feature CHAIN KR905429_HBe_P-A of FT:mat_peptide KR905429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-35). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
RRDRGR
>gnl|hbvpro|KR905430_HBe_P-A Product feature CHAIN KR905430_HBe_P-A of FT:mat_peptide KR905430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-47). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KR905431_HBe_P-A Product feature CHAIN KR905431_HBe_P-A of FT:mat_peptide KR905431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI-77). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT151611_HBe_P-A Product feature CHAIN KT151611_HBe_P-A of FT:mat_peptide KT151611_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 398). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT151612_HBe_P-A Product feature CHAIN KT151612_HBe_P-A of FT:mat_peptide KT151612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 500). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPANAPILSTLPETTVIR
GRGRGR
>gnl|hbvpro|KT151613_HBe_P-A Product feature CHAIN KT151613_HBe_P-A of FT:mat_peptide KT151613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 792). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT151614_HBe_P-A Product feature CHAIN KT151614_HBe_P-A of FT:mat_peptide KT151614_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 969). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT151615_HBe_P-A Product feature CHAIN KT151615_HBe_P-A of FT:mat_peptide KT151615_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 191). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDHYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT151616_HBe_P-A Product feature CHAIN KT151616_HBe_P-A of FT:mat_peptide KT151616_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 655). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT151617_HBe_P-A Product feature CHAIN KT151617_HBe_P-A of FT:mat_peptide KT151617_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 803). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPXNAPILSTLPETTVIR
GRGRGR
>gnl|hbvpro|KT151618_HBe_P-A Product feature CHAIN KT151618_HBe_P-A of FT:mat_peptide KT151618_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 590). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT347087_HBe_P-A Product feature CHAIN KT347087_HBe_P-A of FT:mat_peptide KT347087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM265). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT347088_HBe_P-A Product feature CHAIN KT347088_HBe_P-A of FT:mat_peptide KT347088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM285). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT366466_HBe_P-A Product feature CHAIN KT366466_HBe_P-A of FT:mat_peptide KT366466_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.7). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPEIAVVR
RRDRGR
>gnl|hbvpro|KT366467_HBe_P-A Product feature CHAIN KT366467_HBe_P-A of FT:mat_peptide KT366467_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.9). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT366468_HBe_P-A Product feature CHAIN KT366468_HBe_P-A of FT:mat_peptide KT366468_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.27). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT366469_HBe_P-A Product feature CHAIN KT366469_HBe_P-A of FT:mat_peptide KT366469_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.28). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT366470_HBe_P-A Product feature CHAIN KT366470_HBe_P-A of FT:mat_peptide KT366470_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.31). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT366471_HBe_P-A Product feature CHAIN KT366471_HBe_P-A of FT:mat_peptide KT366471_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C-EICI.50). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749824_HBe_P-A Product feature CHAIN KT749824_HBe_P-A of FT:mat_peptide KT749824_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL2b). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLGFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749825_HBe_P-A Product feature CHAIN KT749825_HBe_P-A of FT:mat_peptide KT749825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4a). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749826_HBe_P-A Product feature CHAIN KT749826_HBe_P-A of FT:mat_peptide KT749826_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4b). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749829_HBe_P-A Product feature CHAIN KT749829_HBe_P-A of FT:mat_peptide KT749829_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL7). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749830_HBe_P-A Product feature CHAIN KT749830_HBe_P-A of FT:mat_peptide KT749830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5b). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749831_HBe_P-A Product feature CHAIN KT749831_HBe_P-A of FT:mat_peptide KT749831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL8). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749832_HBe_P-A Product feature CHAIN KT749832_HBe_P-A of FT:mat_peptide KT749832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELISFLPADFFPSVRDLLDTASALFREALESPEHCSAHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749833_HBe_P-A Product feature CHAIN KT749833_HBe_P-A of FT:mat_peptide KT749833_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9b). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDTYKEFGATVELLSFLPSDFFPSVRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749834_HBe_P-A Product feature CHAIN KT749834_HBe_P-A of FT:mat_peptide KT749834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9a). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749835_HBe_P-A Product feature CHAIN KT749835_HBe_P-A of FT:mat_peptide KT749835_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9c). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749836_HBe_P-A Product feature CHAIN KT749836_HBe_P-A of FT:mat_peptide KT749836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL12). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749837_HBe_P-A Product feature CHAIN KT749837_HBe_P-A of FT:mat_peptide KT749837_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL15). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749838_HBe_P-A Product feature CHAIN KT749838_HBe_P-A of FT:mat_peptide KT749838_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749839_HBe_P-A Product feature CHAIN KT749839_HBe_P-A of FT:mat_peptide KT749839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5d). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749840_HBe_P-A Product feature CHAIN KT749840_HBe_P-A of FT:mat_peptide KT749840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL18). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749842_HBe_P-A Product feature CHAIN KT749842_HBe_P-A of FT:mat_peptide KT749842_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4e). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749843_HBe_P-A Product feature CHAIN KT749843_HBe_P-A of FT:mat_peptide KT749843_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5c). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAMYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749844_HBe_P-A Product feature CHAIN KT749844_HBe_P-A of FT:mat_peptide KT749844_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749846_HBe_P-A Product feature CHAIN KT749846_HBe_P-A of FT:mat_peptide KT749846_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4f). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749847_HBe_P-A Product feature CHAIN KT749847_HBe_P-A of FT:mat_peptide KT749847_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4d). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749849_HBe_P-A Product feature CHAIN KT749849_HBe_P-A of FT:mat_peptide KT749849_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4c). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KT749850_HBe_P-A Product feature CHAIN KT749850_HBe_P-A of FT:mat_peptide KT749850_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL21). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605516_HBe_P-A Product feature CHAIN KU605516_HBe_P-A of FT:mat_peptide KU605516_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605517_HBe_P-A Product feature CHAIN KU605517_HBe_P-A of FT:mat_peptide KU605517_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486F2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605518_HBe_P-A Product feature CHAIN KU605518_HBe_P-A of FT:mat_peptide KU605518_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605519_HBe_P-A Product feature CHAIN KU605519_HBe_P-A of FT:mat_peptide KU605519_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605520_HBe_P-A Product feature CHAIN KU605520_HBe_P-A of FT:mat_peptide KU605520_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605521_HBe_P-A Product feature CHAIN KU605521_HBe_P-A of FT:mat_peptide KU605521_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605522_HBe_P-A Product feature CHAIN KU605522_HBe_P-A of FT:mat_peptide KU605522_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605532_HBe_P-A Product feature CHAIN KU605532_HBe_P-A of FT:mat_peptide KU605532_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486Baseline). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605533_HBe_P-A Product feature CHAIN KU605533_HBe_P-A of FT:mat_peptide KU605533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787Baseline). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605534_HBe_P-A Product feature CHAIN KU605534_HBe_P-A of FT:mat_peptide KU605534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605535_HBe_P-A Product feature CHAIN KU605535_HBe_P-A of FT:mat_peptide KU605535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163Baseline). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605536_HBe_P-A Product feature CHAIN KU605536_HBe_P-A of FT:mat_peptide KU605536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643Baseline). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605537_HBe_P-A Product feature CHAIN KU605537_HBe_P-A of FT:mat_peptide KU605537_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605538_HBe_P-A Product feature CHAIN KU605538_HBe_P-A of FT:mat_peptide KU605538_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU605539_HBe_P-A Product feature CHAIN KU605539_HBe_P-A of FT:mat_peptide KU605539_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU736918_HBe_P-A Product feature CHAIN KU736918_HBe_P-A of FT:mat_peptide KU736918_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU736919_HBe_P-A Product feature CHAIN KU736919_HBe_P-A of FT:mat_peptide KU736919_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KU736920_HBe_P-A Product feature CHAIN KU736920_HBe_P-A of FT:mat_peptide KU736920_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Sudan_10). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKXFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX276769_HBe_P-A Product feature CHAIN KX276769_HBe_P-A of FT:mat_peptide KX276769_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDQVVSYVNTNMGLKIRQLLWFHISCLTFGRDAVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX357640_HBe_P-A Product feature CHAIN KX357640_HBe_P-A of FT:mat_peptide KX357640_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA11ETH). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX357642_HBe_P-A Product feature CHAIN KX357642_HBe_P-A of FT:mat_peptide KX357642_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JM16ETH). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX357643_HBe_P-A Product feature CHAIN KX357643_HBe_P-A of FT:mat_peptide KX357643_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MK156ETH). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX357644_HBe_P-A Product feature CHAIN KX357644_HBe_P-A of FT:mat_peptide KX357644_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA152ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRNRGR
>gnl|hbvpro|KX357645_HBe_P-A Product feature CHAIN KX357645_HBe_P-A of FT:mat_peptide KX357645_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA162ETH). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX357646_HBe_P-A Product feature CHAIN KX357646_HBe_P-A of FT:mat_peptide KX357646_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL185ETH). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX357647_HBe_P-A Product feature CHAIN KX357647_HBe_P-A of FT:mat_peptide KX357647_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL13ETH). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX357649_HBe_P-A Product feature CHAIN KX357649_HBe_P-A of FT:mat_peptide KX357649_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA86ETH). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPRDFYPSVRDLIDTASALFREALESPEHCSPHHTALRQAVLCWGELMTLAX
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX648547_HBe_P-A Product feature CHAIN KX648547_HBe_P-A of FT:mat_peptide KX648547_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi12_103). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATXELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRGXGR
>gnl|hbvpro|KX648548_HBe_P-A Product feature CHAIN KX648548_HBe_P-A of FT:mat_peptide KX648548_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_091). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX648549_HBe_P-A Product feature CHAIN KX648549_HBe_P-A of FT:mat_peptide KX648549_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_172). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|KX686607_HBe_P-A Product feature CHAIN KX686607_HBe_P-A of FT:mat_peptide KX686607_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1522). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX827293_HBe_P-A Product feature CHAIN KX827293_HBe_P-A of FT:mat_peptide KX827293_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno5.4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX827294_HBe_P-A Product feature CHAIN KX827294_HBe_P-A of FT:mat_peptide KX827294_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.2). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX827295_HBe_P-A Product feature CHAIN KX827295_HBe_P-A of FT:mat_peptide KX827295_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIPCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX827296_HBe_P-A Product feature CHAIN KX827296_HBe_P-A of FT:mat_peptide KX827296_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6.5). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVGDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KX827298_HBe_P-A Product feature CHAIN KX827298_HBe_P-A of FT:mat_peptide KX827298_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9.4). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KY003230_HBe_P-A Product feature CHAIN KY003230_HBe_P-A of FT:mat_peptide KY003230_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20160922). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KY382410_HBe_P-A Product feature CHAIN KY382410_HBe_P-A of FT:mat_peptide KY382410_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_wt). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|KY886219_HBe_P-A Product feature CHAIN KY886219_HBe_P-A of FT:mat_peptide KY886219_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|L13994_HBe_P-A Product feature CHAIN L13994_HBe_P-A of FT:mat_peptide L13994_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC051141_HBe_P-A Product feature CHAIN LC051141_HBe_P-A of FT:mat_peptide LC051141_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14-0620). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC074724_HBe_P-A Product feature CHAIN LC074724_HBe_P-A of FT:mat_peptide LC074724_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p621). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC311241_HBe_P-A Product feature CHAIN LC311241_HBe_P-A of FT:mat_peptide LC311241_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p509). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC311242_HBe_P-A Product feature CHAIN LC311242_HBe_P-A of FT:mat_peptide LC311242_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p90). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPNHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC311243_HBe_P-A Product feature CHAIN LC311243_HBe_P-A of FT:mat_peptide LC311243_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p121). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC430617_HBe_P-A Product feature CHAIN LC430617_HBe_P-A of FT:mat_peptide LC430617_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 78556-102). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC458430_HBe_P-A Product feature CHAIN LC458430_HBe_P-A of FT:mat_peptide LC458430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB01). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC458431_HBe_P-A Product feature CHAIN LC458431_HBe_P-A of FT:mat_peptide LC458431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB03). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC462120_HBe_P-A Product feature CHAIN LC462120_HBe_P-A of FT:mat_peptide LC462120_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLBTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC517161_HBe_P-A Product feature CHAIN LC517161_HBe_P-A of FT:mat_peptide LC517161_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB16-1360). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC592168_HBe_P-A Product feature CHAIN LC592168_HBe_P-A of FT:mat_peptide LC592168_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate OM-AHB_hair). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC592169_HBe_P-A Product feature CHAIN LC592169_HBe_P-A of FT:mat_peptide LC592169_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate OM-AHB_nail). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC592170_HBe_P-A Product feature CHAIN LC592170_HBe_P-A of FT:mat_peptide LC592170_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate OM-AHB_serum). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC677081_HBe_P-A Product feature CHAIN LC677081_HBe_P-A of FT:mat_peptide LC677081_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB_T4). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC677082_HBe_P-A Product feature CHAIN LC677082_HBe_P-A of FT:mat_peptide LC677082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB_T5). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LC677083_HBe_P-A Product feature CHAIN LC677083_HBe_P-A of FT:mat_peptide LC677083_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JRC-HB_T6). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LK995385_HBe_P-A Product feature CHAIN LK995385_HBe_P-A of FT:mat_peptide LK995385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NAT2037658). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LT992440_HBe_P-A Product feature CHAIN LT992440_HBe_P-A of FT:mat_peptide LT992440_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA119). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|LT992441_HBe_P-A Product feature CHAIN LT992441_HBe_P-A of FT:mat_peptide LT992441_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA195). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|LT992448_HBe_P-A Product feature CHAIN LT992448_HBe_P-A of FT:mat_peptide LT992448_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RISE386). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|M57663_HBe_P-A Product feature CHAIN M57663_HBe_P-A of FT:mat_peptide M57663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|M74501_HBe_P-A Product feature CHAIN M74501_HBe_P-A of FT:mat_peptide M74501_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MF536836_HBe_P-A Product feature CHAIN MF536836_HBe_P-A of FT:mat_peptide MF536836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate T2029C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=167 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLHTASALYREALESPEHCSSHHTALRQAILCWGELLYSLP
TWVGNNLQDPASRDLHVNYVNTNMGLKIRQLLWFHISCLTFGRLVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVV
RCRDRVR
>gnl|hbvpro|MF772344_HBe_P-A Product feature CHAIN MF772344_HBe_P-A of FT:mat_peptide MF772344_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1662). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MF772346_HBe_P-A Product feature CHAIN MF772346_HBe_P-A of FT:mat_peptide MF772346_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 855_16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETCVVR
RRDRGR
>gnl|hbvpro|MF772348_HBe_P-A Product feature CHAIN MF772348_HBe_P-A of FT:mat_peptide MF772348_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV120). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVR
RRDRVR
>gnl|hbvpro|MF772350_HBe_P-A Product feature CHAIN MF772350_HBe_P-A of FT:mat_peptide MF772350_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 64106). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MF772351_HBe_P-A Product feature CHAIN MF772351_HBe_P-A of FT:mat_peptide MF772351_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1141). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MF772353_HBe_P-A Product feature CHAIN MF772353_HBe_P-A of FT:mat_peptide MF772353_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV580). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WXGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MF925361_HBe_P-A Product feature CHAIN MF925361_HBe_P-A of FT:mat_peptide MF925361_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV04). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MF925362_HBe_P-A Product feature CHAIN MF925362_HBe_P-A of FT:mat_peptide MF925362_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV05). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPNVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGQGR
>gnl|hbvpro|MF925368_HBe_P-A Product feature CHAIN MF925368_HBe_P-A of FT:mat_peptide MF925368_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV12). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MF925372_HBe_P-A Product feature CHAIN MF925372_HBe_P-A of FT:mat_peptide MF925372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV16). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWLRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MF925373_HBe_P-A Product feature CHAIN MF925373_HBe_P-A of FT:mat_peptide MF925373_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV17). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|MF925385_HBe_P-A Product feature CHAIN MF925385_HBe_P-A of FT:mat_peptide MF925385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV29). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MF925400_HBe_P-A Product feature CHAIN MF925400_HBe_P-A of FT:mat_peptide MF925400_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV46). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRNRGR
>gnl|hbvpro|MF925407_HBe_P-A Product feature CHAIN MF925407_HBe_P-A of FT:mat_peptide MF925407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD-HBV54). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MG877723_HBe_P-A Product feature CHAIN MG877723_HBe_P-A of FT:mat_peptide MG877723_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I_t1). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFXPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
QRHRGR
>gnl|hbvpro|MG877724_HBe_P-A Product feature CHAIN MG877724_HBe_P-A of FT:mat_peptide MG877724_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I_t2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFXPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
QRHRGR
>gnl|hbvpro|MG877725_HBe_P-A Product feature CHAIN MG877725_HBe_P-A of FT:mat_peptide MG877725_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I_t3). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFXPSVRDLLDTASALYREALESPEHCSXHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
QRHRGR
>gnl|hbvpro|MH464808_HBe_P-A Product feature CHAIN MH464808_HBe_P-A of FT:mat_peptide MH464808_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA86). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKKFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAXRQAILCWGEXMXLAX
WVGNNLZDPXSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH464810_HBe_P-A Product feature CHAIN MH464810_HBe_P-A of FT:mat_peptide MH464810_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA88). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH464813_HBe_P-A Product feature CHAIN MH464813_HBe_P-A of FT:mat_peptide MH464813_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA91). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH464814_HBe_P-A Product feature CHAIN MH464814_HBe_P-A of FT:mat_peptide MH464814_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA92). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH464815_HBe_P-A Product feature CHAIN MH464815_HBe_P-A of FT:mat_peptide MH464815_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA93). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH464817_HBe_P-A Product feature CHAIN MH464817_HBe_P-A of FT:mat_peptide MH464817_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA95). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATXELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGNNLDDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH464818_HBe_P-A Product feature CHAIN MH464818_HBe_P-A of FT:mat_peptide MH464818_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA96). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH464825_HBe_P-A Product feature CHAIN MH464825_HBe_P-A of FT:mat_peptide MH464825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA103). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPPVRDLLGTAAALYREALESSDHCSPHHTALRQALLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH464828_HBe_P-A Product feature CHAIN MH464828_HBe_P-A of FT:mat_peptide MH464828_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA106). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH464830_HBe_P-A Product feature CHAIN MH464830_HBe_P-A of FT:mat_peptide MH464830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA108). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH580627_HBe_P-A Product feature CHAIN MH580627_HBe_P-A of FT:mat_peptide MH580627_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 299). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH580639_HBe_P-A Product feature CHAIN MH580639_HBe_P-A of FT:mat_peptide MH580639_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 420). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH580642_HBe_P-A Product feature CHAIN MH580642_HBe_P-A of FT:mat_peptide MH580642_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 443). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH580643_HBe_P-A Product feature CHAIN MH580643_HBe_P-A of FT:mat_peptide MH580643_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 446). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MH932713_HBe_P-A Product feature CHAIN MH932713_HBe_P-A of FT:mat_peptide MH932713_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Hiroshima GtA CL1). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512455_HBe_P-A Product feature CHAIN MK512455_HBe_P-A of FT:mat_peptide MK512455_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2079). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALNREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRELLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|MK512456_HBe_P-A Product feature CHAIN MK512456_HBe_P-A of FT:mat_peptide MK512456_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3531). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLETASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512457_HBe_P-A Product feature CHAIN MK512457_HBe_P-A of FT:mat_peptide MK512457_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw3173). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512458_HBe_P-A Product feature CHAIN MK512458_HBe_P-A of FT:mat_peptide MK512458_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2244). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDDCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWILTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512459_HBe_P-A Product feature CHAIN MK512459_HBe_P-A of FT:mat_peptide MK512459_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2226). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512460_HBe_P-A Product feature CHAIN MK512460_HBe_P-A of FT:mat_peptide MK512460_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2199). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512461_HBe_P-A Product feature CHAIN MK512461_HBe_P-A of FT:mat_peptide MK512461_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2157). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTAIRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512462_HBe_P-A Product feature CHAIN MK512462_HBe_P-A of FT:mat_peptide MK512462_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2113). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512463_HBe_P-A Product feature CHAIN MK512463_HBe_P-A of FT:mat_peptide MK512463_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2086). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512464_HBe_P-A Product feature CHAIN MK512464_HBe_P-A of FT:mat_peptide MK512464_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2016). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVLR
RRDRGR
>gnl|hbvpro|MK512465_HBe_P-A Product feature CHAIN MK512465_HBe_P-A of FT:mat_peptide MK512465_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw2003). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREGLESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512466_HBe_P-A Product feature CHAIN MK512466_HBe_P-A of FT:mat_peptide MK512466_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-226). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKISQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512467_HBe_P-A Product feature CHAIN MK512467_HBe_P-A of FT:mat_peptide MK512467_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-220). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELRTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGEWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512468_HBe_P-A Product feature CHAIN MK512468_HBe_P-A of FT:mat_peptide MK512468_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-203). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512469_HBe_P-A Product feature CHAIN MK512469_HBe_P-A of FT:mat_peptide MK512469_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-136). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512470_HBe_P-A Product feature CHAIN MK512470_HBe_P-A of FT:mat_peptide MK512470_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-126). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512471_HBe_P-A Product feature CHAIN MK512471_HBe_P-A of FT:mat_peptide MK512471_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-120). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAGALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512472_HBe_P-A Product feature CHAIN MK512472_HBe_P-A of FT:mat_peptide MK512472_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-65). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512473_HBe_P-A Product feature CHAIN MK512473_HBe_P-A of FT:mat_peptide MK512473_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-48). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512474_HBe_P-A Product feature CHAIN MK512474_HBe_P-A of FT:mat_peptide MK512474_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-37). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512475_HBe_P-A Product feature CHAIN MK512475_HBe_P-A of FT:mat_peptide MK512475_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-25). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MK512476_HBe_P-A Product feature CHAIN MK512476_HBe_P-A of FT:mat_peptide MK512476_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate rw14-14). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MN053840_HBe_P-A Product feature CHAIN MN053840_HBe_P-A of FT:mat_peptide MN053840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MN476101_HBe_P-A Product feature CHAIN MN476101_HBe_P-A of FT:mat_peptide MN476101_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV.CCC174). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MN476102_HBe_P-A Product feature CHAIN MN476102_HBe_P-A of FT:mat_peptide MN476102_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV.CCC194). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MN507849_HBe_P-A Product feature CHAIN MN507849_HBe_P-A of FT:mat_peptide MN507849_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2488_ocHBVa_GC). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MN544634_HBe_P-A Product feature CHAIN MN544634_HBe_P-A of FT:mat_peptide MN544634_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CG-0018a-01). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MN585096_HBe_P-A Product feature CHAIN MN585096_HBe_P-A of FT:mat_peptide MN585096_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MB-135). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVINYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRGHGR
>gnl|hbvpro|MN585097_HBe_P-A Product feature CHAIN MN585097_HBe_P-A of FT:mat_peptide MN585097_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MB-146). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILGWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGHGR
>gnl|hbvpro|MT114170_HBe_P-A Product feature CHAIN MT114170_HBe_P-A of FT:mat_peptide MT114170_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 076). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDHYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT210032_HBe_P-A Product feature CHAIN MT210032_HBe_P-A of FT:mat_peptide MT210032_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 209). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT210034_HBe_P-A Product feature CHAIN MT210034_HBe_P-A of FT:mat_peptide MT210034_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 289). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDXDPYKEFGATVELLSFLPXDFXPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAS
WVGNNLQDPASRDXVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|MT426088_HBe_P-A Product feature CHAIN MT426088_HBe_P-A of FT:mat_peptide MT426088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GDF476 transfection clone). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT426090_HBe_P-A Product feature CHAIN MT426090_HBe_P-A of FT:mat_peptide MT426090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NTBS331 transfection clone). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLGYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT426091_HBe_P-A Product feature CHAIN MT426091_HBe_P-A of FT:mat_peptide MT426091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NTBS567 transfection clone). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT426092_HBe_P-A Product feature CHAIN MT426092_HBe_P-A of FT:mat_peptide MT426092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UG4924 transfection clone). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT426093_HBe_P-A Product feature CHAIN MT426093_HBe_P-A of FT:mat_peptide MT426093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3864 transfection clone). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT426094_HBe_P-A Product feature CHAIN MT426094_HBe_P-A of FT:mat_peptide MT426094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3892 transfection clone). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT426095_HBe_P-A Product feature CHAIN MT426095_HBe_P-A of FT:mat_peptide MT426095_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3912 transfection clone). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFMPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT426096_HBe_P-A Product feature CHAIN MT426096_HBe_P-A of FT:mat_peptide MT426096_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6133 transfection clone). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNHVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT426097_HBe_P-A Product feature CHAIN MT426097_HBe_P-A of FT:mat_peptide MT426097_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5878 transfection clone). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT426098_HBe_P-A Product feature CHAIN MT426098_HBe_P-A of FT:mat_peptide MT426098_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6061 transfection clone). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT426099_HBe_P-A Product feature CHAIN MT426099_HBe_P-A of FT:mat_peptide MT426099_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3863 transfection clone). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448620_HBe_P-A Product feature CHAIN MT448620_HBe_P-A of FT:mat_peptide MT448620_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448622_HBe_P-A Product feature CHAIN MT448622_HBe_P-A of FT:mat_peptide MT448622_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 22P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448623_HBe_P-A Product feature CHAIN MT448623_HBe_P-A of FT:mat_peptide MT448623_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448624_HBe_P-A Product feature CHAIN MT448624_HBe_P-A of FT:mat_peptide MT448624_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 40P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448625_HBe_P-A Product feature CHAIN MT448625_HBe_P-A of FT:mat_peptide MT448625_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 151P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448626_HBe_P-A Product feature CHAIN MT448626_HBe_P-A of FT:mat_peptide MT448626_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 173P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448627_HBe_P-A Product feature CHAIN MT448627_HBe_P-A of FT:mat_peptide MT448627_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 121P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448629_HBe_P-A Product feature CHAIN MT448629_HBe_P-A of FT:mat_peptide MT448629_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448632_HBe_P-A Product feature CHAIN MT448632_HBe_P-A of FT:mat_peptide MT448632_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 215P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448633_HBe_P-A Product feature CHAIN MT448633_HBe_P-A of FT:mat_peptide MT448633_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 216P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448634_HBe_P-A Product feature CHAIN MT448634_HBe_P-A of FT:mat_peptide MT448634_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 219P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448636_HBe_P-A Product feature CHAIN MT448636_HBe_P-A of FT:mat_peptide MT448636_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 220P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT448637_HBe_P-A Product feature CHAIN MT448637_HBe_P-A of FT:mat_peptide MT448637_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 222P). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT622525_HBe_P-A Product feature CHAIN MT622525_HBe_P-A of FT:mat_peptide MT622525_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate U22343). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT731813_HBe_P-A Product feature CHAIN MT731813_HBe_P-A of FT:mat_peptide MT731813_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B3212). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT731823_HBe_P-A Product feature CHAIN MT731823_HBe_P-A of FT:mat_peptide MT731823_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B3226). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAN
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRNTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGG
>gnl|hbvpro|MT731829_HBe_P-A Product feature CHAIN MT731829_HBe_P-A of FT:mat_peptide MT731829_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B3279). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASSLYRDALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKLRQILWFHLSCLMFGRDTVLEYLVSFGVWIRTPQPYRPPNAPILSTLPETAVIR
QRGRRR
>gnl|hbvpro|MT731833_HBe_P-A Product feature CHAIN MT731833_HBe_P-A of FT:mat_peptide MT731833_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B3510). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIR
QRGRGR
>gnl|hbvpro|MT731863_HBe_P-A Product feature CHAIN MT731863_HBe_P-A of FT:mat_peptide MT731863_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B3593). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT731865_HBe_P-A Product feature CHAIN MT731865_HBe_P-A of FT:mat_peptide MT731865_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B3598). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATXELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPXYRPPNAPILSTLPETTVVR
XRDRGR
>gnl|hbvpro|MT731868_HBe_P-A Product feature CHAIN MT731868_HBe_P-A of FT:mat_peptide MT731868_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B3621). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVAR
RRDRGR
>gnl|hbvpro|MT731888_HBe_P-A Product feature CHAIN MT731888_HBe_P-A of FT:mat_peptide MT731888_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B2803). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELVSFLPHDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNNNVGLRLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT731898_HBe_P-A Product feature CHAIN MT731898_HBe_P-A of FT:mat_peptide MT731898_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B3275). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT731899_HBe_P-A Product feature CHAIN MT731899_HBe_P-A of FT:mat_peptide MT731899_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B3504). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MT731902_HBe_P-A Product feature CHAIN MT731902_HBe_P-A of FT:mat_peptide MT731902_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B3851). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVDLISFLPADFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGQLMTLAT
WVGNNLQDPASRDQVVNYVNNNMGLMIRQILWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|MT731908_HBe_P-A Product feature CHAIN MT731908_HBe_P-A of FT:mat_peptide MT731908_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B4693). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
SRDRGR
>gnl|hbvpro|MT731909_HBe_P-A Product feature CHAIN MT731909_HBe_P-A of FT:mat_peptide MT731909_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B4759). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=167 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFFPSARDLLDTASALYREALESSEHCSPHHTALRQAILCWGDVMTLAT
WVGANLQDPASRDQVVNYVNTNMGLKIRQLLWFHTSCITFGREIVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HRRQDRG
>gnl|hbvpro|MT731914_HBe_P-A Product feature CHAIN MT731914_HBe_P-A of FT:mat_peptide MT731914_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B5560 (D2)). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDHYKEFGASVELISFLPLDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDQVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGRGR
>gnl|hbvpro|MT731919_HBe_P-A Product feature CHAIN MT731919_HBe_P-A of FT:mat_peptide MT731919_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B6597). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|MT731929_HBe_P-A Product feature CHAIN MT731929_HBe_P-A of FT:mat_peptide MT731929_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B8357). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVR
RRDRGR
>gnl|hbvpro|MW567975_HBe_P-A Product feature CHAIN MW567975_HBe_P-A of FT:mat_peptide MW567975_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SEN-CS100148). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
RRDRGR
>gnl|hbvpro|MW567976_HBe_P-A Product feature CHAIN MW567976_HBe_P-A of FT:mat_peptide MW567976_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SEN-CS200152). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
SRGRGR
>gnl|hbvpro|MZ043025_HBe_P-A Product feature CHAIN MZ043025_HBe_P-A of FT:mat_peptide MZ043025_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BO15-071P1). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPQDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVMNLAX
WVGNNLEDPGSRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPIYRPPNAPILSTLPETTVVR
RRBRGR
>gnl|hbvpro|MZ043026_HBe_P-A Product feature CHAIN MZ043026_HBe_P-A of FT:mat_peptide MZ043026_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD13-13048). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQXILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043028_HBe_P-A Product feature CHAIN MZ043028_HBe_P-A of FT:mat_peptide MZ043028_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD13-16003). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043029_HBe_P-A Product feature CHAIN MZ043029_HBe_P-A of FT:mat_peptide MZ043029_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD13-26215). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSAHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETAVVR
CRVRGR
>gnl|hbvpro|MZ043030_HBe_P-A Product feature CHAIN MZ043030_HBe_P-A of FT:mat_peptide MZ043030_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD13-35864). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043031_HBe_P-A Product feature CHAIN MZ043031_HBe_P-A of FT:mat_peptide MZ043031_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD13-38079). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELISFLPPDFFPSARDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043032_HBe_P-A Product feature CHAIN MZ043032_HBe_P-A of FT:mat_peptide MZ043032_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD13-40532). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALFREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRVR
>gnl|hbvpro|MZ043034_HBe_P-A Product feature CHAIN MZ043034_HBe_P-A of FT:mat_peptide MZ043034_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD13-48928). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLHETTVVR
RRDRGR
>gnl|hbvpro|MZ043035_HBe_P-A Product feature CHAIN MZ043035_HBe_P-A of FT:mat_peptide MZ043035_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-03366). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
QRYRGR
>gnl|hbvpro|MZ043036_HBe_P-A Product feature CHAIN MZ043036_HBe_P-A of FT:mat_peptide MZ043036_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-07213). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAXLCWVELMTLAT
WVGNNLXDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRXTVXEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043037_HBe_P-A Product feature CHAIN MZ043037_HBe_P-A of FT:mat_peptide MZ043037_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-08901). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVXR
RRDRGR
>gnl|hbvpro|MZ043038_HBe_P-A Product feature CHAIN MZ043038_HBe_P-A of FT:mat_peptide MZ043038_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-19862). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDTYKEFGASVDLLSFLPADFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAVVCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043040_HBe_P-A Product feature CHAIN MZ043040_HBe_P-A of FT:mat_peptide MZ043040_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-28904). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043041_HBe_P-A Product feature CHAIN MZ043041_HBe_P-A of FT:mat_peptide MZ043041_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-29856). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVDYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPTNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043042_HBe_P-A Product feature CHAIN MZ043042_HBe_P-A of FT:mat_peptide MZ043042_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-31726). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDLYKEFGASVELLSFLPHDFFPSVRDLLDTASALYRQALESPEHCXAHHTALRQAIVCWGELMNLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043043_HBe_P-A Product feature CHAIN MZ043043_HBe_P-A of FT:mat_peptide MZ043043_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-33480). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043044_HBe_P-A Product feature CHAIN MZ043044_HBe_P-A of FT:mat_peptide MZ043044_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-34338). Complete genome. [Riboviria] (length=165 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPLDFYPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGDLTALGT
WVGNNLDDPASRDXVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGCR
>gnl|hbvpro|MZ043046_HBe_P-A Product feature CHAIN MZ043046_HBe_P-A of FT:mat_peptide MZ043046_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-42523). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043047_HBe_P-A Product feature CHAIN MZ043047_HBe_P-A of FT:mat_peptide MZ043047_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD14-48008). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043049_HBe_P-A Product feature CHAIN MZ043049_HBe_P-A of FT:mat_peptide MZ043049_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DD17-19935). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQEIICWGQLTNLAT
WVGSNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
NRNRGR
>gnl|hbvpro|MZ043051_HBe_P-A Product feature CHAIN MZ043051_HBe_P-A of FT:mat_peptide MZ043051_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D-HBV-4). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRQALESPEHCTPHHTALRQAILCWGELMNLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSMLPETAVVR
RRDRGR
>gnl|hbvpro|MZ043052_HBe_P-A Product feature CHAIN MZ043052_HBe_P-A of FT:mat_peptide MZ043052_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D-HBV-11). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTPHHTALRQAILCWVELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043053_HBe_P-A Product feature CHAIN MZ043053_HBe_P-A of FT:mat_peptide MZ043053_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D-HBV-15). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043054_HBe_P-A Product feature CHAIN MZ043054_HBe_P-A of FT:mat_peptide MZ043054_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D-HBV-20). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMTLXX
WVGNNLEDXASRDLVVNYVNTNMGLKXRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPLNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043055_HBe_P-A Product feature CHAIN MZ043055_HBe_P-A of FT:mat_peptide MZ043055_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-01). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043056_HBe_P-A Product feature CHAIN MZ043056_HBe_P-A of FT:mat_peptide MZ043056_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-17). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFYPSVRDLLDTASALLREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHLSCLTFGREIVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043057_HBe_P-A Product feature CHAIN MZ043057_HBe_P-A of FT:mat_peptide MZ043057_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-28). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDLVVNYVNTNMGLKMRQLMWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043058_HBe_P-A Product feature CHAIN MZ043058_HBe_P-A of FT:mat_peptide MZ043058_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-31). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPIDFFPSVRDLVDTASALYRDALESPEHCTPHHTALRQAILCWGELTTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRNTVLEYLVSFGVWIRTPPAYRPANAPILSTLPECTVVR
QRDRGR
>gnl|hbvpro|MZ043059_HBe_P-A Product feature CHAIN MZ043059_HBe_P-A of FT:mat_peptide MZ043059_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-39). Complete genome. [Riboviria] (length=166 residues).
SQLCLGWLWGMNIDPYKEFGATVELLSFLPHDFYPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPKTTVVR
GRDRRR
>gnl|hbvpro|MZ043060_HBe_P-A Product feature CHAIN MZ043060_HBe_P-A of FT:mat_peptide MZ043060_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-40). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTHMGLKIRQLLWFHTSCIVFGRETVXEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043061_HBe_P-A Product feature CHAIN MZ043061_HBe_P-A of FT:mat_peptide MZ043061_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-54). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043062_HBe_P-A Product feature CHAIN MZ043062_HBe_P-A of FT:mat_peptide MZ043062_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-75). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPHDFYPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
CRDRRR
>gnl|hbvpro|MZ043063_HBe_P-A Product feature CHAIN MZ043063_HBe_P-A of FT:mat_peptide MZ043063_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-81). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELISFLPADFFPSVRDLLDTASALYREALESPEHVSAHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTGMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRRR
>gnl|hbvpro|MZ043064_HBe_P-A Product feature CHAIN MZ043064_HBe_P-A of FT:mat_peptide MZ043064_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-91). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELSTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
SRGRGR
>gnl|hbvpro|MZ043065_HBe_P-A Product feature CHAIN MZ043065_HBe_P-A of FT:mat_peptide MZ043065_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-92). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHLSCITFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSILPETAVIR
PRGRRR
>gnl|hbvpro|MZ043067_HBe_P-A Product feature CHAIN MZ043067_HBe_P-A of FT:mat_peptide MZ043067_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FR-HBV-97). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGRDR
>gnl|hbvpro|MZ043068_HBe_P-A Product feature CHAIN MZ043068_HBe_P-A of FT:mat_peptide MZ043068_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-151). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSTKDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLGT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
PRHRGR
>gnl|hbvpro|MZ043069_HBe_P-A Product feature CHAIN MZ043069_HBe_P-A of FT:mat_peptide MZ043069_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-215). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFYPSVRDLLDTASALYRXALESPEHCSAHHTAIRQAILCWGELMTLAS
WVGTNLDDPGSRDQVVQYVNTNMGLKIRQLLWFHISCLTFGRTTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGG
>gnl|hbvpro|MZ043071_HBe_P-A Product feature CHAIN MZ043071_HBe_P-A of FT:mat_peptide MZ043071_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV-273). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPHDFYPSVKDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
WVGNNLEDQASRNLVVDYVNNNVGLRLRQLLWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043074_HBe_P-A Product feature CHAIN MZ043074_HBe_P-A of FT:mat_peptide MZ043074_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HN-HBV-4). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLQDTASALYREALESPEHCSPHHTALRQAXLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGXKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRRR
>gnl|hbvpro|MZ043075_HBe_P-A Product feature CHAIN MZ043075_HBe_P-A of FT:mat_peptide MZ043075_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HN-HBV-28). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGAXVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTAIRQGXVCWGEVMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVXEYLISFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043076_HBe_P-A Product feature CHAIN MZ043076_HBe_P-A of FT:mat_peptide MZ043076_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HN-HBV-38). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAVLCWVELTTLAT
WVGNNLQDPQSRDQVVNYVNTNMGLKLRQLLWFHISCLTFGTPTVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVR
RRGG
>gnl|hbvpro|MZ043077_HBe_P-A Product feature CHAIN MZ043077_HBe_P-A of FT:mat_peptide MZ043077_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HN-HBV-41). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|MZ043078_HBe_P-A Product feature CHAIN MZ043078_HBe_P-A of FT:mat_peptide MZ043078_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HN-HBV-43). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043080_HBe_P-A Product feature CHAIN MZ043080_HBe_P-A of FT:mat_peptide MZ043080_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HN-HBV-58). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
SRDRGR
>gnl|hbvpro|MZ043081_HBe_P-A Product feature CHAIN MZ043081_HBe_P-A of FT:mat_peptide MZ043081_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HN-HBV-62). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDQASRDLVVNYVNTXMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVWIRTPPPYRPLNAPILSTLPETAVVR
PRDRRR
>gnl|hbvpro|MZ043082_HBe_P-A Product feature CHAIN MZ043082_HBe_P-A of FT:mat_peptide MZ043082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HN-HBV-65). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPXDFFPSXRDLLDTASALYRXALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043083_HBe_P-A Product feature CHAIN MZ043083_HBe_P-A of FT:mat_peptide MZ043083_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HN-HBV-70). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043084_HBe_P-A Product feature CHAIN MZ043084_HBe_P-A of FT:mat_peptide MZ043084_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HN-HBV-85b). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043085_HBe_P-A Product feature CHAIN MZ043085_HBe_P-A of FT:mat_peptide MZ043085_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDN-HBV-6). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASSDLISFLPADFFPSIRDLLDTASALFRDALESPEHCSPHHTAIRQEIICWGELMTLAS
WVGNNLQDPASRDLVVHYVNNNMGLKIRQLLWFHISCIIFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
PRDRRR
>gnl|hbvpro|MZ043086_HBe_P-A Product feature CHAIN MZ043086_HBe_P-A of FT:mat_peptide MZ043086_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDN-HBV-7). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESQEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPTNAPILSTLPETTVVR
QRGRGR
>gnl|hbvpro|MZ043087_HBe_P-A Product feature CHAIN MZ043087_HBe_P-A of FT:mat_peptide MZ043087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDN-HBV-9). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPADFFPSARDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELTTLGT
WVGNNLQDPTSRDQVVNYVNNNMGLKIRQLLWYHLSCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043088_HBe_P-A Product feature CHAIN MZ043088_HBe_P-A of FT:mat_peptide MZ043088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDN-HBV-14). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043089_HBe_P-A Product feature CHAIN MZ043089_HBe_P-A of FT:mat_peptide MZ043089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDN-HBV-19). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLDDPGSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|MZ043090_HBe_P-A Product feature CHAIN MZ043090_HBe_P-A of FT:mat_peptide MZ043090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDN-HBV-26). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASADLISFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGDVMSLAT
WVGVNLEDPASRDQVVNYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
QRGRGR
>gnl|hbvpro|MZ043092_HBe_P-A Product feature CHAIN MZ043092_HBe_P-A of FT:mat_peptide MZ043092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDN-HBV-40). Complete genome. [Riboviria] (length=166 residues).
SKLCLRWLWGMDIDPYKEFGASVELLSFLPHDFYPSVRDLLDTASALYRXALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
CRDRRR
>gnl|hbvpro|MZ043094_HBe_P-A Product feature CHAIN MZ043094_HBe_P-A of FT:mat_peptide MZ043094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDN-HBV-50). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPDHCTPHHTALRQAILCWGDLTNLGT
WVGNNLQDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|MZ043096_HBe_P-A Product feature CHAIN MZ043096_HBe_P-A of FT:mat_peptide MZ043096_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDN-HBV-63). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPPDFFPSVRDLLDTATALYREALESPEHCSPHHTAIRQAFLCWGELMTLAS
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
PRVRGR
>gnl|hbvpro|MZ043097_HBe_P-A Product feature CHAIN MZ043097_HBe_P-A of FT:mat_peptide MZ043097_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LDN-HBV-65). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGN
WVGNNLQDPASRDQVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSMLPETTVVR
RRDRGR
>gnl|hbvpro|MZ093431_HBe_P-A Product feature CHAIN MZ093431_HBe_P-A of FT:mat_peptide MZ093431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|OK106253_HBe_P-A Product feature CHAIN OK106253_HBe_P-A of FT:mat_peptide OK106253_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|OK143477_HBe_P-A Product feature CHAIN OK143477_HBe_P-A of FT:mat_peptide OK143477_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17Y_Yakutia_2018). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
GRGR
>gnl|hbvpro|OK143478_HBe_P-A Product feature CHAIN OK143478_HBe_P-A of FT:mat_peptide OK143478_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1Na_Yakutia_2018). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLTNLAT
WVGTNLDDQASRDLVVNYVNTTTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRAR
>gnl|hbvpro|OK143482_HBe_P-A Product feature CHAIN OK143482_HBe_P-A of FT:mat_peptide OK143482_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 42Y_Yakutia_2018). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAN
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK143483_HBe_P-A Product feature CHAIN OK143483_HBe_P-A of FT:mat_peptide OK143483_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 51_Moscow_2008). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK143484_HBe_P-A Product feature CHAIN OK143484_HBe_P-A of FT:mat_peptide OK143484_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 56_Moscow_2008). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK143492_HBe_P-A Product feature CHAIN OK143492_HBe_P-A of FT:mat_peptide OK143492_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 712_Moscow_2008). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK143495_HBe_P-A Product feature CHAIN OK143495_HBe_P-A of FT:mat_peptide OK143495_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 7Y_Yakutia_2018). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELNALAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWYHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|OK143498_HBe_P-A Product feature CHAIN OK143498_HBe_P-A of FT:mat_peptide OK143498_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9Y_Yakutia_2018). Complete genome. [Riboviria] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSVRDLVDTASALYREALESPEHCSAHHTALRQVILCWGELMTLAT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPANAPILSTLPETTVVR
QRRR
>gnl|hbvpro|OK274310_HBe_P-A Product feature CHAIN OK274310_HBe_P-A of FT:mat_peptide OK274310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12/21/389). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|OK998526_HBe_P-A Product feature CHAIN OK998526_HBe_P-A of FT:mat_peptide OK998526_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV_HD_OBI_Belgrade62). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|OM304326_HBe_P-A Product feature CHAIN OM304326_HBe_P-A of FT:mat_peptide OM304326_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 155_Tyva_RU_2021). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGAXVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
CRDRGR
>gnl|hbvpro|ON093162_HBe_P-A Product feature CHAIN ON093162_HBe_P-A of FT:mat_peptide ON093162_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|ON585698_HBe_P-A Product feature CHAIN ON585698_HBe_P-A of FT:mat_peptide ON585698_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LMV_10). Complete genome. [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|ON585700_HBe_P-A Product feature CHAIN ON585700_HBe_P-A of FT:mat_peptide ON585700_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LMV_14). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Riboviria] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVIR
RRDRGR
>gnl|hbvpro|V00866_HBe_P-A Product feature CHAIN V00866_HBe_P-A of FT:mat_peptide V00866_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|X02763_HBe_C-A Product feature CHAIN X02763_HBe_C-A of FT:mat_peptide X02763_HBe_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|X07911_HBe_P-A Product feature CHAIN X07911_HBe_P-A of FT:mat_peptide X07911_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|X51970_HBe_P-A Product feature CHAIN X51970_HBe_P-A of FT:mat_peptide X51970_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|X70185_HBe_P-A Product feature CHAIN X70185_HBe_P-A of FT:mat_peptide X70185_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient A938). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|Z35717_HBe_P-A Product feature CHAIN Z35717_HBe_P-A of FT:mat_peptide Z35717_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hb614). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|Z68141_HBe_P-A Product feature CHAIN Z68141_HBe_P-A of FT:mat_peptide Z68141_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate case 7). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=166 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|Z72478_HBe_P-A Product feature CHAIN Z72478_HBe_P-A of FT:mat_peptide Z72478_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A317). Complete genome. [Hepadnaviridae] (length=166 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRDRGR
>gnl|hbvpro|AB010289_HBe_P-B Product feature CHAIN AB010289_HBe_P-B of FT:mat_peptide AB010289_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Yamagata-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB033554_HBe_P-B Product feature CHAIN AB033554_HBe_P-B of FT:mat_peptide AB033554_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate RTB299). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB033555_HBe_P-B Product feature CHAIN AB033555_HBe_P-B of FT:mat_peptide AB033555_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAD744). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB048705_HBe_P-B Product feature CHAIN AB048705_HBe_P-B of FT:mat_peptide AB048705_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073821_HBe_P-B Product feature CHAIN AB073821_HBe_P-B of FT:mat_peptide AB073821_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi20). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
XRGR
>gnl|hbvpro|AB073822_HBe_P-B Product feature CHAIN AB073822_HBe_P-B of FT:mat_peptide AB073822_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi32). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073825_HBe_P-B Product feature CHAIN AB073825_HBe_P-B of FT:mat_peptide AB073825_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi51). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCTAHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHLSCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073826_HBe_P-B Product feature CHAIN AB073826_HBe_P-B of FT:mat_peptide AB073826_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi89). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073827_HBe_P-B Product feature CHAIN AB073827_HBe_P-B of FT:mat_peptide AB073827_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073828_HBe_P-B Product feature CHAIN AB073828_HBe_P-B of FT:mat_peptide AB073828_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK37). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073829_HBe_P-B Product feature CHAIN AB073829_HBe_P-B of FT:mat_peptide AB073829_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HK38). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073831_HBe_P-B Product feature CHAIN AB073831_HBe_P-B of FT:mat_peptide AB073831_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-TH61). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073833_HBe_P-B Product feature CHAIN AB073833_HBe_P-B of FT:mat_peptide AB073833_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Chi59). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073834_HBe_P-B Product feature CHAIN AB073834_HBe_P-B of FT:mat_peptide AB073834_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Vi16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073840_HBe_P-B Product feature CHAIN AB073840_HBe_P-B of FT:mat_peptide AB073840_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Tw36). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALDREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073846_HBe_P-B Product feature CHAIN AB073846_HBe_P-B of FT:mat_peptide AB073846_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry565). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073848_HBe_P-B Product feature CHAIN AB073848_HBe_P-B of FT:mat_peptide AB073848_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-HUS). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073850_HBe_P-B Product feature CHAIN AB073850_HBe_P-B of FT:mat_peptide AB073850_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Na102). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPVHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB073851_HBe_P-B Product feature CHAIN AB073851_HBe_P-B of FT:mat_peptide AB073851_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-Ry1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTAAALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB100695_HBe_P-B Product feature CHAIN AB100695_HBe_P-B of FT:mat_peptide AB100695_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-VH133). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
WVGSNLEDPASRELVVSHVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSPLPETTVVR
RRCR
>gnl|hbvpro|AB115551_HBe_P-B Product feature CHAIN AB115551_HBe_P-B of FT:mat_peptide AB115551_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-CB15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWAMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB195933_HBe_P-B Product feature CHAIN AB195933_HBe_P-B of FT:mat_peptide AB195933_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB195934_HBe_P-B Product feature CHAIN AB195934_HBe_P-B of FT:mat_peptide AB195934_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB195935_HBe_P-B Product feature CHAIN AB195935_HBe_P-B of FT:mat_peptide AB195935_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB205119_HBe_P-B Product feature CHAIN AB205119_HBe_P-B of FT:mat_peptide AB205119_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF687-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB205121_HBe_P-B Product feature CHAIN AB205121_HBe_P-B of FT:mat_peptide AB205121_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-IF720-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB212625_HBe_P-B Product feature CHAIN AB212625_HBe_P-B of FT:mat_peptide AB212625_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1026). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASAELLSFLPSDFFPTIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RTGR
>gnl|hbvpro|AB212626_HBe_P-B Product feature CHAIN AB212626_HBe_P-B of FT:mat_peptide AB212626_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VT1022). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|AB219426_HBe_P-B Product feature CHAIN AB219426_HBe_P-B of FT:mat_peptide AB219426_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4014, PNN1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|AB219428_HBe_C-B Product feature CHAIN AB219428_HBe_C-B of FT:mat_peptide AB219428_HBe_C-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4076, PNN3). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB219429_HBe_P-B Product feature CHAIN AB219429_HBe_P-B of FT:mat_peptide AB219429_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4101, PNN4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|AB219430_HBe_P-B Product feature CHAIN AB219430_HBe_P-B of FT:mat_peptide AB219430_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Patient #4148, PNN5). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB231909_HBe_P-B Product feature CHAIN AB231909_HBe_P-B of FT:mat_peptide AB231909_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate VH10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTAPRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB241116_HBe_P-B Product feature CHAIN AB241116_HBe_P-B of FT:mat_peptide AB241116_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC03). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|AB241117_HBe_P-B Product feature CHAIN AB241117_HBe_P-B of FT:mat_peptide AB241117_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PhHCC05). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|AB246339_HBe_P-B Product feature CHAIN AB246339_HBe_P-B of FT:mat_peptide AB246339_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB246340_HBe_P-B Product feature CHAIN AB246340_HBe_P-B of FT:mat_peptide AB246340_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB246341_HBe_P-B Product feature CHAIN AB246341_HBe_P-B of FT:mat_peptide AB246341_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB246342_HBe_P-B Product feature CHAIN AB246342_HBe_P-B of FT:mat_peptide AB246342_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB246343_HBe_P-B Product feature CHAIN AB246343_HBe_P-B of FT:mat_peptide AB246343_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHVSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB287314_HBe_P-B Product feature CHAIN AB287314_HBe_P-B of FT:mat_peptide AB287314_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska433). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB287315_HBe_P-B Product feature CHAIN AB287315_HBe_P-B of FT:mat_peptide AB287315_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alaska419). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB287328_HBe_P-B Product feature CHAIN AB287328_HBe_P-B of FT:mat_peptide AB287328_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba 51). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB287329_HBe_P-B Product feature CHAIN AB287329_HBe_P-B of FT:mat_peptide AB287329_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JPN Ba A55). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB300364_HBe_P-B Product feature CHAIN AB300364_HBe_P-B of FT:mat_peptide AB300364_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient6). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB334299_HBe_P-B Product feature CHAIN AB334299_HBe_P-B of FT:mat_peptide AB334299_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB334300_HBe_P-B Product feature CHAIN AB334300_HBe_P-B of FT:mat_peptide AB334300_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 5UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB334301_HBe_P-B Product feature CHAIN AB334301_HBe_P-B of FT:mat_peptide AB334301_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB334302_HBe_P-B Product feature CHAIN AB334302_HBe_P-B of FT:mat_peptide AB334302_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 16UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB334303_HBe_P-B Product feature CHAIN AB334303_HBe_P-B of FT:mat_peptide AB334303_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 21UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB355453_HBe_P-B Product feature CHAIN AB355453_HBe_P-B of FT:mat_peptide AB355453_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB355454_HBe_P-B Product feature CHAIN AB355454_HBe_P-B of FT:mat_peptide AB355454_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 29UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB355455_HBe_P-B Product feature CHAIN AB355455_HBe_P-B of FT:mat_peptide AB355455_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 33UC). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB471854_HBe_P-B Product feature CHAIN AB471854_HBe_P-B of FT:mat_peptide AB471854_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-F). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB471855_HBe_P-B Product feature CHAIN AB471855_HBe_P-B of FT:mat_peptide AB471855_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate F5M-C). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB493827_HBe_P-B Product feature CHAIN AB493827_HBe_P-B of FT:mat_peptide AB493827_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 25UC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRXLLNPVLVLYRGALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB493833_HBe_P-B Product feature CHAIN AB493833_HBe_P-B of FT:mat_peptide AB493833_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P9). Complete genome. [Hepadnaviridae] (length=164 residues).
SNLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB493835_HBe_P-B Product feature CHAIN AB493835_HBe_P-B of FT:mat_peptide AB493835_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate P30). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDAASALYREALESPEHCSPHHTALRQAILCWGELRNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB675676_HBe_P-B Product feature CHAIN AB675676_HBe_P-B of FT:mat_peptide AB675676_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 10A37). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB713527_HBe_P-B Product feature CHAIN AB713527_HBe_P-B of FT:mat_peptide AB713527_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv30). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB713528_HBe_P-B Product feature CHAIN AB713528_HBe_P-B of FT:mat_peptide AB713528_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv44). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB713530_HBe_P-B Product feature CHAIN AB713530_HBe_P-B of FT:mat_peptide AB713530_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv94). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALKQAILCWGELMNLAT
WVGSNLEDPACRDLIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB713531_HBe_P-B Product feature CHAIN AB713531_HBe_P-B of FT:mat_peptide AB713531_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv98). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB713532_HBe_P-B Product feature CHAIN AB713532_HBe_P-B of FT:mat_peptide AB713532_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate YOGHhbv132). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIKQLLGVPIFGRTFRRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB900110_HBe_P-B Product feature CHAIN AB900110_HBe_P-B of FT:mat_peptide AB900110_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTAIRQAIICWGELMNLAT
WVGSNLEDPSSREAVVGYVNVNMGIKLRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPAAYRPANAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB900112_HBe_P-B Product feature CHAIN AB900112_HBe_P-B of FT:mat_peptide AB900112_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPQDFYPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB908299_HBe_P-B Product feature CHAIN AB908299_HBe_P-B of FT:mat_peptide AB908299_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB908300_HBe_P-B Product feature CHAIN AB908300_HBe_P-B of FT:mat_peptide AB908300_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB908303_HBe_P-B Product feature CHAIN AB908303_HBe_P-B of FT:mat_peptide AB908303_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESLEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLASFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AB908304_HBe_P-B Product feature CHAIN AB908304_HBe_P-B of FT:mat_peptide AB908304_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF100308_HBe_P-B Product feature CHAIN AF100308_HBe_P-B of FT:mat_peptide AF100308_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRGALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF100309_HBe_P-B Product feature CHAIN AF100309_HBe_P-B of FT:mat_peptide AF100309_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPSSRELVVSYVNVNMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF121243_HBe_P-B Product feature CHAIN AF121243_HBe_P-B of FT:mat_peptide AF121243_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/14611). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF121244_HBe_P-B Product feature CHAIN AF121244_HBe_P-B of FT:mat_peptide AF121244_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/15122). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF121245_HBe_P-B Product feature CHAIN AF121245_HBe_P-B of FT:mat_peptide AF121245_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/16091). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF121246_HBe_P-B Product feature CHAIN AF121246_HBe_P-B of FT:mat_peptide AF121246_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/IK29902). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF121247_HBe_P-B Product feature CHAIN AF121247_HBe_P-B of FT:mat_peptide AF121247_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/719). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF121249_HBe_P-B Product feature CHAIN AF121249_HBe_P-B of FT:mat_peptide AF121249_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV/4014). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF157020_HBe_P-B Product feature CHAIN AF157020_HBe_P-B of FT:mat_peptide AF157020_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWICTPPAYRPPNAPILSTLPDTTVVR
RRGR
>gnl|hbvpro|AF157023_HBe_P-B Product feature CHAIN AF157023_HBe_P-B of FT:mat_peptide AF157023_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF157024_HBe_P-B Product feature CHAIN AF157024_HBe_P-B of FT:mat_peptide AF157024_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF233235_HBe_P-B Product feature CHAIN AF233235_HBe_P-B of FT:mat_peptide AF233235_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV263c). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|AF233237_HBe_P-B Product feature CHAIN AF233237_HBe_P-B of FT:mat_peptide AF233237_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV4c). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF282917_HBe_P-B Product feature CHAIN AF282917_HBe_P-B of FT:mat_peptide AF282917_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHSSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGQNFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF282918_HBe_P-B Product feature CHAIN AF282918_HBe_P-B of FT:mat_peptide AF282918_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-B2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLQDPASRELVVSYVNANMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF335738_HBe_P-B Product feature CHAIN AF335738_HBe_P-B of FT:mat_peptide AF335738_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF335740_HBe_P-B Product feature CHAIN AF335740_HBe_P-B of FT:mat_peptide AF335740_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF335741_HBe_P-B Product feature CHAIN AF335741_HBe_P-B of FT:mat_peptide AF335741_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF335746_HBe_P-B Product feature CHAIN AF335746_HBe_P-B of FT:mat_peptide AF335746_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF335748_HBe_P-B Product feature CHAIN AF335748_HBe_P-B of FT:mat_peptide AF335748_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIQCWGEVMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF335754_HBe_P-B Product feature CHAIN AF335754_HBe_P-B of FT:mat_peptide AF335754_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF479684_HBe_P-B Product feature CHAIN AF479684_HBe_P-B of FT:mat_peptide AF479684_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 3c). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASVLYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480337_HBe_P-B Product feature CHAIN AF480337_HBe_P-B of FT:mat_peptide AF480337_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWPWGMDIDPYKEFGASGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQASLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|AF480338_HBe_P-B Product feature CHAIN AF480338_HBe_P-B of FT:mat_peptide AF480338_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480339_HBe_P-B Product feature CHAIN AF480339_HBe_P-B of FT:mat_peptide AF480339_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480340_HBe_P-B Product feature CHAIN AF480340_HBe_P-B of FT:mat_peptide AF480340_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480341_HBe_P-B Product feature CHAIN AF480341_HBe_P-B of FT:mat_peptide AF480341_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDFIDTASALYREALESSEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480342_HBe_P-B Product feature CHAIN AF480342_HBe_P-B of FT:mat_peptide AF480342_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-8). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|AF480343_HBe_P-B Product feature CHAIN AF480343_HBe_P-B of FT:mat_peptide AF480343_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDLYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQEILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480344_HBe_P-B Product feature CHAIN AF480344_HBe_P-B of FT:mat_peptide AF480344_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|AF480345_HBe_P-B Product feature CHAIN AF480345_HBe_P-B of FT:mat_peptide AF480345_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480346_HBe_P-B Product feature CHAIN AF480346_HBe_P-B of FT:mat_peptide AF480346_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCPTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480347_HBe_P-B Product feature CHAIN AF480347_HBe_P-B of FT:mat_peptide AF480347_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|AF480348_HBe_P-B Product feature CHAIN AF480348_HBe_P-B of FT:mat_peptide AF480348_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480349_HBe_P-B Product feature CHAIN AF480349_HBe_P-B of FT:mat_peptide AF480349_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISRLTFGRETVLEYLVSLGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480350_HBe_P-B Product feature CHAIN AF480350_HBe_P-B of FT:mat_peptide AF480350_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480351_HBe_P-B Product feature CHAIN AF480351_HBe_P-B of FT:mat_peptide AF480351_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLTT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480352_HBe_P-B Product feature CHAIN AF480352_HBe_P-B of FT:mat_peptide AF480352_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSLGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480353_HBe_P-B Product feature CHAIN AF480353_HBe_P-B of FT:mat_peptide AF480353_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQNILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|AF480354_HBe_P-B Product feature CHAIN AF480354_HBe_P-B of FT:mat_peptide AF480354_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480355_HBe_P-B Product feature CHAIN AF480355_HBe_P-B of FT:mat_peptide AF480355_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLRGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480356_HBe_P-B Product feature CHAIN AF480356_HBe_P-B of FT:mat_peptide AF480356_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|AF480357_HBe_P-B Product feature CHAIN AF480357_HBe_P-B of FT:mat_peptide AF480357_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480358_HBe_P-B Product feature CHAIN AF480358_HBe_P-B of FT:mat_peptide AF480358_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGG
>gnl|hbvpro|AF480359_HBe_P-B Product feature CHAIN AF480359_HBe_P-B of FT:mat_peptide AF480359_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480360_HBe_P-B Product feature CHAIN AF480360_HBe_P-B of FT:mat_peptide AF480360_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480361_HBe_P-B Product feature CHAIN AF480361_HBe_P-B of FT:mat_peptide AF480361_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQDILCWCELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480362_HBe_P-B Product feature CHAIN AF480362_HBe_P-B of FT:mat_peptide AF480362_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480363_HBe_P-B Product feature CHAIN AF480363_HBe_P-B of FT:mat_peptide AF480363_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AF480364_HBe_P-B Product feature CHAIN AF480364_HBe_P-B of FT:mat_peptide AF480364_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 414-32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYIEFRASGELLSFLPSDFFPSIRDLLDTASALYREALQSPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AJ298864_HBe_P-B Product feature CHAIN AJ298864_HBe_P-B of FT:mat_peptide AJ298864_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPATTVVR
RRGR
>gnl|hbvpro|AM888201_HBe_P-B Product feature CHAIN AM888201_HBe_P-B of FT:mat_peptide AM888201_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BM1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGPSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPVYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AP011084_HBe_P-B Product feature CHAIN AP011084_HBe_P-B of FT:mat_peptide AP011084_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AP011085_HBe_P-B Product feature CHAIN AP011085_HBe_P-B of FT:mat_peptide AP011085_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AP011086_HBe_P-B Product feature CHAIN AP011086_HBe_P-B of FT:mat_peptide AP011086_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AP011087_HBe_P-B Product feature CHAIN AP011087_HBe_P-B of FT:mat_peptide AP011087_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AP011088_HBe_P-B Product feature CHAIN AP011088_HBe_P-B of FT:mat_peptide AP011088_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
RRGR
>gnl|hbvpro|AP011089_HBe_P-B Product feature CHAIN AP011089_HBe_P-B of FT:mat_peptide AP011089_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AP011090_HBe_P-B Product feature CHAIN AP011090_HBe_P-B of FT:mat_peptide AP011090_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AP011091_HBe_P-B Product feature CHAIN AP011091_HBe_P-B of FT:mat_peptide AP011091_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AP011092_HBe_P-B Product feature CHAIN AP011092_HBe_P-B of FT:mat_peptide AP011092_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AP011095_HBe_P-B Product feature CHAIN AP011095_HBe_P-B of FT:mat_peptide AP011095_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AP011096_HBe_P-B Product feature CHAIN AP011096_HBe_P-B of FT:mat_peptide AP011096_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY033072_HBe_P-B Product feature CHAIN AY033072_HBe_P-B of FT:mat_peptide AY033072_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY033073_HBe_P-B Product feature CHAIN AY033073_HBe_P-B of FT:mat_peptide AY033073_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY167089_HBe_P-B Product feature CHAIN AY167089_HBe_P-B of FT:mat_peptide AY167089_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY167098_HBe_P-B Product feature CHAIN AY167098_HBe_P-B of FT:mat_peptide AY167098_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate IVa). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRELLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNAGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVR
RRCR
>gnl|hbvpro|AY217359_HBe_P-B Product feature CHAIN AY217359_HBe_P-B of FT:mat_peptide AY217359_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Q6-5). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY217360_HBe_P-B Product feature CHAIN AY217360_HBe_P-B of FT:mat_peptide AY217360_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6-4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY220698_HBe_P-B Product feature CHAIN AY220698_HBe_P-B of FT:mat_peptide AY220698_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY220703_HBe_P-B Product feature CHAIN AY220703_HBe_P-B of FT:mat_peptide AY220703_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY220704_HBe_P-B Product feature CHAIN AY220704_HBe_P-B of FT:mat_peptide AY220704_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269091_HBe_P-B Product feature CHAIN AY269091_HBe_P-B of FT:mat_peptide AY269091_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269093_HBe_P-B Product feature CHAIN AY269093_HBe_P-B of FT:mat_peptide AY269093_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269095_HBe_P-B Product feature CHAIN AY269095_HBe_P-B of FT:mat_peptide AY269095_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFSPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269097_HBe_P-B Product feature CHAIN AY269097_HBe_P-B of FT:mat_peptide AY269097_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269100_HBe_P-B Product feature CHAIN AY269100_HBe_P-B of FT:mat_peptide AY269100_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 52). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269102_HBe_P-B Product feature CHAIN AY269102_HBe_P-B of FT:mat_peptide AY269102_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 50). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLAT
WVGSNLEDPASRELVVDYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIR
QRGR
>gnl|hbvpro|AY269105_HBe_P-B Product feature CHAIN AY269105_HBe_P-B of FT:mat_peptide AY269105_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 47). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPSNAPILSTLPETAVVR
CRGR
>gnl|hbvpro|AY269108_HBe_P-B Product feature CHAIN AY269108_HBe_P-B of FT:mat_peptide AY269108_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRELLDTASAQYREALESPEHCSPHHTALRQAILCWVELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|AY269109_HBe_P-B Product feature CHAIN AY269109_HBe_P-B of FT:mat_peptide AY269109_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFRASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269110_HBe_P-B Product feature CHAIN AY269110_HBe_P-B of FT:mat_peptide AY269110_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269115_HBe_P-B Product feature CHAIN AY269115_HBe_P-B of FT:mat_peptide AY269115_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269120_HBe_P-B Product feature CHAIN AY269120_HBe_P-B of FT:mat_peptide AY269120_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269128_HBe_P-B Product feature CHAIN AY269128_HBe_P-B of FT:mat_peptide AY269128_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPSSRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPENTVVR
QRGR
>gnl|hbvpro|AY269131_HBe_P-B Product feature CHAIN AY269131_HBe_P-B of FT:mat_peptide AY269131_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY269135_HBe_P-B Product feature CHAIN AY269135_HBe_P-B of FT:mat_peptide AY269135_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate mutant 25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY293309_HBe_P-B Product feature CHAIN AY293309_HBe_P-B of FT:mat_peptide AY293309_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY382514_HBe_P-B Product feature CHAIN AY382514_HBe_P-B of FT:mat_peptide AY382514_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Vu57). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=163 residues).
SKLCLGWLWGMAIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRELVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRG
>gnl|hbvpro|AY518556_HBe_P-B Product feature CHAIN AY518556_HBe_P-B of FT:mat_peptide AY518556_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 57-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY596102_HBe_P-B Product feature CHAIN AY596102_HBe_P-B of FT:mat_peptide AY596102_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY596110_HBe_P-B Product feature CHAIN AY596110_HBe_P-B of FT:mat_peptide AY596110_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate II-2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|AY596111_HBe_P-B Product feature CHAIN AY596111_HBe_P-B of FT:mat_peptide AY596111_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Ia-3). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSSHHTALRQAIVCWGELMNLAT
WVGSNLDDPASRELVVGYVNVNMGLKFRQILWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVIR
QRGR
>gnl|hbvpro|AY766463_HBe_P-B Product feature CHAIN AY766463_HBe_P-B of FT:mat_peptide AY766463_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|D00329_HBe_P-B Product feature CHAIN D00329_HBe_P-B of FT:mat_peptide D00329_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALKSPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLWWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|D00330_HBe_P-B Product feature CHAIN D00330_HBe_P-B of FT:mat_peptide D00330_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|D00331_HBe_C-B Product feature CHAIN D00331_HBe_C-B of FT:mat_peptide D00331_HBe_C-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ144550_HBe_P-B Product feature CHAIN DQ144550_HBe_P-B of FT:mat_peptide DQ144550_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq1-21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFSPSIRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ144560_HBe_P-B Product feature CHAIN DQ144560_HBe_P-B of FT:mat_peptide DQ144560_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ144561_HBe_P-B Product feature CHAIN DQ144561_HBe_P-B of FT:mat_peptide DQ144561_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-E2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
RVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ144564_HBe_P-B Product feature CHAIN DQ144564_HBe_P-B of FT:mat_peptide DQ144564_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq2-24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLEIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ144594_HBe_P-B Product feature CHAIN DQ144594_HBe_P-B of FT:mat_peptide DQ144594_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLEIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ144597_HBe_P-B Product feature CHAIN DQ144597_HBe_P-B of FT:mat_peptide DQ144597_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-C3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ144598_HBe_P-B Product feature CHAIN DQ144598_HBe_P-B of FT:mat_peptide DQ144598_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-D7). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
RVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ144599_HBe_P-B Product feature CHAIN DQ144599_HBe_P-B of FT:mat_peptide DQ144599_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Cq5-7). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ361535_HBe_P-B Product feature CHAIN DQ361535_HBe_P-B of FT:mat_peptide DQ361535_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CRP-228). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ448619_HBe_P-B Product feature CHAIN DQ448619_HBe_P-B of FT:mat_peptide DQ448619_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYH). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ448620_HBe_P-B Product feature CHAIN DQ448620_HBe_P-B of FT:mat_peptide DQ448620_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-DYF). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ448621_HBe_P-B Product feature CHAIN DQ448621_HBe_P-B of FT:mat_peptide DQ448621_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-HQY). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ448622_HBe_P-B Product feature CHAIN DQ448622_HBe_P-B of FT:mat_peptide DQ448622_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-JSM). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ448623_HBe_P-B Product feature CHAIN DQ448623_HBe_P-B of FT:mat_peptide DQ448623_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-LMX). Complete genome. [Hepadnaviridae] (length=164 residues).
CKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ448624_HBe_P-B Product feature CHAIN DQ448624_HBe_P-B of FT:mat_peptide DQ448624_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-QSA). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ448625_HBe_P-B Product feature CHAIN DQ448625_HBe_P-B of FT:mat_peptide DQ448625_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-TXB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ448626_HBe_P-B Product feature CHAIN DQ448626_HBe_P-B of FT:mat_peptide DQ448626_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-XLB). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPSSRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ448627_HBe_P-B Product feature CHAIN DQ448627_HBe_P-B of FT:mat_peptide DQ448627_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZFL). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ448628_HBe_P-B Product feature CHAIN DQ448628_HBe_P-B of FT:mat_peptide DQ448628_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate GZ-ZX). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ904357_HBe_P-B Product feature CHAIN DQ904357_HBe_P-B of FT:mat_peptide DQ904357_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETCVVR
RRGR
>gnl|hbvpro|DQ975271_HBe_P-B Product feature CHAIN DQ975271_HBe_P-B of FT:mat_peptide DQ975271_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993687_HBe_P-B Product feature CHAIN DQ993687_HBe_P-B of FT:mat_peptide DQ993687_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 700). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGSSAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVRYVNVNMGLKLTQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|DQ993694_HBe_P-B Product feature CHAIN DQ993694_HBe_P-B of FT:mat_peptide DQ993694_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 234). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993696_HBe_P-B Product feature CHAIN DQ993696_HBe_P-B of FT:mat_peptide DQ993696_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 452b1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993697_HBe_P-B Product feature CHAIN DQ993697_HBe_P-B of FT:mat_peptide DQ993697_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient 940b1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993700_HBe_P-B Product feature CHAIN DQ993700_HBe_P-B of FT:mat_peptide DQ993700_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0725-ETC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993701_HBe_P-B Product feature CHAIN DQ993701_HBe_P-B of FT:mat_peptide DQ993701_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate JMY-0210-ETCvs3TC-Brack). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993703_HBe_P-B Product feature CHAIN DQ993703_HBe_P-B of FT:mat_peptide DQ993703_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 236-0526-Nature1.2-Sero). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993706_HBe_P-B Product feature CHAIN DQ993706_HBe_P-B of FT:mat_peptide DQ993706_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-0402-Nature3.3-unSero). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993707_HBe_P-B Product feature CHAIN DQ993707_HBe_P-B of FT:mat_peptide DQ993707_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 239-O218-Nature3.2-unSero). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALEAPEHCSPHHTALRQALLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993708_HBe_P-B Product feature CHAIN DQ993708_HBe_P-B of FT:mat_peptide DQ993708_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-1228-Naive). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIPDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993709_HBe_P-B Product feature CHAIN DQ993709_HBe_P-B of FT:mat_peptide DQ993709_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 6136-0127-ETCvs3TC-Break). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ993711_HBe_P-B Product feature CHAIN DQ993711_HBe_P-B of FT:mat_peptide DQ993711_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 221-1120-Nature1.1-unSero). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|DQ995801_HBe_P-B Product feature CHAIN DQ995801_HBe_P-B of FT:mat_peptide DQ995801_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate H60-6). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF134945_HBe_P-B Product feature CHAIN EF134945_HBe_P-B of FT:mat_peptide EF134945_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B3). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF134946_HBe_P-B Product feature CHAIN EF134946_HBe_P-B of FT:mat_peptide EF134946_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate G247-B5). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF473972_HBe_P-B Product feature CHAIN EF473972_HBe_P-B of FT:mat_peptide EF473972_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1839Java). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF473973_HBe_P-B Product feature CHAIN EF473973_HBe_P-B of FT:mat_peptide EF473973_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH45AChinese). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDSFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILGWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF473974_HBe_P-B Product feature CHAIN EF473974_HBe_P-B of FT:mat_peptide EF473974_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIH21AChinese). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLHTASALNREALESPEHCSPHHTALRQAILGWGELMNLAT
WVGRNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGEWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF473975_HBe_P-B Product feature CHAIN EF473975_HBe_P-B of FT:mat_peptide EF473975_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2061Chinese). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF473976_HBe_P-B Product feature CHAIN EF473976_HBe_P-B of FT:mat_peptide EF473976_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Alr049East). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF473977_HBe_P-B Product feature CHAIN EF473977_HBe_P-B of FT:mat_peptide EF473977_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KD048East). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRIPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF494380_HBe_P-B Product feature CHAIN EF494380_HBe_P-B of FT:mat_peptide EF494380_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW836). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLAT
WVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF494381_HBe_P-B Product feature CHAIN EF494381_HBe_P-B of FT:mat_peptide EF494381_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TW936). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
WVGGNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EF494382_HBe_P-B Product feature CHAIN EF494382_HBe_P-B of FT:mat_peptide EF494382_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate TWD347). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPNIRDLLDTANALYREALESPEHCSAHHTALRQAIVCWGELMNLAT
WVGGNLEDPGSRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
QRGR
>gnl|hbvpro|EU139543_HBe_P-B Product feature CHAIN EU139543_HBe_P-B of FT:mat_peptide EU139543_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU305547_HBe_P-B Product feature CHAIN EU305547_HBe_P-B of FT:mat_peptide EU305547_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-481). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU305548_HBe_P-B Product feature CHAIN EU305548_HBe_P-B of FT:mat_peptide EU305548_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M118-673). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306677_HBe_P-B Product feature CHAIN EU306677_HBe_P-B of FT:mat_peptide EU306677_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVR
RRCR
>gnl|hbvpro|EU306695_HBe_P-B Product feature CHAIN EU306695_HBe_P-B of FT:mat_peptide EU306695_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306696_HBe_P-B Product feature CHAIN EU306696_HBe_P-B of FT:mat_peptide EU306696_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPAPRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306697_HBe_P-B Product feature CHAIN EU306697_HBe_P-B of FT:mat_peptide EU306697_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306698_HBe_P-B Product feature CHAIN EU306698_HBe_P-B of FT:mat_peptide EU306698_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306699_HBe_P-B Product feature CHAIN EU306699_HBe_P-B of FT:mat_peptide EU306699_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDFLDTASALYREALESPEHCSPHHTALRQAILCWGVLMNLAT
WVGSNLENPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306700_HBe_P-B Product feature CHAIN EU306700_HBe_P-B of FT:mat_peptide EU306700_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306701_HBe_P-B Product feature CHAIN EU306701_HBe_P-B of FT:mat_peptide EU306701_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306702_HBe_P-B Product feature CHAIN EU306702_HBe_P-B of FT:mat_peptide EU306702_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306703_HBe_P-B Product feature CHAIN EU306703_HBe_P-B of FT:mat_peptide EU306703_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYGNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306704_HBe_P-B Product feature CHAIN EU306704_HBe_P-B of FT:mat_peptide EU306704_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306705_HBe_P-B Product feature CHAIN EU306705_HBe_P-B of FT:mat_peptide EU306705_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306706_HBe_P-B Product feature CHAIN EU306706_HBe_P-B of FT:mat_peptide EU306706_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306707_HBe_P-B Product feature CHAIN EU306707_HBe_P-B of FT:mat_peptide EU306707_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306708_HBe_P-B Product feature CHAIN EU306708_HBe_P-B of FT:mat_peptide EU306708_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306709_HBe_P-B Product feature CHAIN EU306709_HBe_P-B of FT:mat_peptide EU306709_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQPLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306710_HBe_P-B Product feature CHAIN EU306710_HBe_P-B of FT:mat_peptide EU306710_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU306712_HBe_P-B Product feature CHAIN EU306712_HBe_P-B of FT:mat_peptide EU306712_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTTSALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU330989_HBe_P-B Product feature CHAIN EU330989_HBe_P-B of FT:mat_peptide EU330989_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-74). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU330990_HBe_P-B Product feature CHAIN EU330990_HBe_P-B of FT:mat_peptide EU330990_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M84-146). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU330992_HBe_P-B Product feature CHAIN EU330992_HBe_P-B of FT:mat_peptide EU330992_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-6). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU330994_HBe_P-B Product feature CHAIN EU330994_HBe_P-B of FT:mat_peptide EU330994_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU330996_HBe_P-B Product feature CHAIN EU330996_HBe_P-B of FT:mat_peptide EU330996_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-81). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKISQLLWFHISCLTFGRETVLEYLVSFGVRIRTTPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU330997_HBe_P-B Product feature CHAIN EU330997_HBe_P-B of FT:mat_peptide EU330997_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-216). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLRGMDIDPYKGFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU330998_HBe_P-B Product feature CHAIN EU330998_HBe_P-B of FT:mat_peptide EU330998_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1043). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU330999_HBe_P-B Product feature CHAIN EU330999_HBe_P-B of FT:mat_peptide EU330999_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1044). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU331000_HBe_P-B Product feature CHAIN EU331000_HBe_P-B of FT:mat_peptide EU331000_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1045). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU331001_HBe_P-B Product feature CHAIN EU331001_HBe_P-B of FT:mat_peptide EU331001_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M85-1046). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU350409_HBe_P-B Product feature CHAIN EU350409_HBe_P-B of FT:mat_peptide EU350409_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate BTO5856). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU439018_HBe_P-B Product feature CHAIN EU439018_HBe_P-B of FT:mat_peptide EU439018_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU439020_HBe_P-B Product feature CHAIN EU439020_HBe_P-B of FT:mat_peptide EU439020_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVEVLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU439021_HBe_P-B Product feature CHAIN EU439021_HBe_P-B of FT:mat_peptide EU439021_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU439022_HBe_P-B Product feature CHAIN EU439022_HBe_P-B of FT:mat_peptide EU439022_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU439023_HBe_P-B Product feature CHAIN EU439023_HBe_P-B of FT:mat_peptide EU439023_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLRLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU487256_HBe_P-B Product feature CHAIN EU487256_HBe_P-B of FT:mat_peptide EU487256_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAMLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU570069_HBe_P-B Product feature CHAIN EU570069_HBe_P-B of FT:mat_peptide EU570069_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1-B24). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVG
RRGR
>gnl|hbvpro|EU570070_HBe_P-B Product feature CHAIN EU570070_HBe_P-B of FT:mat_peptide EU570070_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2-B24). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPAPRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU570071_HBe_P-B Product feature CHAIN EU570071_HBe_P-B of FT:mat_peptide EU570071_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 4-B24). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU660224_HBe_P-B Product feature CHAIN EU660224_HBe_P-B of FT:mat_peptide EU660224_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate HBV-12N). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU796066_HBe_P-B Product feature CHAIN EU796066_HBe_P-B of FT:mat_peptide EU796066_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU796067_HBe_P-B Product feature CHAIN EU796067_HBe_P-B of FT:mat_peptide EU796067_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU796068_HBe_P-B Product feature CHAIN EU796068_HBe_P-B of FT:mat_peptide EU796068_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU796071_HBe_P-B Product feature CHAIN EU796071_HBe_P-B of FT:mat_peptide EU796071_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU881998_HBe_P-B Product feature CHAIN EU881998_HBe_P-B of FT:mat_peptide EU881998_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient18). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU882004_HBe_P-B Product feature CHAIN EU882004_HBe_P-B of FT:mat_peptide EU882004_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient21). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU919171_HBe_P-B Product feature CHAIN EU919171_HBe_P-B of FT:mat_peptide EU919171_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate patient29). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPDHVSAHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|EU939559_HBe_P-B Product feature CHAIN EU939559_HBe_P-B of FT:mat_peptide EU939559_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C67). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|EU939633_HBe_P-B Product feature CHAIN EU939633_HBe_P-B of FT:mat_peptide EU939633_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C181). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNAGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTIVR
RRGR
>gnl|hbvpro|EU939634_HBe_P-B Product feature CHAIN EU939634_HBe_P-B of FT:mat_peptide EU939634_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C19). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNAGLKIRQLLWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTIVR
RRGR
>gnl|hbvpro|EU939639_HBe_P-B Product feature CHAIN EU939639_HBe_P-B of FT:mat_peptide EU939639_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPSAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU939666_HBe_P-B Product feature CHAIN EU939666_HBe_P-B of FT:mat_peptide EU939666_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C150). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU939669_HBe_P-B Product feature CHAIN EU939669_HBe_P-B of FT:mat_peptide EU939669_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|EU939676_HBe_P-B Product feature CHAIN EU939676_HBe_P-B of FT:mat_peptide EU939676_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate D54). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023569_HBe_P-B Product feature CHAIN FJ023569_HBe_P-B of FT:mat_peptide FJ023569_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0081). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023573_HBe_P-B Product feature CHAIN FJ023573_HBe_P-B of FT:mat_peptide FJ023573_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0469). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSLLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023575_HBe_P-B Product feature CHAIN FJ023575_HBe_P-B of FT:mat_peptide FJ023575_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-0990). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
WVGGNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023576_HBe_P-B Product feature CHAIN FJ023576_HBe_P-B of FT:mat_peptide FJ023576_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-1046). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023605_HBe_P-B Product feature CHAIN FJ023605_HBe_P-B of FT:mat_peptide FJ023605_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023606_HBe_P-B Product feature CHAIN FJ023606_HBe_P-B of FT:mat_peptide FJ023606_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|FJ023607_HBe_P-B Product feature CHAIN FJ023607_HBe_P-B of FT:mat_peptide FJ023607_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023608_HBe_P-B Product feature CHAIN FJ023608_HBe_P-B of FT:mat_peptide FJ023608_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETGLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023609_HBe_P-B Product feature CHAIN FJ023609_HBe_P-B of FT:mat_peptide FJ023609_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023610_HBe_P-B Product feature CHAIN FJ023610_HBe_P-B of FT:mat_peptide FJ023610_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASGDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023611_HBe_P-B Product feature CHAIN FJ023611_HBe_P-B of FT:mat_peptide FJ023611_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023612_HBe_P-B Product feature CHAIN FJ023612_HBe_P-B of FT:mat_peptide FJ023612_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023613_HBe_P-B Product feature CHAIN FJ023613_HBe_P-B of FT:mat_peptide FJ023613_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023614_HBe_P-B Product feature CHAIN FJ023614_HBe_P-B of FT:mat_peptide FJ023614_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3692). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023617_HBe_P-B Product feature CHAIN FJ023617_HBe_P-B of FT:mat_peptide FJ023617_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023618_HBe_P-B Product feature CHAIN FJ023618_HBe_P-B of FT:mat_peptide FJ023618_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023620_HBe_P-B Product feature CHAIN FJ023620_HBe_P-B of FT:mat_peptide FJ023620_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3718). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTIPETTVVR
RRGR
>gnl|hbvpro|FJ023626_HBe_P-B Product feature CHAIN FJ023626_HBe_P-B of FT:mat_peptide FJ023626_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3733). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023627_HBe_P-B Product feature CHAIN FJ023627_HBe_P-B of FT:mat_peptide FJ023627_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRAPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023628_HBe_P-B Product feature CHAIN FJ023628_HBe_P-B of FT:mat_peptide FJ023628_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLASFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023629_HBe_P-B Product feature CHAIN FJ023629_HBe_P-B of FT:mat_peptide FJ023629_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023630_HBe_P-B Product feature CHAIN FJ023630_HBe_P-B of FT:mat_peptide FJ023630_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M04-3979). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023633_HBe_P-B Product feature CHAIN FJ023633_HBe_P-B of FT:mat_peptide FJ023633_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-0583). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPLAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023634_HBe_P-B Product feature CHAIN FJ023634_HBe_P-B of FT:mat_peptide FJ023634_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_C04-1358). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023635_HBe_P-B Product feature CHAIN FJ023635_HBe_P-B of FT:mat_peptide FJ023635_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0467). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023636_HBe_P-B Product feature CHAIN FJ023636_HBe_P-B of FT:mat_peptide FJ023636_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B4_M04-0876). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023637_HBe_P-B Product feature CHAIN FJ023637_HBe_P-B of FT:mat_peptide FJ023637_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0013). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ023638_HBe_P-B Product feature CHAIN FJ023638_HBe_P-B of FT:mat_peptide FJ023638_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate B5_M04-0465). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ032349_HBe_P-B Product feature CHAIN FJ032349_HBe_P-B of FT:mat_peptide FJ032349_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ032352_HBe_P-B Product feature CHAIN FJ032352_HBe_P-B of FT:mat_peptide FJ032352_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-3). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFLPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ032353_HBe_P-B Product feature CHAIN FJ032353_HBe_P-B of FT:mat_peptide FJ032353_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLGDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ032354_HBe_P-B Product feature CHAIN FJ032354_HBe_P-B of FT:mat_peptide FJ032354_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1026-7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ032357_HBe_P-B Product feature CHAIN FJ032357_HBe_P-B of FT:mat_peptide FJ032357_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ032358_HBe_P-B Product feature CHAIN FJ032358_HBe_P-B of FT:mat_peptide FJ032358_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1607-10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEGPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ349236_HBe_P-B Product feature CHAIN FJ349236_HBe_P-B of FT:mat_peptide FJ349236_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386582_HBe_P-B Product feature CHAIN FJ386582_HBe_P-B of FT:mat_peptide FJ386582_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1765). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386583_HBe_P-B Product feature CHAIN FJ386583_HBe_P-B of FT:mat_peptide FJ386583_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1780). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386584_HBe_P-B Product feature CHAIN FJ386584_HBe_P-B of FT:mat_peptide FJ386584_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1798). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386600_HBe_P-B Product feature CHAIN FJ386600_HBe_P-B of FT:mat_peptide FJ386600_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1893). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKENGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
QRGR
>gnl|hbvpro|FJ386610_HBe_P-B Product feature CHAIN FJ386610_HBe_P-B of FT:mat_peptide FJ386610_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2000). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386636_HBe_P-B Product feature CHAIN FJ386636_HBe_P-B of FT:mat_peptide FJ386636_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1813). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386642_HBe_P-B Product feature CHAIN FJ386642_HBe_P-B of FT:mat_peptide FJ386642_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 1829). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386648_HBe_P-B Product feature CHAIN FJ386648_HBe_P-B of FT:mat_peptide FJ386648_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 2419). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPVHCTPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVR
PRGR
>gnl|hbvpro|FJ386654_HBe_P-B Product feature CHAIN FJ386654_HBe_P-B of FT:mat_peptide FJ386654_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S51). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386655_HBe_P-B Product feature CHAIN FJ386655_HBe_P-B of FT:mat_peptide FJ386655_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S121). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386660_HBe_P-B Product feature CHAIN FJ386660_HBe_P-B of FT:mat_peptide FJ386660_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S221). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDQASRDLVVSYVNVNMGIKIRQLLWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
QRRR
>gnl|hbvpro|FJ386666_HBe_P-B Product feature CHAIN FJ386666_HBe_P-B of FT:mat_peptide FJ386666_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S367). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386668_HBe_P-B Product feature CHAIN FJ386668_HBe_P-B of FT:mat_peptide FJ386668_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S395). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386675_HBe_P-B Product feature CHAIN FJ386675_HBe_P-B of FT:mat_peptide FJ386675_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S734). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386676_HBe_P-B Product feature CHAIN FJ386676_HBe_P-B of FT:mat_peptide FJ386676_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1055). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|FJ386684_HBe_P-B Product feature CHAIN FJ386684_HBe_P-B of FT:mat_peptide FJ386684_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1554). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ386688_HBe_P-B Product feature CHAIN FJ386688_HBe_P-B of FT:mat_peptide FJ386688_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S1632). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVR
RRCR
>gnl|hbvpro|FJ518812_HBe_P-B Product feature CHAIN FJ518812_HBe_P-B of FT:mat_peptide FJ518812_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ562224_HBe_P-B Product feature CHAIN FJ562224_HBe_P-B of FT:mat_peptide FJ562224_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|FJ562253_HBe_P-B Product feature CHAIN FJ562253_HBe_P-B of FT:mat_peptide FJ562253_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I86). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ562257_HBe_P-B Product feature CHAIN FJ562257_HBe_P-B of FT:mat_peptide FJ562257_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I96). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRCR
>gnl|hbvpro|FJ562289_HBe_P-B Product feature CHAIN FJ562289_HBe_P-B of FT:mat_peptide FJ562289_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I160). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ562296_HBe_P-B Product feature CHAIN FJ562296_HBe_P-B of FT:mat_peptide FJ562296_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I171). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLXGMDIDPYKEFGASXELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQILWFHISCLSFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIR
GRCR
>gnl|hbvpro|FJ562311_HBe_P-B Product feature CHAIN FJ562311_HBe_P-B of FT:mat_peptide FJ562311_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I202). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLAT
WVGSNLEDQGSRDLVVGYVNVNMGIKLRQLLWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GRRR
>gnl|hbvpro|FJ562322_HBe_P-B Product feature CHAIN FJ562322_HBe_P-B of FT:mat_peptide FJ562322_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate I216). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ667207_HBe_P-B Product feature CHAIN FJ667207_HBe_P-B of FT:mat_peptide FJ667207_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate Mars_RJ_8803658). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ751767_HBe_P-B Product feature CHAIN FJ751767_HBe_P-B of FT:mat_peptide FJ751767_HBe_P-B of [Viruses] Hepatitis B Virus genotype B. Partial genome (Contains: HBe, HBc, HBx, LHBs, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ787444_HBe_P-B Product feature CHAIN FJ787444_HBe_P-B of FT:mat_peptide FJ787444_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate S208-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|FJ899779_HBe_P-B Product feature CHAIN FJ899779_HBe_P-B of FT:mat_peptide FJ899779_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C185-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358136_HBe_P-B Product feature CHAIN GQ358136_HBe_P-B of FT:mat_peptide GQ358136_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate EIHB134). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358137_HBe_P-B Product feature CHAIN GQ358137_HBe_P-B of FT:mat_peptide GQ358137_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY001). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWPWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358138_HBe_P-B Product feature CHAIN GQ358138_HBe_P-B of FT:mat_peptide GQ358138_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY041). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358141_HBe_P-B Product feature CHAIN GQ358141_HBe_P-B of FT:mat_peptide GQ358141_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LBY009). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358142_HBe_P-B Product feature CHAIN GQ358142_HBe_P-B of FT:mat_peptide GQ358142_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate LAR070). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358143_HBe_P-B Product feature CHAIN GQ358143_HBe_P-B of FT:mat_peptide GQ358143_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate CBL027). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVR
RRGR
>gnl|hbvpro|GQ358144_HBe_P-B Product feature CHAIN GQ358144_HBe_P-B of FT:mat_peptide GQ358144_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRKAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358145_HBe_P-B Product feature CHAIN GQ358145_HBe_P-B of FT:mat_peptide GQ358145_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI04). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVEVLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WLGSNLKDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358147_HBe_P-B Product feature CHAIN GQ358147_HBe_P-B of FT:mat_peptide GQ358147_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KDI43). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWIWGMDIDPYKEFGASVEVLSFLPSDSFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WLGSNLKDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358148_HBe_P-B Product feature CHAIN GQ358148_HBe_P-B of FT:mat_peptide GQ358148_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate ALO36). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASKELVVSYVNVNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358149_HBe_P-B Product feature CHAIN GQ358149_HBe_P-B of FT:mat_peptide GQ358149_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN001). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358150_HBe_P-B Product feature CHAIN GQ358150_HBe_P-B of FT:mat_peptide GQ358150_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN009). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358151_HBe_P-B Product feature CHAIN GQ358151_HBe_P-B of FT:mat_peptide GQ358151_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN011). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ358152_HBe_P-B Product feature CHAIN GQ358152_HBe_P-B of FT:mat_peptide GQ358152_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate PAN037). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377519_HBe_P-B Product feature CHAIN GQ377519_HBe_P-B of FT:mat_peptide GQ377519_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J16). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377525_HBe_P-B Product feature CHAIN GQ377525_HBe_P-B of FT:mat_peptide GQ377525_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J24). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377537_HBe_P-B Product feature CHAIN GQ377537_HBe_P-B of FT:mat_peptide GQ377537_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J48). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377542_HBe_P-B Product feature CHAIN GQ377542_HBe_P-B of FT:mat_peptide GQ377542_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J61). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377558_HBe_P-B Product feature CHAIN GQ377558_HBe_P-B of FT:mat_peptide GQ377558_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J89). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377561_HBe_P-B Product feature CHAIN GQ377561_HBe_P-B of FT:mat_peptide GQ377561_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J96). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377566_HBe_P-B Product feature CHAIN GQ377566_HBe_P-B of FT:mat_peptide GQ377566_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J101). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377568_HBe_P-B Product feature CHAIN GQ377568_HBe_P-B of FT:mat_peptide GQ377568_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J103). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377569_HBe_P-B Product feature CHAIN GQ377569_HBe_P-B of FT:mat_peptide GQ377569_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J105). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377587_HBe_P-B Product feature CHAIN GQ377587_HBe_P-B of FT:mat_peptide GQ377587_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J138). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPANAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377588_HBe_P-B Product feature CHAIN GQ377588_HBe_P-B of FT:mat_peptide GQ377588_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J141). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377612_HBe_P-B Product feature CHAIN GQ377612_HBe_P-B of FT:mat_peptide GQ377612_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J180). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377625_HBe_P-B Product feature CHAIN GQ377625_HBe_P-B of FT:mat_peptide GQ377625_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J222). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377629_HBe_P-B Product feature CHAIN GQ377629_HBe_P-B of FT:mat_peptide GQ377629_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J234). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377638_HBe_P-B Product feature CHAIN GQ377638_HBe_P-B of FT:mat_peptide GQ377638_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J250). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377639_HBe_P-B Product feature CHAIN GQ377639_HBe_P-B of FT:mat_peptide GQ377639_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J251). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377641_HBe_P-B Product feature CHAIN GQ377641_HBe_P-B of FT:mat_peptide GQ377641_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J254). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377643_HBe_P-B Product feature CHAIN GQ377643_HBe_P-B of FT:mat_peptide GQ377643_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J258). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ377644_HBe_P-B Product feature CHAIN GQ377644_HBe_P-B of FT:mat_peptide GQ377644_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate J294). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQCILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
GRRR
>gnl|hbvpro|GQ475340_HBe_P-B Product feature CHAIN GQ475340_HBe_P-B of FT:mat_peptide GQ475340_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate KOR36HCC). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ855522_HBe_P-B Product feature CHAIN GQ855522_HBe_P-B of FT:mat_peptide GQ855522_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 23). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ855526_HBe_P-B Product feature CHAIN GQ855526_HBe_P-B of FT:mat_peptide GQ855526_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 103). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWVELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ855532_HBe_P-B Product feature CHAIN GQ855532_HBe_P-B of FT:mat_peptide GQ855532_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate migrant 210). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924603_HBe_P-B Product feature CHAIN GQ924603_HBe_P-B of FT:mat_peptide GQ924603_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924605_HBe_P-B Product feature CHAIN GQ924605_HBe_P-B of FT:mat_peptide GQ924605_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEXLVSFGVWIRTXPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924606_HBe_P-B Product feature CHAIN GQ924606_HBe_P-B of FT:mat_peptide GQ924606_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASXLYREALESPEHCSPHHTALRQAIXCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924607_HBe_P-B Product feature CHAIN GQ924607_HBe_P-B of FT:mat_peptide GQ924607_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M13). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924608_HBe_P-B Product feature CHAIN GQ924608_HBe_P-B of FT:mat_peptide GQ924608_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M15). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924610_HBe_P-B Product feature CHAIN GQ924610_HBe_P-B of FT:mat_peptide GQ924610_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M19). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDRYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924611_HBe_P-B Product feature CHAIN GQ924611_HBe_P-B of FT:mat_peptide GQ924611_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M28). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924621_HBe_P-B Product feature CHAIN GQ924621_HBe_P-B of FT:mat_peptide GQ924621_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M39). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924624_HBe_P-B Product feature CHAIN GQ924624_HBe_P-B of FT:mat_peptide GQ924624_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M42). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924627_HBe_P-B Product feature CHAIN GQ924627_HBe_P-B of FT:mat_peptide GQ924627_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M48). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924631_HBe_P-B Product feature CHAIN GQ924631_HBe_P-B of FT:mat_peptide GQ924631_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M53). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924634_HBe_P-B Product feature CHAIN GQ924634_HBe_P-B of FT:mat_peptide GQ924634_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M57). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924635_HBe_P-B Product feature CHAIN GQ924635_HBe_P-B of FT:mat_peptide GQ924635_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M67). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGIKLRQLLWFHISCITFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVIR
QGSR
>gnl|hbvpro|GQ924638_HBe_P-B Product feature CHAIN GQ924638_HBe_P-B of FT:mat_peptide GQ924638_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M70). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRESVVSYVNVNMGLKLRQILWFHLSCLTFGREVVLEYLVSFGVWIRTPSAYRPQNAPILSTLPETTVVR
GRGR
>gnl|hbvpro|GQ924640_HBe_P-B Product feature CHAIN GQ924640_HBe_P-B of FT:mat_peptide GQ924640_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M72). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924651_HBe_P-B Product feature CHAIN GQ924651_HBe_P-B of FT:mat_peptide GQ924651_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M88). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924653_HBe_P-B Product feature CHAIN GQ924653_HBe_P-B of FT:mat_peptide GQ924653_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M90). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GQ924654_HBe_P-B Product feature CHAIN GQ924654_HBe_P-B of FT:mat_peptide GQ924654_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate M91). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU357842_HBe_P-B Product feature CHAIN GU357842_HBe_P-B of FT:mat_peptide GU357842_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate C4371). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU434372_HBe_P-B Product feature CHAIN GU434372_HBe_P-B of FT:mat_peptide GU434372_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 011-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU434373_HBe_P-B Product feature CHAIN GU434373_HBe_P-B of FT:mat_peptide GU434373_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate 209-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU451682_HBe_P-B Product feature CHAIN GU451682_HBe_P-B of FT:mat_peptide GU451682_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate pLL-EGFP). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815548_HBe_P-B Product feature CHAIN GU815548_HBe_P-B of FT:mat_peptide GU815548_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-1). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815549_HBe_P-B Product feature CHAIN GU815549_HBe_P-B of FT:mat_peptide GU815549_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-2). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815550_HBe_P-B Product feature CHAIN GU815550_HBe_P-B of FT:mat_peptide GU815550_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-3). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815551_HBe_P-B Product feature CHAIN GU815551_HBe_P-B of FT:mat_peptide GU815551_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-4). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815552_HBe_P-B Product feature CHAIN GU815552_HBe_P-B of FT:mat_peptide GU815552_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-5). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMSLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815553_HBe_P-B Product feature CHAIN GU815553_HBe_P-B of FT:mat_peptide GU815553_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-6). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815554_HBe_P-B Product feature CHAIN GU815554_HBe_P-B of FT:mat_peptide GU815554_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-7). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVNYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815555_HBe_P-B Product feature CHAIN GU815555_HBe_P-B of FT:mat_peptide GU815555_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-8). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815556_HBe_P-B Product feature CHAIN GU815556_HBe_P-B of FT:mat_peptide GU815556_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-9). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815557_HBe_P-B Product feature CHAIN GU815557_HBe_P-B of FT:mat_peptide GU815557_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-10). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815558_HBe_P-B Product feature CHAIN GU815558_HBe_P-B of FT:mat_peptide GU815558_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-11). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGVDIDPYKEFGASVELLSFLPSDFFPPIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815559_HBe_P-B Product feature CHAIN GU815559_HBe_P-B of FT:mat_peptide GU815559_HBe_P-B of [Viruses] Hepatitis B Virus genotype B (isolate A1-12). Complete genome. [Hepadnaviridae] (length=164 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
RRGR
>gnl|hbvpro|GU815560_HBe