HBVdb

Dataset for protein HBe of genotype all

[Download (right click)] [Alignment] [Repertoires]

10666 sequence(s)

>gnl|hbvpro|AB014370_HBe_P-A Product feature CHAIN AB014370_HBe_P-A of FT:mat_peptide AB014370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11D11HCC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB064314_HBe_P-A Product feature CHAIN AB064314_HBe_P-A of FT:mat_peptide AB064314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB076678_HBe_P-A Product feature CHAIN AB076678_HBe_P-A of FT:mat_peptide AB076678_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB076679_HBe_P-A Product feature CHAIN AB076679_HBe_P-A of FT:mat_peptide AB076679_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELTTLAT
WVGNNLEDHASRDLVVNYVNDNMGLKLRQLLWFHISCLTFGKQTVLEYLVSFGVW
>gnl|hbvpro|AB116076_HBe_P-A Product feature CHAIN AB116076_HBe_P-A of FT:mat_peptide AB116076_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|AB116077_HBe_P-A Product feature CHAIN AB116077_HBe_P-A of FT:mat_peptide AB116077_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116078_HBe_P-A Product feature CHAIN AB116078_HBe_P-A of FT:mat_peptide AB116078_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYQEALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116079_HBe_P-A Product feature CHAIN AB116079_HBe_P-A of FT:mat_peptide AB116079_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116080_HBe_P-A Product feature CHAIN AB116080_HBe_P-A of FT:mat_peptide AB116080_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116081_HBe_P-A Product feature CHAIN AB116081_HBe_P-A of FT:mat_peptide AB116081_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116082_HBe_P-A Product feature CHAIN AB116082_HBe_P-A of FT:mat_peptide AB116082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116083_HBe_P-A Product feature CHAIN AB116083_HBe_P-A of FT:mat_peptide AB116083_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116084_HBe_P-A Product feature CHAIN AB116084_HBe_P-A of FT:mat_peptide AB116084_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|AB116085_HBe_P-A Product feature CHAIN AB116085_HBe_P-A of FT:mat_peptide AB116085_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116086_HBe_P-A Product feature CHAIN AB116086_HBe_P-A of FT:mat_peptide AB116086_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATADLLSFLPSDFFPSVQDLLDTASALYREALESPVHCSPHHTALRQAILCWGELRTLGT
WVGNNLDDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|AB116087_HBe_P-A Product feature CHAIN AB116087_HBe_P-A of FT:mat_peptide AB116087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSRHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|AB116088_HBe_P-A Product feature CHAIN AB116088_HBe_P-A of FT:mat_peptide AB116088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAIVCWGELMTLGT
WVGNNLEDPESRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116089_HBe_P-A Product feature CHAIN AB116089_HBe_P-A of FT:mat_peptide AB116089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQASLCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|AB116090_HBe_P-A Product feature CHAIN AB116090_HBe_P-A of FT:mat_peptide AB116090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116091_HBe_P-A Product feature CHAIN AB116091_HBe_P-A of FT:mat_peptide AB116091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|AB116092_HBe_P-A Product feature CHAIN AB116092_HBe_P-A of FT:mat_peptide AB116092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVAALFRDALESPEHCSAHHTALRQVILCWGELMTLAT
WVGTNLQDPASRDLVVSYVNDNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116093_HBe_P-A Product feature CHAIN AB116093_HBe_P-A of FT:mat_peptide AB116093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB116094_HBe_P-A Product feature CHAIN AB116094_HBe_P-A of FT:mat_peptide AB116094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB126580_HBe_P-A Product feature CHAIN AB126580_HBe_P-A of FT:mat_peptide AB126580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB194950_HBe_P-A Product feature CHAIN AB194950_HBe_P-A of FT:mat_peptide AB194950_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR983). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB194951_HBe_P-A Product feature CHAIN AB194951_HBe_P-A of FT:mat_peptide AB194951_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR82). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB194952_HBe_P-A Product feature CHAIN AB194952_HBe_P-A of FT:mat_peptide AB194952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMR711). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|AB205118_HBe_P-A Product feature CHAIN AB205118_HBe_P-A of FT:mat_peptide AB205118_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB222707_HBe_P-A Product feature CHAIN AB222707_HBe_P-A of FT:mat_peptide AB222707_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate UZTBV102). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB241114_HBe_P-A Product feature CHAIN AB241114_HBe_P-A of FT:mat_peptide AB241114_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhHCC01). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB241115_HBe_P-A Product feature CHAIN AB241115_HBe_P-A of FT:mat_peptide AB241115_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PhCH09). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB246317_HBe_P-A Product feature CHAIN AB246317_HBe_P-A of FT:mat_peptide AB246317_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TA112). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKVRQLLWFHISCITFGRQTVGEFLVSFGVW
>gnl|hbvpro|AB246335_HBe_P-A Product feature CHAIN AB246335_HBe_P-A of FT:mat_peptide AB246335_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB246336_HBe_P-A Product feature CHAIN AB246336_HBe_P-A of FT:mat_peptide AB246336_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB246337_HBe_P-A Product feature CHAIN AB246337_HBe_P-A of FT:mat_peptide AB246337_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB246338_HBe_P-A Product feature CHAIN AB246338_HBe_P-A of FT:mat_peptide AB246338_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB300366_HBe_P-A Product feature CHAIN AB300366_HBe_P-A of FT:mat_peptide AB300366_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB300367_HBe_P-A Product feature CHAIN AB300367_HBe_P-A of FT:mat_peptide AB300367_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate patient9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB362931_HBe_P-A Product feature CHAIN AB362931_HBe_P-A of FT:mat_peptide AB362931_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB453979_HBe_P-A Product feature CHAIN AB453979_HBe_P-A of FT:mat_peptide AB453979_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB453980_HBe_P-A Product feature CHAIN AB453980_HBe_P-A of FT:mat_peptide AB453980_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB453981_HBe_P-A Product feature CHAIN AB453981_HBe_P-A of FT:mat_peptide AB453981_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB453982_HBe_P-A Product feature CHAIN AB453982_HBe_P-A of FT:mat_peptide AB453982_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELTTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB453984_HBe_P-A Product feature CHAIN AB453984_HBe_P-A of FT:mat_peptide AB453984_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB453986_HBe_P-A Product feature CHAIN AB453986_HBe_P-A of FT:mat_peptide AB453986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLQDQTSRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB453987_HBe_P-A Product feature CHAIN AB453987_HBe_P-A of FT:mat_peptide AB453987_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB453988_HBe_P-A Product feature CHAIN AB453988_HBe_P-A of FT:mat_peptide AB453988_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB453989_HBe_P-A Product feature CHAIN AB453989_HBe_P-A of FT:mat_peptide AB453989_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JPN_CH11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGREIVLEYLVSFGVW
>gnl|hbvpro|AB480034_HBe_P-A Product feature CHAIN AB480034_HBe_P-A of FT:mat_peptide AB480034_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc). [Hepadnaviridae] (length=135 residues).
SKLCLGWPWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHVSPHHTALRQAILCWGDLMTLAT
WVGNNLEDPASRDLVVQYVNTNIGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB480035_HBe_P-A Product feature CHAIN AB480035_HBe_P-A of FT:mat_peptide AB480035_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB480036_HBe_P-A Product feature CHAIN AB480036_HBe_P-A of FT:mat_peptide AB480036_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB480037_HBe_P-A Product feature CHAIN AB480037_HBe_P-A of FT:mat_peptide AB480037_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB480038_HBe_P-A Product feature CHAIN AB480038_HBe_P-A of FT:mat_peptide AB480038_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB480039_HBe_P-A Product feature CHAIN AB480039_HBe_P-A of FT:mat_peptide AB480039_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB480040_HBe_P-A Product feature CHAIN AB480040_HBe_P-A of FT:mat_peptide AB480040_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB480041_HBe_P-A Product feature CHAIN AB480041_HBe_P-A of FT:mat_peptide AB480041_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB480042_HBe_P-A Product feature CHAIN AB480042_HBe_P-A of FT:mat_peptide AB480042_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB549213_HBe_P-A Product feature CHAIN AB549213_HBe_P-A of FT:mat_peptide AB549213_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697488_HBe_P-A Product feature CHAIN AB697488_HBe_P-A of FT:mat_peptide AB697488_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697489_HBe_P-A Product feature CHAIN AB697489_HBe_P-A of FT:mat_peptide AB697489_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697491_HBe_P-A Product feature CHAIN AB697491_HBe_P-A of FT:mat_peptide AB697491_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697492_HBe_P-A Product feature CHAIN AB697492_HBe_P-A of FT:mat_peptide AB697492_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No7). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697493_HBe_P-A Product feature CHAIN AB697493_HBe_P-A of FT:mat_peptide AB697493_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697495_HBe_P-A Product feature CHAIN AB697495_HBe_P-A of FT:mat_peptide AB697495_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697496_HBe_P-A Product feature CHAIN AB697496_HBe_P-A of FT:mat_peptide AB697496_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697497_HBe_P-A Product feature CHAIN AB697497_HBe_P-A of FT:mat_peptide AB697497_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697499_HBe_P-A Product feature CHAIN AB697499_HBe_P-A of FT:mat_peptide AB697499_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697501_HBe_P-A Product feature CHAIN AB697501_HBe_P-A of FT:mat_peptide AB697501_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No19). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697503_HBe_P-A Product feature CHAIN AB697503_HBe_P-A of FT:mat_peptide AB697503_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No22). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697504_HBe_P-A Product feature CHAIN AB697504_HBe_P-A of FT:mat_peptide AB697504_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No23). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697505_HBe_P-A Product feature CHAIN AB697505_HBe_P-A of FT:mat_peptide AB697505_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No25). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697506_HBe_P-A Product feature CHAIN AB697506_HBe_P-A of FT:mat_peptide AB697506_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No28). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697507_HBe_P-A Product feature CHAIN AB697507_HBe_P-A of FT:mat_peptide AB697507_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No29). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697508_HBe_P-A Product feature CHAIN AB697508_HBe_P-A of FT:mat_peptide AB697508_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No31). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697509_HBe_P-A Product feature CHAIN AB697509_HBe_P-A of FT:mat_peptide AB697509_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No32). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697511_HBe_P-A Product feature CHAIN AB697511_HBe_P-A of FT:mat_peptide AB697511_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No36). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB697512_HBe_P-A Product feature CHAIN AB697512_HBe_P-A of FT:mat_peptide AB697512_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate No37). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB775198_HBe_P-A Product feature CHAIN AB775198_HBe_P-A of FT:mat_peptide AB775198_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB775199_HBe_P-A Product feature CHAIN AB775199_HBe_P-A of FT:mat_peptide AB775199_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB775200_HBe_P-A Product feature CHAIN AB775200_HBe_P-A of FT:mat_peptide AB775200_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB775201_HBe_P-A Product feature CHAIN AB775201_HBe_P-A of FT:mat_peptide AB775201_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB937791_HBe_P-A Product feature CHAIN AB937791_HBe_P-A of FT:mat_peptide AB937791_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB05). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB937792_HBe_P-A Product feature CHAIN AB937792_HBe_P-A of FT:mat_peptide AB937792_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB937793_HBe_P-A Product feature CHAIN AB937793_HBe_P-A of FT:mat_peptide AB937793_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB937794_HBe_P-A Product feature CHAIN AB937794_HBe_P-A of FT:mat_peptide AB937794_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB937795_HBe_P-A Product feature CHAIN AB937795_HBe_P-A of FT:mat_peptide AB937795_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB937796_HBe_P-A Product feature CHAIN AB937796_HBe_P-A of FT:mat_peptide AB937796_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB937797_HBe_P-A Product feature CHAIN AB937797_HBe_P-A of FT:mat_peptide AB937797_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVKDLLDTASALYRDALESPEHCSAHHTALRQVSLCWVELMTLAT
WVGNNLQDPASRDQVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB937798_HBe_P-A Product feature CHAIN AB937798_HBe_P-A of FT:mat_peptide AB937798_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF043560_HBe_P-A Product feature CHAIN AF043560_HBe_P-A of FT:mat_peptide AF043560_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF043580_HBe_P-A Product feature CHAIN AF043580_HBe_P-A of FT:mat_peptide AF043580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF090839_HBe_P-A Product feature CHAIN AF090839_HBe_P-A of FT:mat_peptide AF090839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF090840_HBe_P-A Product feature CHAIN AF090840_HBe_P-A of FT:mat_peptide AF090840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF090841_HBe_P-A Product feature CHAIN AF090841_HBe_P-A of FT:mat_peptide AF090841_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF090842_HBe_P-A Product feature CHAIN AF090842_HBe_P-A of FT:mat_peptide AF090842_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF289978_HBe_P-A Product feature CHAIN AF289978_HBe_P-A of FT:mat_peptide AF289978_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BDA10). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=133 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFG
>gnl|hbvpro|AF289980_HBe_P-A Product feature CHAIN AF289980_HBe_P-A of FT:mat_peptide AF289980_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BDA12). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=133 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLGFHISCLTFGRETVLEYLVSFG
>gnl|hbvpro|AF297622_HBe_P-A Product feature CHAIN AF297622_HBe_P-A of FT:mat_peptide AF297622_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 79). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF297623_HBe_P-A Product feature CHAIN AF297623_HBe_P-A of FT:mat_peptide AF297623_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 83). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF297624_HBe_P-A Product feature CHAIN AF297624_HBe_P-A of FT:mat_peptide AF297624_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 80). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF297625_HBe_P-A Product feature CHAIN AF297625_HBe_P-A of FT:mat_peptide AF297625_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 84). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRETILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350080_HBe_P-A Product feature CHAIN AF350080_HBe_P-A of FT:mat_peptide AF350080_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1196). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350081_HBe_P-A Product feature CHAIN AF350081_HBe_P-A of FT:mat_peptide AF350081_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1199). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVPDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350082_HBe_P-A Product feature CHAIN AF350082_HBe_P-A of FT:mat_peptide AF350082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1213). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350083_HBe_P-A Product feature CHAIN AF350083_HBe_P-A of FT:mat_peptide AF350083_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1314F79). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350084_HBe_P-A Product feature CHAIN AF350084_HBe_P-A of FT:mat_peptide AF350084_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1315F80). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350085_HBe_P-A Product feature CHAIN AF350085_HBe_P-A of FT:mat_peptide AF350085_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1316F79). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350086_HBe_P-A Product feature CHAIN AF350086_HBe_P-A of FT:mat_peptide AF350086_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1330F80). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350087_HBe_P-A Product feature CHAIN AF350087_HBe_P-A of FT:mat_peptide AF350087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1486F125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALNREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350088_HBe_P-A Product feature CHAIN AF350088_HBe_P-A of FT:mat_peptide AF350088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1487F125). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350089_HBe_P-A Product feature CHAIN AF350089_HBe_P-A of FT:mat_peptide AF350089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1606). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350090_HBe_P-A Product feature CHAIN AF350090_HBe_P-A of FT:mat_peptide AF350090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1687). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350091_HBe_P-A Product feature CHAIN AF350091_HBe_P-A of FT:mat_peptide AF350091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1730F202). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350092_HBe_P-A Product feature CHAIN AF350092_HBe_P-A of FT:mat_peptide AF350092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1746). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350093_HBe_P-A Product feature CHAIN AF350093_HBe_P-A of FT:mat_peptide AF350093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1747). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350094_HBe_P-A Product feature CHAIN AF350094_HBe_P-A of FT:mat_peptide AF350094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1800). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350095_HBe_P-A Product feature CHAIN AF350095_HBe_P-A of FT:mat_peptide AF350095_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1815F214). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350096_HBe_P-A Product feature CHAIN AF350096_HBe_P-A of FT:mat_peptide AF350096_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1817F214). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350097_HBe_P-A Product feature CHAIN AF350097_HBe_P-A of FT:mat_peptide AF350097_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1835F222). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF350098_HBe_P-A Product feature CHAIN AF350098_HBe_P-A of FT:mat_peptide AF350098_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Gam1841F222). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF419534_HBe_P-A Product feature CHAIN AF419534_HBe_P-A of FT:mat_peptide AF419534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHSSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF419535_HBe_P-A Product feature CHAIN AF419535_HBe_P-A of FT:mat_peptide AF419535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTVSALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTXCITFGRETVLEYLVSFGVW
>gnl|hbvpro|AF419536_HBe_P-A Product feature CHAIN AF419536_HBe_P-A of FT:mat_peptide AF419536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I7). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTVSALYREALESPEHCSPHHTAIRQAILCWGQLMTLAT
WVGNNLQDPASRDLVVNYVNDNMGLMIRQLLWFHSSCITFGRETVLEYLVSFGVW
>gnl|hbvpro|AF536524_HBe_P-A Product feature CHAIN AF536524_HBe_P-A of FT:mat_peptide AF536524_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASTLYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF537371_HBe_P-A Product feature CHAIN AF537371_HBe_P-A of FT:mat_peptide AF537371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF537372_HBe_P-A Product feature CHAIN AF537372_HBe_P-A of FT:mat_peptide AF537372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AJ012207_HBe_P-A Product feature CHAIN AJ012207_HBe_P-A of FT:mat_peptide AJ012207_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AJ309369_HBe_P-A Product feature CHAIN AJ309369_HBe_P-A of FT:mat_peptide AJ309369_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate X104). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AJ309370_HBe_P-A Product feature CHAIN AJ309370_HBe_P-A of FT:mat_peptide AJ309370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate X104). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AJ309371_HBe_P-A Product feature CHAIN AJ309371_HBe_P-A of FT:mat_peptide AJ309371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate X104). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AJ344115_HBe_P-A Product feature CHAIN AJ344115_HBe_P-A of FT:mat_peptide AJ344115_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate X27). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKDTVLEYLVSFGVW
>gnl|hbvpro|AJ627226_HBe_P-A Product feature CHAIN AJ627226_HBe_P-A of FT:mat_peptide AJ627226_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 20952). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPPDFFPSARDLLDTASALFRDALESPEHCSAHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHLSCIMFGRDIVLEYLVSFGVW
>gnl|hbvpro|AJ627228_HBe_P-A Product feature CHAIN AJ627228_HBe_P-A of FT:mat_peptide AJ627228_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 34408). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQCVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVW
>gnl|hbvpro|AM110796_HBe_P-A Product feature CHAIN AM110796_HBe_P-A of FT:mat_peptide AM110796_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAL42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110797_HBe_P-A Product feature CHAIN AM110797_HBe_P-A of FT:mat_peptide AM110797_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAL134). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGDNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRKTVLEYLVSFGVW
>gnl|hbvpro|AM110798_HBe_P-A Product feature CHAIN AM110798_HBe_P-A of FT:mat_peptide AM110798_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NIE24165). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110799_HBe_P-A Product feature CHAIN AM110799_HBe_P-A of FT:mat_peptide AM110799_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NIE24063). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110800_HBe_P-A Product feature CHAIN AM110800_HBe_P-A of FT:mat_peptide AM110800_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NIE24074). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGAXVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110801_HBe_P-A Product feature CHAIN AM110801_HBe_P-A of FT:mat_peptide AM110801_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NIE24094). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110802_HBe_P-A Product feature CHAIN AM110802_HBe_P-A of FT:mat_peptide AM110802_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE85). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110814_HBe_P-A Product feature CHAIN AM110814_HBe_P-A of FT:mat_peptide AM110814_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE151). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHGSPHHTALRQAILCWGDVMTLAT
WVGANLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110829_HBe_P-A Product feature CHAIN AM110829_HBe_P-A of FT:mat_peptide AM110829_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHGSPHHTALRQAILCWGDVMTLAT
WVGANLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110831_HBe_P-A Product feature CHAIN AM110831_HBe_P-A of FT:mat_peptide AM110831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE154). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLSLGWLWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALFREALESPEHGSPHHTALRQAILCWGDVMTLAT
WVGANLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110832_HBe_P-A Product feature CHAIN AM110832_HBe_P-A of FT:mat_peptide AM110832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE182). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110833_HBe_P-A Product feature CHAIN AM110833_HBe_P-A of FT:mat_peptide AM110833_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE193). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110834_HBe_P-A Product feature CHAIN AM110834_HBe_P-A of FT:mat_peptide AM110834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE357). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVDLLSFLPXDFFPSVRDLLETARALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110836_HBe_P-A Product feature CHAIN AM110836_HBe_P-A of FT:mat_peptide AM110836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE364). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110837_HBe_P-A Product feature CHAIN AM110837_HBe_P-A of FT:mat_peptide AM110837_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE343). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110838_HBe_P-A Product feature CHAIN AM110838_HBe_P-A of FT:mat_peptide AM110838_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE375). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLQYLVSFGVW
>gnl|hbvpro|AM110839_HBe_P-A Product feature CHAIN AM110839_HBe_P-A of FT:mat_peptide AM110839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAEch13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVG
>gnl|hbvpro|AM110840_HBe_P-A Product feature CHAIN AM110840_HBe_P-A of FT:mat_peptide AM110840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAEch43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110841_HBe_P-A Product feature CHAIN AM110841_HBe_P-A of FT:mat_peptide AM110841_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAEch44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110842_HBe_P-A Product feature CHAIN AM110842_HBe_P-A of FT:mat_peptide AM110842_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAEch45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110843_HBe_P-A Product feature CHAIN AM110843_HBe_P-A of FT:mat_peptide AM110843_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAEch46). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110844_HBe_P-A Product feature CHAIN AM110844_HBe_P-A of FT:mat_peptide AM110844_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAEch52). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110845_HBe_P-A Product feature CHAIN AM110845_HBe_P-A of FT:mat_peptide AM110845_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAEch55). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM110846_HBe_P-A Product feature CHAIN AM110846_HBe_P-A of FT:mat_peptide AM110846_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAEch62). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM180624_HBe_P-A Product feature CHAIN AM180624_HBe_P-A of FT:mat_peptide AM180624_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAE168). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHGSXHHTAXRQAILCWGXVMTLAT
WVGXNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM184125_HBe_P-A Product feature CHAIN AM184125_HBe_P-A of FT:mat_peptide AM184125_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate O64). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM184126_HBe_P-A Product feature CHAIN AM184126_HBe_P-A of FT:mat_peptide AM184126_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N35). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM282986_HBe_P-A Product feature CHAIN AM282986_HBe_P-A of FT:mat_peptide AM282986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM295795_HBe_P-A Product feature CHAIN AM295795_HBe_P-A of FT:mat_peptide AM295795_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM295796_HBe_P-A Product feature CHAIN AM295796_HBe_P-A of FT:mat_peptide AM295796_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM295797_HBe_P-A Product feature CHAIN AM295797_HBe_P-A of FT:mat_peptide AM295797_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM410963_HBe_P-A Product feature CHAIN AM410963_HBe_P-A of FT:mat_peptide AM410963_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AM494718_HBe_P-A Product feature CHAIN AM494718_HBe_P-A of FT:mat_peptide AM494718_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CAR204). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY034878_HBe_P-A Product feature CHAIN AY034878_HBe_P-A of FT:mat_peptide AY034878_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVKL). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLDDPASKDLVVNYVNTKHGLKIRQLLWVHTSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY128092_HBe_P-A Product feature CHAIN AY128092_HBe_P-A of FT:mat_peptide AY128092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY152726_HBe_P-A Product feature CHAIN AY152726_HBe_P-A of FT:mat_peptide AY152726_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY161138_HBe_P-A Product feature CHAIN AY161138_HBe_P-A of FT:mat_peptide AY161138_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY161139_HBe_P-A Product feature CHAIN AY161139_HBe_P-A of FT:mat_peptide AY161139_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY161142_HBe_P-A Product feature CHAIN AY161142_HBe_P-A of FT:mat_peptide AY161142_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVW
>gnl|hbvpro|AY161143_HBe_P-A Product feature CHAIN AY161143_HBe_P-A of FT:mat_peptide AY161143_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVW
>gnl|hbvpro|AY161144_HBe_P-A Product feature CHAIN AY161144_HBe_P-A of FT:mat_peptide AY161144_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCCGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYVVSFGVW
>gnl|hbvpro|AY233274_HBe_P-A Product feature CHAIN AY233274_HBe_P-A of FT:mat_peptide AY233274_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 0962). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233275_HBe_P-A Product feature CHAIN AY233275_HBe_P-A of FT:mat_peptide AY233275_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 163). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233276_HBe_P-A Product feature CHAIN AY233276_HBe_P-A of FT:mat_peptide AY233276_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1839). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233278_HBe_P-A Product feature CHAIN AY233278_HBe_P-A of FT:mat_peptide AY233278_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233279_HBe_P-A Product feature CHAIN AY233279_HBe_P-A of FT:mat_peptide AY233279_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 28). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAHRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233280_HBe_P-A Product feature CHAIN AY233280_HBe_P-A of FT:mat_peptide AY233280_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233281_HBe_P-A Product feature CHAIN AY233281_HBe_P-A of FT:mat_peptide AY233281_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 303). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233282_HBe_P-A Product feature CHAIN AY233282_HBe_P-A of FT:mat_peptide AY233282_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 306). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233283_HBe_P-A Product feature CHAIN AY233283_HBe_P-A of FT:mat_peptide AY233283_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4038). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233284_HBe_P-A Product feature CHAIN AY233284_HBe_P-A of FT:mat_peptide AY233284_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5283). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233285_HBe_P-A Product feature CHAIN AY233285_HBe_P-A of FT:mat_peptide AY233285_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 795). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAQYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233286_HBe_P-A Product feature CHAIN AY233286_HBe_P-A of FT:mat_peptide AY233286_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233287_HBe_P-A Product feature CHAIN AY233287_HBe_P-A of FT:mat_peptide AY233287_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8225). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMALAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233288_HBe_P-A Product feature CHAIN AY233288_HBe_P-A of FT:mat_peptide AY233288_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233289_HBe_P-A Product feature CHAIN AY233289_HBe_P-A of FT:mat_peptide AY233289_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233290_HBe_P-A Product feature CHAIN AY233290_HBe_P-A of FT:mat_peptide AY233290_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 85). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAS
WVGNNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|AY373428_HBe_P-A Product feature CHAIN AY373428_HBe_P-A of FT:mat_peptide AY373428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY373429_HBe_P-A Product feature CHAIN AY373429_HBe_P-A of FT:mat_peptide AY373429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWSHISCLTFGRETALEYLVSFGVW
>gnl|hbvpro|AY373432_HBe_P-A Product feature CHAIN AY373432_HBe_P-A of FT:mat_peptide AY373432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY382505_HBe_P-A Product feature CHAIN AY382505_HBe_P-A of FT:mat_peptide AY382505_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Vu46). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY382506_HBe_P-A Product feature CHAIN AY382506_HBe_P-A of FT:mat_peptide AY382506_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Vu47). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY382513_HBe_P-A Product feature CHAIN AY382513_HBe_P-A of FT:mat_peptide AY382513_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Vu56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
CNLVPGCLWGMAIDPYKEFGATVELLSFLPSDFLPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY509208_HBe_P-A Product feature CHAIN AY509208_HBe_P-A of FT:mat_peptide AY509208_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEYGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAIVCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY603429_HBe_P-A Product feature CHAIN AY603429_HBe_P-A of FT:mat_peptide AY603429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 15T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY603430_HBe_P-A Product feature CHAIN AY603430_HBe_P-A of FT:mat_peptide AY603430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 19T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY603431_HBe_P-A Product feature CHAIN AY603431_HBe_P-A of FT:mat_peptide AY603431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY603432_HBe_P-A Product feature CHAIN AY603432_HBe_P-A of FT:mat_peptide AY603432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24T). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVLDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY603435_HBe_P-A Product feature CHAIN AY603435_HBe_P-A of FT:mat_peptide AY603435_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 31T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY603436_HBe_P-A Product feature CHAIN AY603436_HBe_P-A of FT:mat_peptide AY603436_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 32T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY603438_HBe_P-A Product feature CHAIN AY603438_HBe_P-A of FT:mat_peptide AY603438_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 36T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY603441_HBe_P-A Product feature CHAIN AY603441_HBe_P-A of FT:mat_peptide AY603441_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 59T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY603446_HBe_P-A Product feature CHAIN AY603446_HBe_P-A of FT:mat_peptide AY603446_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11T). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVW
>gnl|hbvpro|AY707087_HBe_P-A Product feature CHAIN AY707087_HBe_P-A of FT:mat_peptide AY707087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY738139_HBe_P-A Product feature CHAIN AY738139_HBe_P-A of FT:mat_peptide AY738139_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY738140_HBe_P-A Product feature CHAIN AY738140_HBe_P-A of FT:mat_peptide AY738140_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY738141_HBe_P-A Product feature CHAIN AY738141_HBe_P-A of FT:mat_peptide AY738141_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY738142_HBe_P-A Product feature CHAIN AY738142_HBe_P-A of FT:mat_peptide AY738142_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY738143_HBe_P-A Product feature CHAIN AY738143_HBe_P-A of FT:mat_peptide AY738143_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY862867_HBe_P-A Product feature CHAIN AY862867_HBe_P-A of FT:mat_peptide AY862867_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCPGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY862868_HBe_P-A Product feature CHAIN AY862868_HBe_P-A of FT:mat_peptide AY862868_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY902775_HBe_P-A Product feature CHAIN AY902775_HBe_P-A of FT:mat_peptide AY902775_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MTB162). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY903452_HBe_P-A Product feature CHAIN AY903452_HBe_P-A of FT:mat_peptide AY903452_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934763_HBe_P-A Product feature CHAIN AY934763_HBe_P-A of FT:mat_peptide AY934763_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ik3346). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934764_HBe_P-A Product feature CHAIN AY934764_HBe_P-A of FT:mat_peptide AY934764_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9210699). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934765_HBe_P-A Product feature CHAIN AY934765_HBe_P-A of FT:mat_peptide AY934765_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24306). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934766_HBe_P-A Product feature CHAIN AY934766_HBe_P-A of FT:mat_peptide AY934766_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24233). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934767_HBe_P-A Product feature CHAIN AY934767_HBe_P-A of FT:mat_peptide AY934767_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27178). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934768_HBe_P-A Product feature CHAIN AY934768_HBe_P-A of FT:mat_peptide AY934768_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 25830). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934769_HBe_P-A Product feature CHAIN AY934769_HBe_P-A of FT:mat_peptide AY934769_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 23719). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934770_HBe_P-A Product feature CHAIN AY934770_HBe_P-A of FT:mat_peptide AY934770_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953642). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934771_HBe_P-A Product feature CHAIN AY934771_HBe_P-A of FT:mat_peptide AY934771_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 27439). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934772_HBe_P-A Product feature CHAIN AY934772_HBe_P-A of FT:mat_peptide AY934772_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1908). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934773_HBe_P-A Product feature CHAIN AY934773_HBe_P-A of FT:mat_peptide AY934773_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9414346). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY934774_HBe_P-A Product feature CHAIN AY934774_HBe_P-A of FT:mat_peptide AY934774_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 9615549). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ020002_HBe_P-A Product feature CHAIN DQ020002_HBe_P-A of FT:mat_peptide DQ020002_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 380). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ020003_HBe_P-A Product feature CHAIN DQ020003_HBe_P-A of FT:mat_peptide DQ020003_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 5780). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ315784_HBe_P-A Product feature CHAIN DQ315784_HBe_P-A of FT:mat_peptide DQ315784_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI03101). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ315786_HBe_P-A Product feature CHAIN DQ315786_HBe_P-A of FT:mat_peptide DQ315786_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EI057). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ788725_HBe_P-A Product feature CHAIN DQ788725_HBe_P-A of FT:mat_peptide DQ788725_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EF103278_HBe_P-A Product feature CHAIN EF103278_HBe_P-A of FT:mat_peptide EF103278_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ran60). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKQTVLEYLVSFGVW
>gnl|hbvpro|EF208113_HBe_P-A Product feature CHAIN EF208113_HBe_P-A of FT:mat_peptide EF208113_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU054331_HBe_C-A Product feature CHAIN EU054331_HBe_C-A of FT:mat_peptide EU054331_HBe_C-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU086721_HBe_P-A Product feature CHAIN EU086721_HBe_P-A of FT:mat_peptide EU086721_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HRO). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185746_HBe_P-A Product feature CHAIN EU185746_HBe_P-A of FT:mat_peptide EU185746_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185748_HBe_P-A Product feature CHAIN EU185748_HBe_P-A of FT:mat_peptide EU185748_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM11). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185750_HBe_P-A Product feature CHAIN EU185750_HBe_P-A of FT:mat_peptide EU185750_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185765_HBe_P-A Product feature CHAIN EU185765_HBe_P-A of FT:mat_peptide EU185765_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185774_HBe_P-A Product feature CHAIN EU185774_HBe_P-A of FT:mat_peptide EU185774_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLBTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185775_HBe_P-A Product feature CHAIN EU185775_HBe_P-A of FT:mat_peptide EU185775_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|EU185776_HBe_P-A Product feature CHAIN EU185776_HBe_P-A of FT:mat_peptide EU185776_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLXTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPPSRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185777_HBe_P-A Product feature CHAIN EU185777_HBe_P-A of FT:mat_peptide EU185777_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCXGWLWGMDIDPYKEFGATVELLSFLPSDFFPSXRDLLXTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPPSRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185778_HBe_P-A Product feature CHAIN EU185778_HBe_P-A of FT:mat_peptide EU185778_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEBPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185786_HBe_P-A Product feature CHAIN EU185786_HBe_P-A of FT:mat_peptide EU185786_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185787_HBe_P-A Product feature CHAIN EU185787_HBe_P-A of FT:mat_peptide EU185787_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|EU185789_HBe_P-A Product feature CHAIN EU185789_HBe_P-A of FT:mat_peptide EU185789_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|EU234069_HBe_P-A Product feature CHAIN EU234069_HBe_P-A of FT:mat_peptide EU234069_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 117_PL76). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU234071_HBe_P-A Product feature CHAIN EU234071_HBe_P-A of FT:mat_peptide EU234071_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 221_AB25). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWXMDIDPYKEFGATTELLSFLPSDFFPSARDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGSNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU304331_HBe_P-A Product feature CHAIN EU304331_HBe_P-A of FT:mat_peptide EU304331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA84). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRDXVLEYLVSFGVW
>gnl|hbvpro|EU366129_HBe_P-A Product feature CHAIN EU366129_HBe_P-A of FT:mat_peptide EU366129_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA92). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALFREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLXDPASRDLVVNYVNTHMGLKIRQLLWFHXSCICFGRETVLEYLVSFGVW
>gnl|hbvpro|EU410082_HBe_P-A Product feature CHAIN EU410082_HBe_P-A of FT:mat_peptide EU410082_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ph81). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU414048_HBe_P-A Product feature CHAIN EU414048_HBe_P-A of FT:mat_peptide EU414048_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU414049_HBe_P-A Product feature CHAIN EU414049_HBe_P-A of FT:mat_peptide EU414049_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SXLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWXXXXTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVW
>gnl|hbvpro|EU414050_HBe_P-A Product feature CHAIN EU414050_HBe_P-A of FT:mat_peptide EU414050_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLNDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU414052_HBe_P-A Product feature CHAIN EU414052_HBe_P-A of FT:mat_peptide EU414052_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWADVTNLAT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU414133_HBe_P-A Product feature CHAIN EU414133_HBe_P-A of FT:mat_peptide EU414133_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWADVTNLAT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594383_HBe_P-A Product feature CHAIN EU594383_HBe_P-A of FT:mat_peptide EU594383_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594384_HBe_P-A Product feature CHAIN EU594384_HBe_P-A of FT:mat_peptide EU594384_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594385_HBe_P-A Product feature CHAIN EU594385_HBe_P-A of FT:mat_peptide EU594385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594386_HBe_P-A Product feature CHAIN EU594386_HBe_P-A of FT:mat_peptide EU594386_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594387_HBe_P-A Product feature CHAIN EU594387_HBe_P-A of FT:mat_peptide EU594387_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594388_HBe_P-A Product feature CHAIN EU594388_HBe_P-A of FT:mat_peptide EU594388_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594389_HBe_P-A Product feature CHAIN EU594389_HBe_P-A of FT:mat_peptide EU594389_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594390_HBe_P-A Product feature CHAIN EU594390_HBe_P-A of FT:mat_peptide EU594390_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594391_HBe_P-A Product feature CHAIN EU594391_HBe_P-A of FT:mat_peptide EU594391_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594392_HBe_P-A Product feature CHAIN EU594392_HBe_P-A of FT:mat_peptide EU594392_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594393_HBe_P-A Product feature CHAIN EU594393_HBe_P-A of FT:mat_peptide EU594393_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594394_HBe_P-A Product feature CHAIN EU594394_HBe_P-A of FT:mat_peptide EU594394_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594395_HBe_P-A Product feature CHAIN EU594395_HBe_P-A of FT:mat_peptide EU594395_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859898_HBe_P-A Product feature CHAIN EU859898_HBe_P-A of FT:mat_peptide EU859898_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P45). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859899_HBe_P-A Product feature CHAIN EU859899_HBe_P-A of FT:mat_peptide EU859899_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P44). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859900_HBe_P-A Product feature CHAIN EU859900_HBe_P-A of FT:mat_peptide EU859900_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P42). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859901_HBe_P-A Product feature CHAIN EU859901_HBe_P-A of FT:mat_peptide EU859901_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P37). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859902_HBe_P-A Product feature CHAIN EU859902_HBe_P-A of FT:mat_peptide EU859902_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P32). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859903_HBe_P-A Product feature CHAIN EU859903_HBe_P-A of FT:mat_peptide EU859903_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859904_HBe_P-A Product feature CHAIN EU859904_HBe_P-A of FT:mat_peptide EU859904_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P39). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859905_HBe_P-A Product feature CHAIN EU859905_HBe_P-A of FT:mat_peptide EU859905_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P38). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859906_HBe_P-A Product feature CHAIN EU859906_HBe_P-A of FT:mat_peptide EU859906_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859907_HBe_P-A Product feature CHAIN EU859907_HBe_P-A of FT:mat_peptide EU859907_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859908_HBe_P-A Product feature CHAIN EU859908_HBe_P-A of FT:mat_peptide EU859908_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859909_HBe_P-A Product feature CHAIN EU859909_HBe_P-A of FT:mat_peptide EU859909_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P31). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859910_HBe_P-A Product feature CHAIN EU859910_HBe_P-A of FT:mat_peptide EU859910_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859911_HBe_P-A Product feature CHAIN EU859911_HBe_P-A of FT:mat_peptide EU859911_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P26). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859912_HBe_P-A Product feature CHAIN EU859912_HBe_P-A of FT:mat_peptide EU859912_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P23). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859913_HBe_P-A Product feature CHAIN EU859913_HBe_P-A of FT:mat_peptide EU859913_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859914_HBe_P-A Product feature CHAIN EU859914_HBe_P-A of FT:mat_peptide EU859914_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P20). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859915_HBe_P-A Product feature CHAIN EU859915_HBe_P-A of FT:mat_peptide EU859915_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P07). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859916_HBe_P-A Product feature CHAIN EU859916_HBe_P-A of FT:mat_peptide EU859916_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P03). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859917_HBe_P-A Product feature CHAIN EU859917_HBe_P-A of FT:mat_peptide EU859917_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859918_HBe_P-A Product feature CHAIN EU859918_HBe_P-A of FT:mat_peptide EU859918_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P17). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859919_HBe_P-A Product feature CHAIN EU859919_HBe_P-A of FT:mat_peptide EU859919_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVEFLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859920_HBe_P-A Product feature CHAIN EU859920_HBe_P-A of FT:mat_peptide EU859920_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P21). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859921_HBe_P-A Product feature CHAIN EU859921_HBe_P-A of FT:mat_peptide EU859921_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P08). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859922_HBe_P-A Product feature CHAIN EU859922_HBe_P-A of FT:mat_peptide EU859922_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P09). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859923_HBe_P-A Product feature CHAIN EU859923_HBe_P-A of FT:mat_peptide EU859923_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P15). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859924_HBe_P-A Product feature CHAIN EU859924_HBe_P-A of FT:mat_peptide EU859924_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859925_HBe_P-A Product feature CHAIN EU859925_HBe_P-A of FT:mat_peptide EU859925_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P22). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859926_HBe_P-A Product feature CHAIN EU859926_HBe_P-A of FT:mat_peptide EU859926_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P06). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859927_HBe_P-A Product feature CHAIN EU859927_HBe_P-A of FT:mat_peptide EU859927_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P25). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859928_HBe_P-A Product feature CHAIN EU859928_HBe_P-A of FT:mat_peptide EU859928_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P01). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859929_HBe_P-A Product feature CHAIN EU859929_HBe_P-A of FT:mat_peptide EU859929_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P43). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859930_HBe_P-A Product feature CHAIN EU859930_HBe_P-A of FT:mat_peptide EU859930_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C126). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859931_HBe_P-A Product feature CHAIN EU859931_HBe_P-A of FT:mat_peptide EU859931_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C96). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859932_HBe_P-A Product feature CHAIN EU859932_HBe_P-A of FT:mat_peptide EU859932_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C69). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859933_HBe_P-A Product feature CHAIN EU859933_HBe_P-A of FT:mat_peptide EU859933_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C67). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859934_HBe_P-A Product feature CHAIN EU859934_HBe_P-A of FT:mat_peptide EU859934_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C60). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859935_HBe_P-A Product feature CHAIN EU859935_HBe_P-A of FT:mat_peptide EU859935_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859936_HBe_P-A Product feature CHAIN EU859936_HBe_P-A of FT:mat_peptide EU859936_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859937_HBe_P-A Product feature CHAIN EU859937_HBe_P-A of FT:mat_peptide EU859937_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C40). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859939_HBe_P-A Product feature CHAIN EU859939_HBe_P-A of FT:mat_peptide EU859939_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C130). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859940_HBe_P-A Product feature CHAIN EU859940_HBe_P-A of FT:mat_peptide EU859940_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C122). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859941_HBe_P-A Product feature CHAIN EU859941_HBe_P-A of FT:mat_peptide EU859941_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C153). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859942_HBe_P-A Product feature CHAIN EU859942_HBe_P-A of FT:mat_peptide EU859942_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C110). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859943_HBe_P-A Product feature CHAIN EU859943_HBe_P-A of FT:mat_peptide EU859943_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C109). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859944_HBe_P-A Product feature CHAIN EU859944_HBe_P-A of FT:mat_peptide EU859944_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C105). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859945_HBe_P-A Product feature CHAIN EU859945_HBe_P-A of FT:mat_peptide EU859945_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C102). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859946_HBe_P-A Product feature CHAIN EU859946_HBe_P-A of FT:mat_peptide EU859946_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C155). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859947_HBe_P-A Product feature CHAIN EU859947_HBe_P-A of FT:mat_peptide EU859947_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C85). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859948_HBe_P-A Product feature CHAIN EU859948_HBe_P-A of FT:mat_peptide EU859948_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C151). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859949_HBe_P-A Product feature CHAIN EU859949_HBe_P-A of FT:mat_peptide EU859949_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C152). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859950_HBe_P-A Product feature CHAIN EU859950_HBe_P-A of FT:mat_peptide EU859950_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C64). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859951_HBe_P-A Product feature CHAIN EU859951_HBe_P-A of FT:mat_peptide EU859951_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C62). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859952_HBe_P-A Product feature CHAIN EU859952_HBe_P-A of FT:mat_peptide EU859952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C56). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859953_HBe_P-A Product feature CHAIN EU859953_HBe_P-A of FT:mat_peptide EU859953_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C55). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859954_HBe_P-A Product feature CHAIN EU859954_HBe_P-A of FT:mat_peptide EU859954_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C42). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859955_HBe_P-A Product feature CHAIN EU859955_HBe_P-A of FT:mat_peptide EU859955_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C39). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU859956_HBe_P-A Product feature CHAIN EU859956_HBe_P-A of FT:mat_peptide EU859956_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C35). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ349222_HBe_P-A Product feature CHAIN FJ349222_HBe_P-A of FT:mat_peptide FJ349222_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H20). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ349224_HBe_P-A Product feature CHAIN FJ349224_HBe_P-A of FT:mat_peptide FJ349224_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate H71). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ349296_HBe_P-A Product feature CHAIN FJ349296_HBe_P-A of FT:mat_peptide FJ349296_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLNTASALYREALKSPGHCSPHHTALRQAILCWGELMTLAT
WVGNNLENPASRDLVVNYVNTNMGLKIRQLWGFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692554_HBe_P-A Product feature CHAIN FJ692554_HBe_P-A of FT:mat_peptide FJ692554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24063). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692555_HBe_P-A Product feature CHAIN FJ692555_HBe_P-A of FT:mat_peptide FJ692555_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_24074). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASXLYREALESPEHCSPXHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692557_HBe_P-A Product feature CHAIN FJ692557_HBe_P-A of FT:mat_peptide FJ692557_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692558_HBe_P-A Product feature CHAIN FJ692558_HBe_P-A of FT:mat_peptide FJ692558_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48008). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPYDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDAASRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVW
>gnl|hbvpro|FJ692559_HBe_P-A Product feature CHAIN FJ692559_HBe_P-A of FT:mat_peptide FJ692559_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48032). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|FJ692561_HBe_P-A Product feature CHAIN FJ692561_HBe_P-A of FT:mat_peptide FJ692561_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48040). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692562_HBe_P-A Product feature CHAIN FJ692562_HBe_P-A of FT:mat_peptide FJ692562_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48044). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVW
>gnl|hbvpro|FJ692563_HBe_P-A Product feature CHAIN FJ692563_HBe_P-A of FT:mat_peptide FJ692563_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48049). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692564_HBe_P-A Product feature CHAIN FJ692564_HBe_P-A of FT:mat_peptide FJ692564_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48074). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCXTFGREVVLEYLVSFGVW
>gnl|hbvpro|FJ692565_HBe_P-A Product feature CHAIN FJ692565_HBe_P-A of FT:mat_peptide FJ692565_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48077). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|FJ692566_HBe_P-A Product feature CHAIN FJ692566_HBe_P-A of FT:mat_peptide FJ692566_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48090). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRESLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692567_HBe_P-A Product feature CHAIN FJ692567_HBe_P-A of FT:mat_peptide FJ692567_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_48113). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDGLESPEHCXPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692570_HBe_P-A Product feature CHAIN FJ692570_HBe_P-A of FT:mat_peptide FJ692570_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50010). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|FJ692571_HBe_P-A Product feature CHAIN FJ692571_HBe_P-A of FT:mat_peptide FJ692571_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50011). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692573_HBe_P-A Product feature CHAIN FJ692573_HBe_P-A of FT:mat_peptide FJ692573_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50014). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|FJ692574_HBe_P-A Product feature CHAIN FJ692574_HBe_P-A of FT:mat_peptide FJ692574_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50015). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692575_HBe_P-A Product feature CHAIN FJ692575_HBe_P-A of FT:mat_peptide FJ692575_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50020). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692576_HBe_P-A Product feature CHAIN FJ692576_HBe_P-A of FT:mat_peptide FJ692576_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50022). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEFLVSFGVW
>gnl|hbvpro|FJ692577_HBe_P-A Product feature CHAIN FJ692577_HBe_P-A of FT:mat_peptide FJ692577_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50024). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGXXTVLEYLVSFGVW
>gnl|hbvpro|FJ692578_HBe_P-A Product feature CHAIN FJ692578_HBe_P-A of FT:mat_peptide FJ692578_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50083). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692579_HBe_P-A Product feature CHAIN FJ692579_HBe_P-A of FT:mat_peptide FJ692579_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50084). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692580_HBe_P-A Product feature CHAIN FJ692580_HBe_P-A of FT:mat_peptide FJ692580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50085). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692581_HBe_P-A Product feature CHAIN FJ692581_HBe_P-A of FT:mat_peptide FJ692581_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50086). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692582_HBe_P-A Product feature CHAIN FJ692582_HBe_P-A of FT:mat_peptide FJ692582_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50088). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692583_HBe_P-A Product feature CHAIN FJ692583_HBe_P-A of FT:mat_peptide FJ692583_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50089). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692584_HBe_P-A Product feature CHAIN FJ692584_HBe_P-A of FT:mat_peptide FJ692584_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50090). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692585_HBe_P-A Product feature CHAIN FJ692585_HBe_P-A of FT:mat_peptide FJ692585_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50091). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692586_HBe_P-A Product feature CHAIN FJ692586_HBe_P-A of FT:mat_peptide FJ692586_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50099). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLTTLGS
WVGNNLEDQASRALVVNYVDTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVW
>gnl|hbvpro|FJ692587_HBe_P-A Product feature CHAIN FJ692587_HBe_P-A of FT:mat_peptide FJ692587_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50115). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGDVMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEFLVSFGVW
>gnl|hbvpro|FJ692588_HBe_P-A Product feature CHAIN FJ692588_HBe_P-A of FT:mat_peptide FJ692588_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50119). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692590_HBe_P-A Product feature CHAIN FJ692590_HBe_P-A of FT:mat_peptide FJ692590_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50152). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692591_HBe_P-A Product feature CHAIN FJ692591_HBe_P-A of FT:mat_peptide FJ692591_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50167). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692592_HBe_P-A Product feature CHAIN FJ692592_HBe_P-A of FT:mat_peptide FJ692592_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_50175). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREGLESPEHCSPHHTALRQAILXWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692593_HBe_P-A Product feature CHAIN FJ692593_HBe_P-A of FT:mat_peptide FJ692593_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48054). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPVSRDLVVNYVNTNMGLRIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692595_HBe_P-A Product feature CHAIN FJ692595_HBe_P-A of FT:mat_peptide FJ692595_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48093). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNDNMGIKIRQLLWFHISCLTFGREIVLEYLVSFGVW
>gnl|hbvpro|FJ692596_HBe_P-A Product feature CHAIN FJ692596_HBe_P-A of FT:mat_peptide FJ692596_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48103). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHTSSITFGREXVLEYLVSFGVW
>gnl|hbvpro|FJ692597_HBe_P-A Product feature CHAIN FJ692597_HBe_P-A of FT:mat_peptide FJ692597_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_48125). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFXEALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNXNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVW
>gnl|hbvpro|FJ692598_HBe_P-A Product feature CHAIN FJ692598_HBe_P-A of FT:mat_peptide FJ692598_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50018). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVMBLGN
WVGNNLEDXASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVW
>gnl|hbvpro|FJ692599_HBe_P-A Product feature CHAIN FJ692599_HBe_P-A of FT:mat_peptide FJ692599_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50033). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|FJ692600_HBe_P-A Product feature CHAIN FJ692600_HBe_P-A of FT:mat_peptide FJ692600_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50034). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDYYPSVRDLLDTASALYRXALESPEHCSPHHTALRQAXLCWGELMTLAT
WVGNNLEDPASRDXVVNYVNXNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|FJ692601_HBe_P-A Product feature CHAIN FJ692601_HBe_P-A of FT:mat_peptide FJ692601_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50035). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692602_HBe_P-A Product feature CHAIN FJ692602_HBe_P-A of FT:mat_peptide FJ692602_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50041). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAILCWGDLSTLAT
WVGNNLADPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQIVLEYLVSFGVW
>gnl|hbvpro|FJ692603_HBe_P-A Product feature CHAIN FJ692603_HBe_P-A of FT:mat_peptide FJ692603_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50050). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGAXVELLSFLPSDFYPSVRDLLDTATALYRXXLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692604_HBe_P-A Product feature CHAIN FJ692604_HBe_P-A of FT:mat_peptide FJ692604_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50052). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGNNLEDPASRDLVVNYVNTTTGLRIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|FJ692605_HBe_P-A Product feature CHAIN FJ692605_HBe_P-A of FT:mat_peptide FJ692605_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50059). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLXDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVW
>gnl|hbvpro|FJ692606_HBe_P-A Product feature CHAIN FJ692606_HBe_P-A of FT:mat_peptide FJ692606_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50061). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|FJ692607_HBe_P-A Product feature CHAIN FJ692607_HBe_P-A of FT:mat_peptide FJ692607_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50068). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVW
>gnl|hbvpro|FJ692608_HBe_P-A Product feature CHAIN FJ692608_HBe_P-A of FT:mat_peptide FJ692608_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50075). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|FJ692611_HBe_P-A Product feature CHAIN FJ692611_HBe_P-A of FT:mat_peptide FJ692611_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50127). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAS
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVW
>gnl|hbvpro|FJ692612_HBe_P-A Product feature CHAIN FJ692612_HBe_P-A of FT:mat_peptide FJ692612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50132). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692613_HBe_P-A Product feature CHAIN FJ692613_HBe_P-A of FT:mat_peptide FJ692613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A5_50156). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867946_HBe_P-A Product feature CHAIN FJ867946_HBe_P-A of FT:mat_peptide FJ867946_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867947_HBe_P-A Product feature CHAIN FJ867947_HBe_P-A of FT:mat_peptide FJ867947_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC9). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867948_HBe_P-A Product feature CHAIN FJ867948_HBe_P-A of FT:mat_peptide FJ867948_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867949_HBe_P-A Product feature CHAIN FJ867949_HBe_P-A of FT:mat_peptide FJ867949_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCMPC4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867958_HBe_P-A Product feature CHAIN FJ867958_HBe_P-A of FT:mat_peptide FJ867958_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867960_HBe_P-A Product feature CHAIN FJ867960_HBe_P-A of FT:mat_peptide FJ867960_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867961_HBe_P-A Product feature CHAIN FJ867961_HBe_P-A of FT:mat_peptide FJ867961_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HCCNPC36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867985_HBe_P-A Product feature CHAIN FJ867985_HBe_P-A of FT:mat_peptide FJ867985_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCMPC19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867986_HBe_P-A Product feature CHAIN FJ867986_HBe_P-A of FT:mat_peptide FJ867986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCMPC26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867994_HBe_P-A Product feature CHAIN FJ867994_HBe_P-A of FT:mat_peptide FJ867994_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCNPC13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ867995_HBe_P-A Product feature CHAIN FJ867995_HBe_P-A of FT:mat_peptide FJ867995_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate LCNPC29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRELVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ868002_HBe_P-A Product feature CHAIN FJ868002_HBe_P-A of FT:mat_peptide FJ868002_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHMPC58). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDRYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHGSPHHTALRQAILCWGELMTLAT
WVGINLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREAVLEYLVSFGVW
>gnl|hbvpro|FJ868008_HBe_P-A Product feature CHAIN FJ868008_HBe_P-A of FT:mat_peptide FJ868008_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CHNPC87). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ904434_HBe_P-A Product feature CHAIN FJ904434_HBe_P-A of FT:mat_peptide FJ904434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate B21). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPRDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQIILCWGDVMTLAT
WVGTNLZDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FM199974_HBe_P-A Product feature CHAIN FM199974_HBe_P-A of FT:mat_peptide FM199974_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMALAS
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVW
>gnl|hbvpro|FM199975_HBe_P-A Product feature CHAIN FM199975_HBe_P-A of FT:mat_peptide FM199975_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESXEHCXPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FM199976_HBe_P-A Product feature CHAIN FM199976_HBe_P-A of FT:mat_peptide FM199976_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQXLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FM199977_HBe_P-A Product feature CHAIN FM199977_HBe_P-A of FT:mat_peptide FM199977_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALQREALESHEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|FM199978_HBe_P-A Product feature CHAIN FM199978_HBe_P-A of FT:mat_peptide FM199978_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FM199979_HBe_P-A Product feature CHAIN FM199979_HBe_P-A of FT:mat_peptide FM199979_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FM199980_HBe_P-A Product feature CHAIN FM199980_HBe_P-A of FT:mat_peptide FM199980_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FN545825_HBe_P-A Product feature CHAIN FN545825_HBe_P-A of FT:mat_peptide FN545825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FN545826_HBe_P-A Product feature CHAIN FN545826_HBe_P-A of FT:mat_peptide FN545826_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGNNLEDPASRDLVVNYVNNTTGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|FN545828_HBe_P-A Product feature CHAIN FN545828_HBe_P-A of FT:mat_peptide FN545828_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGXLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDQVVDYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|FN545829_HBe_P-A Product feature CHAIN FN545829_HBe_P-A of FT:mat_peptide FN545829_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREGLESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|FN545830_HBe_P-A Product feature CHAIN FN545830_HBe_P-A of FT:mat_peptide FN545830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVW
>gnl|hbvpro|FN545831_HBe_P-A Product feature CHAIN FN545831_HBe_P-A of FT:mat_peptide FN545831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FN545832_HBe_P-A Product feature CHAIN FN545832_HBe_P-A of FT:mat_peptide FN545832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRXALESPEHCTPHHTALRQAILCWGEXMTLAT
WVGNNLDDPASRDLVVNYVNTXMGLKIRQLLWFHISCLTFGREXVLZYLVSFGVW
>gnl|hbvpro|FN545833_HBe_P-A Product feature CHAIN FN545833_HBe_P-A of FT:mat_peptide FN545833_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|FN545834_HBe_P-A Product feature CHAIN FN545834_HBe_P-A of FT:mat_peptide FN545834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLETASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGREVVLEYLVSFGVW
>gnl|hbvpro|FN545835_HBe_P-A Product feature CHAIN FN545835_HBe_P-A of FT:mat_peptide FN545835_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FN545836_HBe_P-A Product feature CHAIN FN545836_HBe_P-A of FT:mat_peptide FN545836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FN545838_HBe_P-A Product feature CHAIN FN545838_HBe_P-A of FT:mat_peptide FN545838_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMSLAT
WVGTNLEDPASREQVVSYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|FN545839_HBe_P-A Product feature CHAIN FN545839_HBe_P-A of FT:mat_peptide FN545839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRXTVLQYLVSFGVW
>gnl|hbvpro|FN545840_HBe_P-A Product feature CHAIN FN545840_HBe_P-A of FT:mat_peptide FN545840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ161813_HBe_P-A Product feature CHAIN GQ161813_HBe_P-A of FT:mat_peptide GQ161813_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GU1021). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ184323_HBe_P-A Product feature CHAIN GQ184323_HBe_P-A of FT:mat_peptide GQ184323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1121). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ184324_HBe_P-A Product feature CHAIN GQ184324_HBe_P-A of FT:mat_peptide GQ184324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1122). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATLELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ222208_HBe_P-A Product feature CHAIN GQ222208_HBe_P-A of FT:mat_peptide GQ222208_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1123). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWRELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ331046_HBe_P-A Product feature CHAIN GQ331046_HBe_P-A of FT:mat_peptide GQ331046_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|GQ331047_HBe_P-A Product feature CHAIN GQ331047_HBe_P-A of FT:mat_peptide GQ331047_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ414522_HBe_P-A Product feature CHAIN GQ414522_HBe_P-A of FT:mat_peptide GQ414522_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477461_HBe_P-A Product feature CHAIN GQ477461_HBe_P-A of FT:mat_peptide GQ477461_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477462_HBe_P-A Product feature CHAIN GQ477462_HBe_P-A of FT:mat_peptide GQ477462_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTSLGT
WVGNNLDDQASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ477463_HBe_P-A Product feature CHAIN GQ477463_HBe_P-A of FT:mat_peptide GQ477463_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTPHHTALRQAILCWVELMTLAS
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477464_HBe_P-A Product feature CHAIN GQ477464_HBe_P-A of FT:mat_peptide GQ477464_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPLDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477465_HBe_P-A Product feature CHAIN GQ477465_HBe_P-A of FT:mat_peptide GQ477465_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477466_HBe_P-A Product feature CHAIN GQ477466_HBe_P-A of FT:mat_peptide GQ477466_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHLSCLMFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477467_HBe_P-A Product feature CHAIN GQ477467_HBe_P-A of FT:mat_peptide GQ477467_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477468_HBe_P-A Product feature CHAIN GQ477468_HBe_P-A of FT:mat_peptide GQ477468_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGNNLEDLASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477469_HBe_P-A Product feature CHAIN GQ477469_HBe_P-A of FT:mat_peptide GQ477469_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P19). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPLDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAVLCWGELMTLAT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477472_HBe_P-A Product feature CHAIN GQ477472_HBe_P-A of FT:mat_peptide GQ477472_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P24). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPGVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477473_HBe_P-A Product feature CHAIN GQ477473_HBe_P-A of FT:mat_peptide GQ477473_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P27). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPLDFFPSARDLLDTASALYREGLESPEHCSPHHTALRQAILCWGELTALAT
WVGGNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVW
>gnl|hbvpro|GQ477474_HBe_P-A Product feature CHAIN GQ477474_HBe_P-A of FT:mat_peptide GQ477474_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P28). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELISFLPSDFFPSVRDLLDTASALYREALESSEHCSPHHTAIRHVLLCWVELMTLAN
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|GQ477475_HBe_P-A Product feature CHAIN GQ477475_HBe_P-A of FT:mat_peptide GQ477475_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P29). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLRWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTAIRQVVLCWGELMTLAT
WVGNNLQDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ477476_HBe_P-A Product feature CHAIN GQ477476_HBe_P-A of FT:mat_peptide GQ477476_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P30). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPTDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELSTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHVSCIIFGREIVLEYLVSFGVW
>gnl|hbvpro|GQ477478_HBe_P-A Product feature CHAIN GQ477478_HBe_P-A of FT:mat_peptide GQ477478_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P34). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDYYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477479_HBe_P-A Product feature CHAIN GQ477479_HBe_P-A of FT:mat_peptide GQ477479_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P40). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADYYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477480_HBe_P-A Product feature CHAIN GQ477480_HBe_P-A of FT:mat_peptide GQ477480_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P41). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASTELLSFLPSDFFPNVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELMNLAT
WVGSNLQDPASRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477482_HBe_P-A Product feature CHAIN GQ477482_HBe_P-A of FT:mat_peptide GQ477482_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P46). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIICWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477484_HBe_P-A Product feature CHAIN GQ477484_HBe_P-A of FT:mat_peptide GQ477484_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P54). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMSLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477486_HBe_P-A Product feature CHAIN GQ477486_HBe_P-A of FT:mat_peptide GQ477486_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P57). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTAAALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477487_HBe_P-A Product feature CHAIN GQ477487_HBe_P-A of FT:mat_peptide GQ477487_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P60). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELSTLAT
WVGNNLQDSASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477488_HBe_P-A Product feature CHAIN GQ477488_HBe_P-A of FT:mat_peptide GQ477488_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P64). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELMTLAS
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEFLVSFGVW
>gnl|hbvpro|GQ477490_HBe_P-A Product feature CHAIN GQ477490_HBe_P-A of FT:mat_peptide GQ477490_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P74). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGSNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477491_HBe_P-A Product feature CHAIN GQ477491_HBe_P-A of FT:mat_peptide GQ477491_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P75). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHSSCITFGRDTVLEYLVSFGVW
>gnl|hbvpro|GQ477493_HBe_P-A Product feature CHAIN GQ477493_HBe_P-A of FT:mat_peptide GQ477493_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P79). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSARDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRDTVLEYLVSFGVW
>gnl|hbvpro|GQ477495_HBe_P-A Product feature CHAIN GQ477495_HBe_P-A of FT:mat_peptide GQ477495_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P89). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477496_HBe_P-A Product feature CHAIN GQ477496_HBe_P-A of FT:mat_peptide GQ477496_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P94). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477497_HBe_P-A Product feature CHAIN GQ477497_HBe_P-A of FT:mat_peptide GQ477497_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P98). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLRWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477498_HBe_P-A Product feature CHAIN GQ477498_HBe_P-A of FT:mat_peptide GQ477498_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P100). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ477500_HBe_P-A Product feature CHAIN GQ477500_HBe_P-A of FT:mat_peptide GQ477500_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P107). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVKDLLDTASALYREALESSEHCSPHHTAIRQVILCWGDVMTLGT
WVGNNLEDPASKDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477501_HBe_P-A Product feature CHAIN GQ477501_HBe_P-A of FT:mat_peptide GQ477501_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P116). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLNDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|GQ477502_HBe_P-A Product feature CHAIN GQ477502_HBe_P-A of FT:mat_peptide GQ477502_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P123). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPNVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGGNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLQYLVSFGVW
>gnl|hbvpro|GQ477503_HBe_P-A Product feature CHAIN GQ477503_HBe_P-A of FT:mat_peptide GQ477503_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P130). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ477504_HBe_P-A Product feature CHAIN GQ477504_HBe_P-A of FT:mat_peptide GQ477504_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P131). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELSTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGREVVHEYLVSFGVW
>gnl|hbvpro|GQ921978_HBe_P-A Product feature CHAIN GQ921978_HBe_P-A of FT:mat_peptide GQ921978_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1B1148). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSYHHTALRQAILCWEEVTSLGT
WVGNNLQDPASRDLVVNHVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563545_HBe_P-A Product feature CHAIN GU563545_HBe_P-A of FT:mat_peptide GU563545_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLCDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563546_HBe_P-A Product feature CHAIN GU563546_HBe_P-A of FT:mat_peptide GU563546_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563547_HBe_P-A Product feature CHAIN GU563547_HBe_P-A of FT:mat_peptide GU563547_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATTDLLSFLPSDFFPSVRDLRDTTSALYREALESPEHCSSHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHLSCITFGRDTVLEYLVSFGVW
>gnl|hbvpro|GU563548_HBe_P-A Product feature CHAIN GU563548_HBe_P-A of FT:mat_peptide GU563548_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563550_HBe_P-A Product feature CHAIN GU563550_HBe_P-A of FT:mat_peptide GU563550_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWVWGMDIDPYKEFGATGELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563553_HBe_P-A Product feature CHAIN GU563553_HBe_P-A of FT:mat_peptide GU563553_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563554_HBe_P-A Product feature CHAIN GU563554_HBe_P-A of FT:mat_peptide GU563554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563555_HBe_P-A Product feature CHAIN GU563555_HBe_P-A of FT:mat_peptide GU563555_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563557_HBe_P-A Product feature CHAIN GU563557_HBe_P-A of FT:mat_peptide GU563557_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563558_HBe_P-A Product feature CHAIN GU563558_HBe_P-A of FT:mat_peptide GU563558_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563562_HBe_P-A Product feature CHAIN GU563562_HBe_P-A of FT:mat_peptide GU563562_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU827640_HBe_P-A Product feature CHAIN GU827640_HBe_P-A of FT:mat_peptide GU827640_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CMC25B). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTSLGT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HE576988_HBe_P-A Product feature CHAIN HE576988_HBe_P-A of FT:mat_peptide HE576988_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HE576989_HBe_P-A Product feature CHAIN HE576989_HBe_P-A of FT:mat_peptide HE576989_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate P2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM214718_HBe_P-A Product feature CHAIN HM214718_HBe_P-A of FT:mat_peptide HM214718_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA83). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM214726_HBe_P-A Product feature CHAIN HM214726_HBe_P-A of FT:mat_peptide HM214726_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA62). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM214727_HBe_P-A Product feature CHAIN HM214727_HBe_P-A of FT:mat_peptide HM214727_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGGLWGMDIDPYKEFGGTGELLSFLPFDFFPSVRDFLDTASALYREALEFPEHCSPPHTALRQAIFCWGELMTLAT
WGGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVFEYLVSFGGG
>gnl|hbvpro|HM214730_HBe_P-A Product feature CHAIN HM214730_HBe_P-A of FT:mat_peptide HM214730_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA146). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATGELLSFLPFDFFPSVKDFLDPASALYREPLEFPDHCSPPHTALRQAIFCWGELMTLAP
WGGNNLEDPASRDLVVNYVNTNLGLKIRQLLGFHISSLTFGRETVLEYLVSFGGG
>gnl|hbvpro|HM214731_HBe_P-A Product feature CHAIN HM214731_HBe_P-A of FT:mat_peptide HM214731_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA149). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGGLWGMDIDPYKKFGATGELLSFLPFDFFPSVRDFLDTASALYREALEFPEHCSPPHTALRQAIFCWGELRNLAT
WGGNNLEDPASRDLVVNYVNTNMGLKIRQLLGFHISSLTFGRETVLEYLVSFGGG
>gnl|hbvpro|HM214743_HBe_P-A Product feature CHAIN HM214743_HBe_P-A of FT:mat_peptide HM214743_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BA80). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM363612_HBe_P-A Product feature CHAIN HM363612_HBe_P-A of FT:mat_peptide HM363612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|HM363613_HBe_P-A Product feature CHAIN HM363613_HBe_P-A of FT:mat_peptide HM363613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate V103). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTSAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|HM535200_HBe_P-A Product feature CHAIN HM535200_HBe_P-A of FT:mat_peptide HM535200_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 947). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLRFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM535205_HBe_P-A Product feature CHAIN HM535205_HBe_P-A of FT:mat_peptide HM535205_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 72). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439720_HBe_P-A Product feature CHAIN JF439720_HBe_P-A of FT:mat_peptide JF439720_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL437). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439721_HBe_P-A Product feature CHAIN JF439721_HBe_P-A of FT:mat_peptide JF439721_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL444). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439722_HBe_P-A Product feature CHAIN JF439722_HBe_P-A of FT:mat_peptide JF439722_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL445). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439723_HBe_P-A Product feature CHAIN JF439723_HBe_P-A of FT:mat_peptide JF439723_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL448). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439724_HBe_P-A Product feature CHAIN JF439724_HBe_P-A of FT:mat_peptide JF439724_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL450). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRGALESPEHCSPHHTALRQDILCWGELMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439725_HBe_P-A Product feature CHAIN JF439725_HBe_P-A of FT:mat_peptide JF439725_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL451). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439726_HBe_P-A Product feature CHAIN JF439726_HBe_P-A of FT:mat_peptide JF439726_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL452). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439727_HBe_P-A Product feature CHAIN JF439727_HBe_P-A of FT:mat_peptide JF439727_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL453). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439728_HBe_P-A Product feature CHAIN JF439728_HBe_P-A of FT:mat_peptide JF439728_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL454). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439729_HBe_P-A Product feature CHAIN JF439729_HBe_P-A of FT:mat_peptide JF439729_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439730_HBe_P-A Product feature CHAIN JF439730_HBe_P-A of FT:mat_peptide JF439730_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL456). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439731_HBe_P-A Product feature CHAIN JF439731_HBe_P-A of FT:mat_peptide JF439731_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL458). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439732_HBe_P-A Product feature CHAIN JF439732_HBe_P-A of FT:mat_peptide JF439732_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL459). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439733_HBe_P-A Product feature CHAIN JF439733_HBe_P-A of FT:mat_peptide JF439733_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL460). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439734_HBe_P-A Product feature CHAIN JF439734_HBe_P-A of FT:mat_peptide JF439734_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL461). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439735_HBe_P-A Product feature CHAIN JF439735_HBe_P-A of FT:mat_peptide JF439735_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL462). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439736_HBe_P-A Product feature CHAIN JF439736_HBe_P-A of FT:mat_peptide JF439736_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL463). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439737_HBe_P-A Product feature CHAIN JF439737_HBe_P-A of FT:mat_peptide JF439737_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL465). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMSLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439738_HBe_P-A Product feature CHAIN JF439738_HBe_P-A of FT:mat_peptide JF439738_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL466). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYREFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439740_HBe_P-A Product feature CHAIN JF439740_HBe_P-A of FT:mat_peptide JF439740_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL468). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLGSPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439741_HBe_P-A Product feature CHAIN JF439741_HBe_P-A of FT:mat_peptide JF439741_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL469). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGKVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439742_HBe_P-A Product feature CHAIN JF439742_HBe_P-A of FT:mat_peptide JF439742_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL471). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439743_HBe_P-A Product feature CHAIN JF439743_HBe_P-A of FT:mat_peptide JF439743_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL472). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439744_HBe_P-A Product feature CHAIN JF439744_HBe_P-A of FT:mat_peptide JF439744_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL473). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGGLMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439746_HBe_P-A Product feature CHAIN JF439746_HBe_P-A of FT:mat_peptide JF439746_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL485). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439747_HBe_P-A Product feature CHAIN JF439747_HBe_P-A of FT:mat_peptide JF439747_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL489). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439748_HBe_P-A Product feature CHAIN JF439748_HBe_P-A of FT:mat_peptide JF439748_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL490). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTAPRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439750_HBe_P-A Product feature CHAIN JF439750_HBe_P-A of FT:mat_peptide JF439750_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL498). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGNVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439751_HBe_P-A Product feature CHAIN JF439751_HBe_P-A of FT:mat_peptide JF439751_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL499). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439752_HBe_P-A Product feature CHAIN JF439752_HBe_P-A of FT:mat_peptide JF439752_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439753_HBe_P-A Product feature CHAIN JF439753_HBe_P-A of FT:mat_peptide JF439753_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439754_HBe_P-A Product feature CHAIN JF439754_HBe_P-A of FT:mat_peptide JF439754_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439755_HBe_P-A Product feature CHAIN JF439755_HBe_P-A of FT:mat_peptide JF439755_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439756_HBe_P-A Product feature CHAIN JF439756_HBe_P-A of FT:mat_peptide JF439756_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439757_HBe_P-A Product feature CHAIN JF439757_HBe_P-A of FT:mat_peptide JF439757_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439758_HBe_P-A Product feature CHAIN JF439758_HBe_P-A of FT:mat_peptide JF439758_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439759_HBe_P-A Product feature CHAIN JF439759_HBe_P-A of FT:mat_peptide JF439759_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439760_HBe_P-A Product feature CHAIN JF439760_HBe_P-A of FT:mat_peptide JF439760_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439761_HBe_P-A Product feature CHAIN JF439761_HBe_P-A of FT:mat_peptide JF439761_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95A12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439762_HBe_P-A Product feature CHAIN JF439762_HBe_P-A of FT:mat_peptide JF439762_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439763_HBe_P-A Product feature CHAIN JF439763_HBe_P-A of FT:mat_peptide JF439763_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439764_HBe_P-A Product feature CHAIN JF439764_HBe_P-A of FT:mat_peptide JF439764_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439765_HBe_P-A Product feature CHAIN JF439765_HBe_P-A of FT:mat_peptide JF439765_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B6). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439766_HBe_P-A Product feature CHAIN JF439766_HBe_P-A of FT:mat_peptide JF439766_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU95B7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439767_HBe_P-A Product feature CHAIN JF439767_HBe_P-A of FT:mat_peptide JF439767_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLRLGWLWGMDIDPYKEFGATVELLSVLPCDFFPSVPDLLHAASTWYQEVLKSPGHCSPHHTALLHAILCWRELMTLAT
WVGDNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439768_HBe_P-A Product feature CHAIN JF439768_HBe_P-A of FT:mat_peptide JF439768_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439769_HBe_P-A Product feature CHAIN JF439769_HBe_P-A of FT:mat_peptide JF439769_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B10). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439770_HBe_P-A Product feature CHAIN JF439770_HBe_P-A of FT:mat_peptide JF439770_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B12). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439771_HBe_P-A Product feature CHAIN JF439771_HBe_P-A of FT:mat_peptide JF439771_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439772_HBe_P-A Product feature CHAIN JF439772_HBe_P-A of FT:mat_peptide JF439772_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C5). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439773_HBe_P-A Product feature CHAIN JF439773_HBe_P-A of FT:mat_peptide JF439773_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C7). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439774_HBe_P-A Product feature CHAIN JF439774_HBe_P-A of FT:mat_peptide JF439774_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALREAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439775_HBe_P-A Product feature CHAIN JF439775_HBe_P-A of FT:mat_peptide JF439775_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05C9). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439777_HBe_P-A Product feature CHAIN JF439777_HBe_P-A of FT:mat_peptide JF439777_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439778_HBe_P-A Product feature CHAIN JF439778_HBe_P-A of FT:mat_peptide JF439778_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05D3). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439819_HBe_P-A Product feature CHAIN JF439819_HBe_P-A of FT:mat_peptide JF439819_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97A1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439820_HBe_P-A Product feature CHAIN JF439820_HBe_P-A of FT:mat_peptide JF439820_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439821_HBe_P-A Product feature CHAIN JF439821_HBe_P-A of FT:mat_peptide JF439821_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97B2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGGLWGRDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYQEALKSPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVFNYVNTNMGLKIRQLLWFHISCLSFGRKTVLEYLVSFGVW
>gnl|hbvpro|JF439822_HBe_P-A Product feature CHAIN JF439822_HBe_P-A of FT:mat_peptide JF439822_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439823_HBe_P-A Product feature CHAIN JF439823_HBe_P-A of FT:mat_peptide JF439823_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97C2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439824_HBe_P-A Product feature CHAIN JF439824_HBe_P-A of FT:mat_peptide JF439824_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439825_HBe_P-A Product feature CHAIN JF439825_HBe_P-A of FT:mat_peptide JF439825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97D2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439826_HBe_P-A Product feature CHAIN JF439826_HBe_P-A of FT:mat_peptide JF439826_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97E1). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGAAVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439827_HBe_P-A Product feature CHAIN JF439827_HBe_P-A of FT:mat_peptide JF439827_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97E2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439828_HBe_P-A Product feature CHAIN JF439828_HBe_P-A of FT:mat_peptide JF439828_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439829_HBe_P-A Product feature CHAIN JF439829_HBe_P-A of FT:mat_peptide JF439829_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97F2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHAALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439830_HBe_P-A Product feature CHAIN JF439830_HBe_P-A of FT:mat_peptide JF439830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97G2). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMALAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVW
>gnl|hbvpro|JF439831_HBe_P-A Product feature CHAIN JF439831_HBe_P-A of FT:mat_peptide JF439831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439832_HBe_P-A Product feature CHAIN JF439832_HBe_P-A of FT:mat_peptide JF439832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ97H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPGHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLASFGVW
>gnl|hbvpro|JF439833_HBe_P-A Product feature CHAIN JF439833_HBe_P-A of FT:mat_peptide JF439833_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439834_HBe_P-A Product feature CHAIN JF439834_HBe_P-A of FT:mat_peptide JF439834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99A4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SRLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439835_HBe_P-A Product feature CHAIN JF439835_HBe_P-A of FT:mat_peptide JF439835_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439836_HBe_P-A Product feature CHAIN JF439836_HBe_P-A of FT:mat_peptide JF439836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99B4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439837_HBe_P-A Product feature CHAIN JF439837_HBe_P-A of FT:mat_peptide JF439837_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439838_HBe_P-A Product feature CHAIN JF439838_HBe_P-A of FT:mat_peptide JF439838_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99C4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLYLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439839_HBe_P-A Product feature CHAIN JF439839_HBe_P-A of FT:mat_peptide JF439839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439840_HBe_P-A Product feature CHAIN JF439840_HBe_P-A of FT:mat_peptide JF439840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99D4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439841_HBe_P-A Product feature CHAIN JF439841_HBe_P-A of FT:mat_peptide JF439841_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439842_HBe_P-A Product feature CHAIN JF439842_HBe_P-A of FT:mat_peptide JF439842_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439843_HBe_P-A Product feature CHAIN JF439843_HBe_P-A of FT:mat_peptide JF439843_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99F4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439844_HBe_P-A Product feature CHAIN JF439844_HBe_P-A of FT:mat_peptide JF439844_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ99H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439845_HBe_P-A Product feature CHAIN JF439845_HBe_P-A of FT:mat_peptide JF439845_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439846_HBe_P-A Product feature CHAIN JF439846_HBe_P-A of FT:mat_peptide JF439846_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439847_HBe_P-A Product feature CHAIN JF439847_HBe_P-A of FT:mat_peptide JF439847_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00A6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439848_HBe_P-A Product feature CHAIN JF439848_HBe_P-A of FT:mat_peptide JF439848_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439849_HBe_P-A Product feature CHAIN JF439849_HBe_P-A of FT:mat_peptide JF439849_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00B6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439850_HBe_P-A Product feature CHAIN JF439850_HBe_P-A of FT:mat_peptide JF439850_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439852_HBe_P-A Product feature CHAIN JF439852_HBe_P-A of FT:mat_peptide JF439852_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439853_HBe_P-A Product feature CHAIN JF439853_HBe_P-A of FT:mat_peptide JF439853_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00D6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439854_HBe_P-A Product feature CHAIN JF439854_HBe_P-A of FT:mat_peptide JF439854_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439855_HBe_P-A Product feature CHAIN JF439855_HBe_P-A of FT:mat_peptide JF439855_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00E6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVPFGVW
>gnl|hbvpro|JF439856_HBe_P-A Product feature CHAIN JF439856_HBe_P-A of FT:mat_peptide JF439856_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439857_HBe_P-A Product feature CHAIN JF439857_HBe_P-A of FT:mat_peptide JF439857_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00F6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439858_HBe_P-A Product feature CHAIN JF439858_HBe_P-A of FT:mat_peptide JF439858_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439859_HBe_P-A Product feature CHAIN JF439859_HBe_P-A of FT:mat_peptide JF439859_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLPDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439860_HBe_P-A Product feature CHAIN JF439860_HBe_P-A of FT:mat_peptide JF439860_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ00H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439861_HBe_P-A Product feature CHAIN JF439861_HBe_P-A of FT:mat_peptide JF439861_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEGPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439864_HBe_P-A Product feature CHAIN JF439864_HBe_P-A of FT:mat_peptide JF439864_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439865_HBe_P-A Product feature CHAIN JF439865_HBe_P-A of FT:mat_peptide JF439865_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05D8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439866_HBe_P-A Product feature CHAIN JF439866_HBe_P-A of FT:mat_peptide JF439866_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05F7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439867_HBe_P-A Product feature CHAIN JF439867_HBe_P-A of FT:mat_peptide JF439867_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05G8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439868_HBe_P-A Product feature CHAIN JF439868_HBe_P-A of FT:mat_peptide JF439868_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ABJ05H7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439869_HBe_P-A Product feature CHAIN JF439869_HBe_P-A of FT:mat_peptide JF439869_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439870_HBe_P-A Product feature CHAIN JF439870_HBe_P-A of FT:mat_peptide JF439870_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439871_HBe_P-A Product feature CHAIN JF439871_HBe_P-A of FT:mat_peptide JF439871_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439872_HBe_P-A Product feature CHAIN JF439872_HBe_P-A of FT:mat_peptide JF439872_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439873_HBe_P-A Product feature CHAIN JF439873_HBe_P-A of FT:mat_peptide JF439873_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439874_HBe_P-A Product feature CHAIN JF439874_HBe_P-A of FT:mat_peptide JF439874_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439875_HBe_P-A Product feature CHAIN JF439875_HBe_P-A of FT:mat_peptide JF439875_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439876_HBe_P-A Product feature CHAIN JF439876_HBe_P-A of FT:mat_peptide JF439876_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439877_HBe_P-A Product feature CHAIN JF439877_HBe_P-A of FT:mat_peptide JF439877_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439878_HBe_P-A Product feature CHAIN JF439878_HBe_P-A of FT:mat_peptide JF439878_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01C12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439879_HBe_P-A Product feature CHAIN JF439879_HBe_P-A of FT:mat_peptide JF439879_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439880_HBe_P-A Product feature CHAIN JF439880_HBe_P-A of FT:mat_peptide JF439880_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439881_HBe_P-A Product feature CHAIN JF439881_HBe_P-A of FT:mat_peptide JF439881_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439882_HBe_P-A Product feature CHAIN JF439882_HBe_P-A of FT:mat_peptide JF439882_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439883_HBe_P-A Product feature CHAIN JF439883_HBe_P-A of FT:mat_peptide JF439883_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ANG01E7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|JF439896_HBe_P-A Product feature CHAIN JF439896_HBe_P-A of FT:mat_peptide JF439896_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439897_HBe_P-A Product feature CHAIN JF439897_HBe_P-A of FT:mat_peptide JF439897_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439898_HBe_P-A Product feature CHAIN JF439898_HBe_P-A of FT:mat_peptide JF439898_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01A10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439899_HBe_P-A Product feature CHAIN JF439899_HBe_P-A of FT:mat_peptide JF439899_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439900_HBe_P-A Product feature CHAIN JF439900_HBe_P-A of FT:mat_peptide JF439900_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439901_HBe_P-A Product feature CHAIN JF439901_HBe_P-A of FT:mat_peptide JF439901_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439902_HBe_P-A Product feature CHAIN JF439902_HBe_P-A of FT:mat_peptide JF439902_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439903_HBe_P-A Product feature CHAIN JF439903_HBe_P-A of FT:mat_peptide JF439903_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439904_HBe_P-A Product feature CHAIN JF439904_HBe_P-A of FT:mat_peptide JF439904_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01G12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439905_HBe_P-A Product feature CHAIN JF439905_HBe_P-A of FT:mat_peptide JF439905_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439906_HBe_P-A Product feature CHAIN JF439906_HBe_P-A of FT:mat_peptide JF439906_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439907_HBe_P-A Product feature CHAIN JF439907_HBe_P-A of FT:mat_peptide JF439907_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439908_HBe_P-A Product feature CHAIN JF439908_HBe_P-A of FT:mat_peptide JF439908_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWWDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439909_HBe_P-A Product feature CHAIN JF439909_HBe_P-A of FT:mat_peptide JF439909_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439910_HBe_P-A Product feature CHAIN JF439910_HBe_P-A of FT:mat_peptide JF439910_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FOL01H6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439943_HBe_P-A Product feature CHAIN JF439943_HBe_P-A of FT:mat_peptide JF439943_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439944_HBe_P-A Product feature CHAIN JF439944_HBe_P-A of FT:mat_peptide JF439944_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDMDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439945_HBe_P-A Product feature CHAIN JF439945_HBe_P-A of FT:mat_peptide JF439945_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439946_HBe_P-A Product feature CHAIN JF439946_HBe_P-A of FT:mat_peptide JF439946_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439947_HBe_P-A Product feature CHAIN JF439947_HBe_P-A of FT:mat_peptide JF439947_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439948_HBe_P-A Product feature CHAIN JF439948_HBe_P-A of FT:mat_peptide JF439948_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439949_HBe_P-A Product feature CHAIN JF439949_HBe_P-A of FT:mat_peptide JF439949_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439950_HBe_P-A Product feature CHAIN JF439950_HBe_P-A of FT:mat_peptide JF439950_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439951_HBe_P-A Product feature CHAIN JF439951_HBe_P-A of FT:mat_peptide JF439951_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a11). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439952_HBe_P-A Product feature CHAIN JF439952_HBe_P-A of FT:mat_peptide JF439952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99a12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439953_HBe_P-A Product feature CHAIN JF439953_HBe_P-A of FT:mat_peptide JF439953_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLGYLVSFGVW
>gnl|hbvpro|JF439954_HBe_P-A Product feature CHAIN JF439954_HBe_P-A of FT:mat_peptide JF439954_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439955_HBe_P-A Product feature CHAIN JF439955_HBe_P-A of FT:mat_peptide JF439955_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439956_HBe_P-A Product feature CHAIN JF439956_HBe_P-A of FT:mat_peptide JF439956_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439957_HBe_P-A Product feature CHAIN JF439957_HBe_P-A of FT:mat_peptide JF439957_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439958_HBe_P-A Product feature CHAIN JF439958_HBe_P-A of FT:mat_peptide JF439958_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SRLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWEELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439959_HBe_P-A Product feature CHAIN JF439959_HBe_P-A of FT:mat_peptide JF439959_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439960_HBe_P-A Product feature CHAIN JF439960_HBe_P-A of FT:mat_peptide JF439960_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc99b10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439961_HBe_P-A Product feature CHAIN JF439961_HBe_P-A of FT:mat_peptide JF439961_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439962_HBe_P-A Product feature CHAIN JF439962_HBe_P-A of FT:mat_peptide JF439962_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVPFGVW
>gnl|hbvpro|JF439964_HBe_P-A Product feature CHAIN JF439964_HBe_P-A of FT:mat_peptide JF439964_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439965_HBe_P-A Product feature CHAIN JF439965_HBe_P-A of FT:mat_peptide JF439965_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439966_HBe_P-A Product feature CHAIN JF439966_HBe_P-A of FT:mat_peptide JF439966_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c8). Partial genome (Contains: HBe, HBc, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439968_HBe_P-A Product feature CHAIN JF439968_HBe_P-A of FT:mat_peptide JF439968_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01c12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439969_HBe_P-A Product feature CHAIN JF439969_HBe_P-A of FT:mat_peptide JF439969_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIGPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLAFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439970_HBe_P-A Product feature CHAIN JF439970_HBe_P-A of FT:mat_peptide JF439970_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439971_HBe_P-A Product feature CHAIN JF439971_HBe_P-A of FT:mat_peptide JF439971_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439972_HBe_P-A Product feature CHAIN JF439972_HBe_P-A of FT:mat_peptide JF439972_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLPFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439973_HBe_P-A Product feature CHAIN JF439973_HBe_P-A of FT:mat_peptide JF439973_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDSFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439974_HBe_P-A Product feature CHAIN JF439974_HBe_P-A of FT:mat_peptide JF439974_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439975_HBe_P-A Product feature CHAIN JF439975_HBe_P-A of FT:mat_peptide JF439975_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439976_HBe_P-A Product feature CHAIN JF439976_HBe_P-A of FT:mat_peptide JF439976_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439977_HBe_P-A Product feature CHAIN JF439977_HBe_P-A of FT:mat_peptide JF439977_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc01d9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439979_HBe_P-A Product feature CHAIN JF439979_HBe_P-A of FT:mat_peptide JF439979_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIPCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439980_HBe_P-A Product feature CHAIN JF439980_HBe_P-A of FT:mat_peptide JF439980_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439981_HBe_P-A Product feature CHAIN JF439981_HBe_P-A of FT:mat_peptide JF439981_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLGTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVKYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439982_HBe_P-A Product feature CHAIN JF439982_HBe_P-A of FT:mat_peptide JF439982_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439983_HBe_P-A Product feature CHAIN JF439983_HBe_P-A of FT:mat_peptide JF439983_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e6). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439984_HBe_P-A Product feature CHAIN JF439984_HBe_P-A of FT:mat_peptide JF439984_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e9). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439985_HBe_P-A Product feature CHAIN JF439985_HBe_P-A of FT:mat_peptide JF439985_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e10). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439986_HBe_P-A Product feature CHAIN JF439986_HBe_P-A of FT:mat_peptide JF439986_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05e12). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYIEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELLTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439987_HBe_P-A Product feature CHAIN JF439987_HBe_P-A of FT:mat_peptide JF439987_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f1). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439988_HBe_P-A Product feature CHAIN JF439988_HBe_P-A of FT:mat_peptide JF439988_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f2). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439989_HBe_P-A Product feature CHAIN JF439989_HBe_P-A of FT:mat_peptide JF439989_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439990_HBe_P-A Product feature CHAIN JF439990_HBe_P-A of FT:mat_peptide JF439990_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f4). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439991_HBe_P-A Product feature CHAIN JF439991_HBe_P-A of FT:mat_peptide JF439991_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f5). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439992_HBe_P-A Product feature CHAIN JF439992_HBe_P-A of FT:mat_peptide JF439992_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f7). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDLFPSVRDLLDTASALYREALESPEHCSPHHTALGQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439993_HBe_P-A Product feature CHAIN JF439993_HBe_P-A of FT:mat_peptide JF439993_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate roc05f8). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF440016_HBe_P-A Product feature CHAIN JF440016_HBe_P-A of FT:mat_peptide JF440016_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MAU05B11). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182318_HBe_P-A Product feature CHAIN JN182318_HBe_P-A of FT:mat_peptide JN182318_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182319_HBe_P-A Product feature CHAIN JN182319_HBe_P-A of FT:mat_peptide JN182319_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182320_HBe_P-A Product feature CHAIN JN182320_HBe_P-A of FT:mat_peptide JN182320_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182321_HBe_P-A Product feature CHAIN JN182321_HBe_P-A of FT:mat_peptide JN182321_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182322_HBe_P-A Product feature CHAIN JN182322_HBe_P-A of FT:mat_peptide JN182322_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182323_HBe_P-A Product feature CHAIN JN182323_HBe_P-A of FT:mat_peptide JN182323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSYGVW
>gnl|hbvpro|JN182324_HBe_P-A Product feature CHAIN JN182324_HBe_P-A of FT:mat_peptide JN182324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182325_HBe_P-A Product feature CHAIN JN182325_HBe_P-A of FT:mat_peptide JN182325_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILRWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182326_HBe_P-A Product feature CHAIN JN182326_HBe_P-A of FT:mat_peptide JN182326_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQTILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182327_HBe_P-A Product feature CHAIN JN182327_HBe_P-A of FT:mat_peptide JN182327_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182328_HBe_P-A Product feature CHAIN JN182328_HBe_P-A of FT:mat_peptide JN182328_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCPGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182329_HBe_P-A Product feature CHAIN JN182329_HBe_P-A of FT:mat_peptide JN182329_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182330_HBe_P-A Product feature CHAIN JN182330_HBe_P-A of FT:mat_peptide JN182330_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182331_HBe_P-A Product feature CHAIN JN182331_HBe_P-A of FT:mat_peptide JN182331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182332_HBe_P-A Product feature CHAIN JN182332_HBe_P-A of FT:mat_peptide JN182332_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQRLWFHISCLTFGRETALEYLVSFGVW
>gnl|hbvpro|JN182333_HBe_P-A Product feature CHAIN JN182333_HBe_P-A of FT:mat_peptide JN182333_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN182334_HBe_P-A Product feature CHAIN JN182334_HBe_P-A of FT:mat_peptide JN182334_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGEPMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ023660_HBe_P-A Product feature CHAIN JQ023660_HBe_P-A of FT:mat_peptide JQ023660_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1160). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREDLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ023661_HBe_P-A Product feature CHAIN JQ023661_HBe_P-A of FT:mat_peptide JQ023661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1158). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREDLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ038390_HBe_P-A Product feature CHAIN JQ038390_HBe_P-A of FT:mat_peptide JQ038390_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SM16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ038410_HBe_P-A Product feature CHAIN JQ038410_HBe_P-A of FT:mat_peptide JQ038410_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SM36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ687529_HBe_P-A Product feature CHAIN JQ687529_HBe_P-A of FT:mat_peptide JQ687529_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ687533_HBe_P-A Product feature CHAIN JQ687533_HBe_P-A of FT:mat_peptide JQ687533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Srb). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707299_HBe_P-A Product feature CHAIN JQ707299_HBe_P-A of FT:mat_peptide JQ707299_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707300_HBe_P-A Product feature CHAIN JQ707300_HBe_P-A of FT:mat_peptide JQ707300_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707301_HBe_P-A Product feature CHAIN JQ707301_HBe_P-A of FT:mat_peptide JQ707301_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707302_HBe_P-A Product feature CHAIN JQ707302_HBe_P-A of FT:mat_peptide JQ707302_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707303_HBe_P-A Product feature CHAIN JQ707303_HBe_P-A of FT:mat_peptide JQ707303_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707304_HBe_P-A Product feature CHAIN JQ707304_HBe_P-A of FT:mat_peptide JQ707304_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707305_HBe_P-A Product feature CHAIN JQ707305_HBe_P-A of FT:mat_peptide JQ707305_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707306_HBe_P-A Product feature CHAIN JQ707306_HBe_P-A of FT:mat_peptide JQ707306_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707307_HBe_P-A Product feature CHAIN JQ707307_HBe_P-A of FT:mat_peptide JQ707307_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707308_HBe_P-A Product feature CHAIN JQ707308_HBe_P-A of FT:mat_peptide JQ707308_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707309_HBe_P-A Product feature CHAIN JQ707309_HBe_P-A of FT:mat_peptide JQ707309_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707310_HBe_P-A Product feature CHAIN JQ707310_HBe_P-A of FT:mat_peptide JQ707310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707311_HBe_P-A Product feature CHAIN JQ707311_HBe_P-A of FT:mat_peptide JQ707311_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707312_HBe_P-A Product feature CHAIN JQ707312_HBe_P-A of FT:mat_peptide JQ707312_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFNISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707313_HBe_P-A Product feature CHAIN JQ707313_HBe_P-A of FT:mat_peptide JQ707313_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707314_HBe_P-A Product feature CHAIN JQ707314_HBe_P-A of FT:mat_peptide JQ707314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707315_HBe_P-A Product feature CHAIN JQ707315_HBe_P-A of FT:mat_peptide JQ707315_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSGFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707316_HBe_P-A Product feature CHAIN JQ707316_HBe_P-A of FT:mat_peptide JQ707316_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707317_HBe_P-A Product feature CHAIN JQ707317_HBe_P-A of FT:mat_peptide JQ707317_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707318_HBe_P-A Product feature CHAIN JQ707318_HBe_P-A of FT:mat_peptide JQ707318_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707319_HBe_P-A Product feature CHAIN JQ707319_HBe_P-A of FT:mat_peptide JQ707319_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707320_HBe_P-A Product feature CHAIN JQ707320_HBe_P-A of FT:mat_peptide JQ707320_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707321_HBe_P-A Product feature CHAIN JQ707321_HBe_P-A of FT:mat_peptide JQ707321_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707322_HBe_P-A Product feature CHAIN JQ707322_HBe_P-A of FT:mat_peptide JQ707322_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707323_HBe_P-A Product feature CHAIN JQ707323_HBe_P-A of FT:mat_peptide JQ707323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707324_HBe_P-A Product feature CHAIN JQ707324_HBe_P-A of FT:mat_peptide JQ707324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707325_HBe_P-A Product feature CHAIN JQ707325_HBe_P-A of FT:mat_peptide JQ707325_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707326_HBe_P-A Product feature CHAIN JQ707326_HBe_P-A of FT:mat_peptide JQ707326_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707327_HBe_P-A Product feature CHAIN JQ707327_HBe_P-A of FT:mat_peptide JQ707327_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707329_HBe_P-A Product feature CHAIN JQ707329_HBe_P-A of FT:mat_peptide JQ707329_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707330_HBe_P-A Product feature CHAIN JQ707330_HBe_P-A of FT:mat_peptide JQ707330_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707331_HBe_P-A Product feature CHAIN JQ707331_HBe_P-A of FT:mat_peptide JQ707331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707332_HBe_P-A Product feature CHAIN JQ707332_HBe_P-A of FT:mat_peptide JQ707332_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707333_HBe_P-A Product feature CHAIN JQ707333_HBe_P-A of FT:mat_peptide JQ707333_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707334_HBe_P-A Product feature CHAIN JQ707334_HBe_P-A of FT:mat_peptide JQ707334_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707335_HBe_P-A Product feature CHAIN JQ707335_HBe_P-A of FT:mat_peptide JQ707335_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707336_HBe_P-A Product feature CHAIN JQ707336_HBe_P-A of FT:mat_peptide JQ707336_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALHREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707337_HBe_P-A Product feature CHAIN JQ707337_HBe_P-A of FT:mat_peptide JQ707337_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707338_HBe_P-A Product feature CHAIN JQ707338_HBe_P-A of FT:mat_peptide JQ707338_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707339_HBe_P-A Product feature CHAIN JQ707339_HBe_P-A of FT:mat_peptide JQ707339_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALGSPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707340_HBe_P-A Product feature CHAIN JQ707340_HBe_P-A of FT:mat_peptide JQ707340_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707341_HBe_P-A Product feature CHAIN JQ707341_HBe_P-A of FT:mat_peptide JQ707341_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
FKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707342_HBe_P-A Product feature CHAIN JQ707342_HBe_P-A of FT:mat_peptide JQ707342_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707343_HBe_P-A Product feature CHAIN JQ707343_HBe_P-A of FT:mat_peptide JQ707343_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707344_HBe_P-A Product feature CHAIN JQ707344_HBe_P-A of FT:mat_peptide JQ707344_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707345_HBe_P-A Product feature CHAIN JQ707345_HBe_P-A of FT:mat_peptide JQ707345_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELVSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707346_HBe_P-A Product feature CHAIN JQ707346_HBe_P-A of FT:mat_peptide JQ707346_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQEPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707347_HBe_P-A Product feature CHAIN JQ707347_HBe_P-A of FT:mat_peptide JQ707347_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707348_HBe_P-A Product feature CHAIN JQ707348_HBe_P-A of FT:mat_peptide JQ707348_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707349_HBe_P-A Product feature CHAIN JQ707349_HBe_P-A of FT:mat_peptide JQ707349_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707350_HBe_P-A Product feature CHAIN JQ707350_HBe_P-A of FT:mat_peptide JQ707350_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707351_HBe_P-A Product feature CHAIN JQ707351_HBe_P-A of FT:mat_peptide JQ707351_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707352_HBe_P-A Product feature CHAIN JQ707352_HBe_P-A of FT:mat_peptide JQ707352_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707353_HBe_P-A Product feature CHAIN JQ707353_HBe_P-A of FT:mat_peptide JQ707353_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707354_HBe_P-A Product feature CHAIN JQ707354_HBe_P-A of FT:mat_peptide JQ707354_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707355_HBe_P-A Product feature CHAIN JQ707355_HBe_P-A of FT:mat_peptide JQ707355_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707356_HBe_P-A Product feature CHAIN JQ707356_HBe_P-A of FT:mat_peptide JQ707356_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707357_HBe_P-A Product feature CHAIN JQ707357_HBe_P-A of FT:mat_peptide JQ707357_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707358_HBe_P-A Product feature CHAIN JQ707358_HBe_P-A of FT:mat_peptide JQ707358_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707359_HBe_P-A Product feature CHAIN JQ707359_HBe_P-A of FT:mat_peptide JQ707359_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
FKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707360_HBe_P-A Product feature CHAIN JQ707360_HBe_P-A of FT:mat_peptide JQ707360_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707361_HBe_P-A Product feature CHAIN JQ707361_HBe_P-A of FT:mat_peptide JQ707361_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707362_HBe_P-A Product feature CHAIN JQ707362_HBe_P-A of FT:mat_peptide JQ707362_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707363_HBe_P-A Product feature CHAIN JQ707363_HBe_P-A of FT:mat_peptide JQ707363_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707364_HBe_P-A Product feature CHAIN JQ707364_HBe_P-A of FT:mat_peptide JQ707364_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707365_HBe_P-A Product feature CHAIN JQ707365_HBe_P-A of FT:mat_peptide JQ707365_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707366_HBe_P-A Product feature CHAIN JQ707366_HBe_P-A of FT:mat_peptide JQ707366_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707367_HBe_P-A Product feature CHAIN JQ707367_HBe_P-A of FT:mat_peptide JQ707367_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707368_HBe_P-A Product feature CHAIN JQ707368_HBe_P-A of FT:mat_peptide JQ707368_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPSKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707369_HBe_P-A Product feature CHAIN JQ707369_HBe_P-A of FT:mat_peptide JQ707369_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707370_HBe_P-A Product feature CHAIN JQ707370_HBe_P-A of FT:mat_peptide JQ707370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BMM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707371_HBe_P-A Product feature CHAIN JQ707371_HBe_P-A of FT:mat_peptide JQ707371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707372_HBe_P-A Product feature CHAIN JQ707372_HBe_P-A of FT:mat_peptide JQ707372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707373_HBe_P-A Product feature CHAIN JQ707373_HBe_P-A of FT:mat_peptide JQ707373_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707374_HBe_P-A Product feature CHAIN JQ707374_HBe_P-A of FT:mat_peptide JQ707374_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707375_HBe_P-A Product feature CHAIN JQ707375_HBe_P-A of FT:mat_peptide JQ707375_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707376_HBe_P-A Product feature CHAIN JQ707376_HBe_P-A of FT:mat_peptide JQ707376_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707377_HBe_P-A Product feature CHAIN JQ707377_HBe_P-A of FT:mat_peptide JQ707377_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707378_HBe_P-A Product feature CHAIN JQ707378_HBe_P-A of FT:mat_peptide JQ707378_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707379_HBe_P-A Product feature CHAIN JQ707379_HBe_P-A of FT:mat_peptide JQ707379_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707380_HBe_P-A Product feature CHAIN JQ707380_HBe_P-A of FT:mat_peptide JQ707380_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707381_HBe_P-A Product feature CHAIN JQ707381_HBe_P-A of FT:mat_peptide JQ707381_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707382_HBe_P-A Product feature CHAIN JQ707382_HBe_P-A of FT:mat_peptide JQ707382_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVDNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707383_HBe_P-A Product feature CHAIN JQ707383_HBe_P-A of FT:mat_peptide JQ707383_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707384_HBe_P-A Product feature CHAIN JQ707384_HBe_P-A of FT:mat_peptide JQ707384_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707385_HBe_P-A Product feature CHAIN JQ707385_HBe_P-A of FT:mat_peptide JQ707385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707386_HBe_P-A Product feature CHAIN JQ707386_HBe_P-A of FT:mat_peptide JQ707386_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707387_HBe_P-A Product feature CHAIN JQ707387_HBe_P-A of FT:mat_peptide JQ707387_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707388_HBe_P-A Product feature CHAIN JQ707388_HBe_P-A of FT:mat_peptide JQ707388_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLLVNYVNGDMGLKIRQLGRFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707389_HBe_P-A Product feature CHAIN JQ707389_HBe_P-A of FT:mat_peptide JQ707389_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707390_HBe_P-A Product feature CHAIN JQ707390_HBe_P-A of FT:mat_peptide JQ707390_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707391_HBe_P-A Product feature CHAIN JQ707391_HBe_P-A of FT:mat_peptide JQ707391_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707392_HBe_P-A Product feature CHAIN JQ707392_HBe_P-A of FT:mat_peptide JQ707392_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707393_HBe_P-A Product feature CHAIN JQ707393_HBe_P-A of FT:mat_peptide JQ707393_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707394_HBe_P-A Product feature CHAIN JQ707394_HBe_P-A of FT:mat_peptide JQ707394_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707395_HBe_P-A Product feature CHAIN JQ707395_HBe_P-A of FT:mat_peptide JQ707395_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707396_HBe_P-A Product feature CHAIN JQ707396_HBe_P-A of FT:mat_peptide JQ707396_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYINTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707397_HBe_P-A Product feature CHAIN JQ707397_HBe_P-A of FT:mat_peptide JQ707397_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707398_HBe_P-A Product feature CHAIN JQ707398_HBe_P-A of FT:mat_peptide JQ707398_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707399_HBe_P-A Product feature CHAIN JQ707399_HBe_P-A of FT:mat_peptide JQ707399_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707400_HBe_P-A Product feature CHAIN JQ707400_HBe_P-A of FT:mat_peptide JQ707400_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707401_HBe_P-A Product feature CHAIN JQ707401_HBe_P-A of FT:mat_peptide JQ707401_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707402_HBe_P-A Product feature CHAIN JQ707402_HBe_P-A of FT:mat_peptide JQ707402_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707403_HBe_P-A Product feature CHAIN JQ707403_HBe_P-A of FT:mat_peptide JQ707403_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707404_HBe_P-A Product feature CHAIN JQ707404_HBe_P-A of FT:mat_peptide JQ707404_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707405_HBe_P-A Product feature CHAIN JQ707405_HBe_P-A of FT:mat_peptide JQ707405_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707406_HBe_P-A Product feature CHAIN JQ707406_HBe_P-A of FT:mat_peptide JQ707406_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707407_HBe_P-A Product feature CHAIN JQ707407_HBe_P-A of FT:mat_peptide JQ707407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707408_HBe_P-A Product feature CHAIN JQ707408_HBe_P-A of FT:mat_peptide JQ707408_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707409_HBe_P-A Product feature CHAIN JQ707409_HBe_P-A of FT:mat_peptide JQ707409_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707410_HBe_P-A Product feature CHAIN JQ707410_HBe_P-A of FT:mat_peptide JQ707410_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707411_HBe_P-A Product feature CHAIN JQ707411_HBe_P-A of FT:mat_peptide JQ707411_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707412_HBe_P-A Product feature CHAIN JQ707412_HBe_P-A of FT:mat_peptide JQ707412_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707413_HBe_P-A Product feature CHAIN JQ707413_HBe_P-A of FT:mat_peptide JQ707413_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707414_HBe_P-A Product feature CHAIN JQ707414_HBe_P-A of FT:mat_peptide JQ707414_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASTLYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707415_HBe_P-A Product feature CHAIN JQ707415_HBe_P-A of FT:mat_peptide JQ707415_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707416_HBe_P-A Product feature CHAIN JQ707416_HBe_P-A of FT:mat_peptide JQ707416_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707417_HBe_P-A Product feature CHAIN JQ707417_HBe_P-A of FT:mat_peptide JQ707417_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707418_HBe_P-A Product feature CHAIN JQ707418_HBe_P-A of FT:mat_peptide JQ707418_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707419_HBe_P-A Product feature CHAIN JQ707419_HBe_P-A of FT:mat_peptide JQ707419_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707420_HBe_P-A Product feature CHAIN JQ707420_HBe_P-A of FT:mat_peptide JQ707420_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HOLA3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707531_HBe_P-A Product feature CHAIN JQ707531_HBe_P-A of FT:mat_peptide JQ707531_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707532_HBe_P-A Product feature CHAIN JQ707532_HBe_P-A of FT:mat_peptide JQ707532_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707533_HBe_P-A Product feature CHAIN JQ707533_HBe_P-A of FT:mat_peptide JQ707533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707534_HBe_P-A Product feature CHAIN JQ707534_HBe_P-A of FT:mat_peptide JQ707534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707535_HBe_P-A Product feature CHAIN JQ707535_HBe_P-A of FT:mat_peptide JQ707535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707536_HBe_P-A Product feature CHAIN JQ707536_HBe_P-A of FT:mat_peptide JQ707536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707537_HBe_P-A Product feature CHAIN JQ707537_HBe_P-A of FT:mat_peptide JQ707537_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707538_HBe_P-A Product feature CHAIN JQ707538_HBe_P-A of FT:mat_peptide JQ707538_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707539_HBe_P-A Product feature CHAIN JQ707539_HBe_P-A of FT:mat_peptide JQ707539_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707540_HBe_P-A Product feature CHAIN JQ707540_HBe_P-A of FT:mat_peptide JQ707540_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707541_HBe_P-A Product feature CHAIN JQ707541_HBe_P-A of FT:mat_peptide JQ707541_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707542_HBe_P-A Product feature CHAIN JQ707542_HBe_P-A of FT:mat_peptide JQ707542_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707543_HBe_P-A Product feature CHAIN JQ707543_HBe_P-A of FT:mat_peptide JQ707543_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707544_HBe_P-A Product feature CHAIN JQ707544_HBe_P-A of FT:mat_peptide JQ707544_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707545_HBe_P-A Product feature CHAIN JQ707545_HBe_P-A of FT:mat_peptide JQ707545_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707546_HBe_P-A Product feature CHAIN JQ707546_HBe_P-A of FT:mat_peptide JQ707546_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707547_HBe_P-A Product feature CHAIN JQ707547_HBe_P-A of FT:mat_peptide JQ707547_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707548_HBe_P-A Product feature CHAIN JQ707548_HBe_P-A of FT:mat_peptide JQ707548_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707549_HBe_P-A Product feature CHAIN JQ707549_HBe_P-A of FT:mat_peptide JQ707549_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707550_HBe_P-A Product feature CHAIN JQ707550_HBe_P-A of FT:mat_peptide JQ707550_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707551_HBe_P-A Product feature CHAIN JQ707551_HBe_P-A of FT:mat_peptide JQ707551_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707552_HBe_P-A Product feature CHAIN JQ707552_HBe_P-A of FT:mat_peptide JQ707552_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707553_HBe_P-A Product feature CHAIN JQ707553_HBe_P-A of FT:mat_peptide JQ707553_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707554_HBe_P-A Product feature CHAIN JQ707554_HBe_P-A of FT:mat_peptide JQ707554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707555_HBe_P-A Product feature CHAIN JQ707555_HBe_P-A of FT:mat_peptide JQ707555_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707556_HBe_P-A Product feature CHAIN JQ707556_HBe_P-A of FT:mat_peptide JQ707556_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707557_HBe_P-A Product feature CHAIN JQ707557_HBe_P-A of FT:mat_peptide JQ707557_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707558_HBe_P-A Product feature CHAIN JQ707558_HBe_P-A of FT:mat_peptide JQ707558_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707559_HBe_P-A Product feature CHAIN JQ707559_HBe_P-A of FT:mat_peptide JQ707559_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707560_HBe_P-A Product feature CHAIN JQ707560_HBe_P-A of FT:mat_peptide JQ707560_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707561_HBe_P-A Product feature CHAIN JQ707561_HBe_P-A of FT:mat_peptide JQ707561_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707562_HBe_P-A Product feature CHAIN JQ707562_HBe_P-A of FT:mat_peptide JQ707562_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707563_HBe_P-A Product feature CHAIN JQ707563_HBe_P-A of FT:mat_peptide JQ707563_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707564_HBe_P-A Product feature CHAIN JQ707564_HBe_P-A of FT:mat_peptide JQ707564_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707565_HBe_P-A Product feature CHAIN JQ707565_HBe_P-A of FT:mat_peptide JQ707565_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHSSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707566_HBe_P-A Product feature CHAIN JQ707566_HBe_P-A of FT:mat_peptide JQ707566_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707567_HBe_P-A Product feature CHAIN JQ707567_HBe_P-A of FT:mat_peptide JQ707567_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707568_HBe_P-A Product feature CHAIN JQ707568_HBe_P-A of FT:mat_peptide JQ707568_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707569_HBe_P-A Product feature CHAIN JQ707569_HBe_P-A of FT:mat_peptide JQ707569_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707570_HBe_P-A Product feature CHAIN JQ707570_HBe_P-A of FT:mat_peptide JQ707570_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707571_HBe_P-A Product feature CHAIN JQ707571_HBe_P-A of FT:mat_peptide JQ707571_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707572_HBe_P-A Product feature CHAIN JQ707572_HBe_P-A of FT:mat_peptide JQ707572_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707573_HBe_P-A Product feature CHAIN JQ707573_HBe_P-A of FT:mat_peptide JQ707573_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707574_HBe_P-A Product feature CHAIN JQ707574_HBe_P-A of FT:mat_peptide JQ707574_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707575_HBe_P-A Product feature CHAIN JQ707575_HBe_P-A of FT:mat_peptide JQ707575_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707576_HBe_P-A Product feature CHAIN JQ707576_HBe_P-A of FT:mat_peptide JQ707576_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMNIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707577_HBe_P-A Product feature CHAIN JQ707577_HBe_P-A of FT:mat_peptide JQ707577_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707578_HBe_P-A Product feature CHAIN JQ707578_HBe_P-A of FT:mat_peptide JQ707578_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLLFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707579_HBe_P-A Product feature CHAIN JQ707579_HBe_P-A of FT:mat_peptide JQ707579_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707580_HBe_P-A Product feature CHAIN JQ707580_HBe_P-A of FT:mat_peptide JQ707580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707581_HBe_P-A Product feature CHAIN JQ707581_HBe_P-A of FT:mat_peptide JQ707581_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707582_HBe_P-A Product feature CHAIN JQ707582_HBe_P-A of FT:mat_peptide JQ707582_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707583_HBe_P-A Product feature CHAIN JQ707583_HBe_P-A of FT:mat_peptide JQ707583_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707584_HBe_P-A Product feature CHAIN JQ707584_HBe_P-A of FT:mat_peptide JQ707584_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707585_HBe_P-A Product feature CHAIN JQ707585_HBe_P-A of FT:mat_peptide JQ707585_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707586_HBe_P-A Product feature CHAIN JQ707586_HBe_P-A of FT:mat_peptide JQ707586_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707587_HBe_P-A Product feature CHAIN JQ707587_HBe_P-A of FT:mat_peptide JQ707587_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707588_HBe_P-A Product feature CHAIN JQ707588_HBe_P-A of FT:mat_peptide JQ707588_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707589_HBe_P-A Product feature CHAIN JQ707589_HBe_P-A of FT:mat_peptide JQ707589_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707590_HBe_P-A Product feature CHAIN JQ707590_HBe_P-A of FT:mat_peptide JQ707590_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707591_HBe_P-A Product feature CHAIN JQ707591_HBe_P-A of FT:mat_peptide JQ707591_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707592_HBe_P-A Product feature CHAIN JQ707592_HBe_P-A of FT:mat_peptide JQ707592_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707593_HBe_P-A Product feature CHAIN JQ707593_HBe_P-A of FT:mat_peptide JQ707593_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLAFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707594_HBe_P-A Product feature CHAIN JQ707594_HBe_P-A of FT:mat_peptide JQ707594_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707595_HBe_P-A Product feature CHAIN JQ707595_HBe_P-A of FT:mat_peptide JQ707595_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707596_HBe_P-A Product feature CHAIN JQ707596_HBe_P-A of FT:mat_peptide JQ707596_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707597_HBe_P-A Product feature CHAIN JQ707597_HBe_P-A of FT:mat_peptide JQ707597_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707598_HBe_P-A Product feature CHAIN JQ707598_HBe_P-A of FT:mat_peptide JQ707598_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707599_HBe_P-A Product feature CHAIN JQ707599_HBe_P-A of FT:mat_peptide JQ707599_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707600_HBe_P-A Product feature CHAIN JQ707600_HBe_P-A of FT:mat_peptide JQ707600_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707601_HBe_P-A Product feature CHAIN JQ707601_HBe_P-A of FT:mat_peptide JQ707601_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707602_HBe_P-A Product feature CHAIN JQ707602_HBe_P-A of FT:mat_peptide JQ707602_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGKLMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707603_HBe_P-A Product feature CHAIN JQ707603_HBe_P-A of FT:mat_peptide JQ707603_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707604_HBe_P-A Product feature CHAIN JQ707604_HBe_P-A of FT:mat_peptide JQ707604_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707605_HBe_P-A Product feature CHAIN JQ707605_HBe_P-A of FT:mat_peptide JQ707605_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQDILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLTIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707606_HBe_P-A Product feature CHAIN JQ707606_HBe_P-A of FT:mat_peptide JQ707606_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707607_HBe_P-A Product feature CHAIN JQ707607_HBe_P-A of FT:mat_peptide JQ707607_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707608_HBe_P-A Product feature CHAIN JQ707608_HBe_P-A of FT:mat_peptide JQ707608_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PM3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707609_HBe_P-A Product feature CHAIN JQ707609_HBe_P-A of FT:mat_peptide JQ707609_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707610_HBe_P-A Product feature CHAIN JQ707610_HBe_P-A of FT:mat_peptide JQ707610_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707611_HBe_P-A Product feature CHAIN JQ707611_HBe_P-A of FT:mat_peptide JQ707611_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707612_HBe_P-A Product feature CHAIN JQ707612_HBe_P-A of FT:mat_peptide JQ707612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707613_HBe_P-A Product feature CHAIN JQ707613_HBe_P-A of FT:mat_peptide JQ707613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707614_HBe_P-A Product feature CHAIN JQ707614_HBe_P-A of FT:mat_peptide JQ707614_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707615_HBe_P-A Product feature CHAIN JQ707615_HBe_P-A of FT:mat_peptide JQ707615_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707616_HBe_P-A Product feature CHAIN JQ707616_HBe_P-A of FT:mat_peptide JQ707616_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707617_HBe_P-A Product feature CHAIN JQ707617_HBe_P-A of FT:mat_peptide JQ707617_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707618_HBe_P-A Product feature CHAIN JQ707618_HBe_P-A of FT:mat_peptide JQ707618_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707619_HBe_P-A Product feature CHAIN JQ707619_HBe_P-A of FT:mat_peptide JQ707619_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707620_HBe_P-A Product feature CHAIN JQ707620_HBe_P-A of FT:mat_peptide JQ707620_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707621_HBe_P-A Product feature CHAIN JQ707621_HBe_P-A of FT:mat_peptide JQ707621_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707622_HBe_P-A Product feature CHAIN JQ707622_HBe_P-A of FT:mat_peptide JQ707622_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707623_HBe_P-A Product feature CHAIN JQ707623_HBe_P-A of FT:mat_peptide JQ707623_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEFPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707624_HBe_P-A Product feature CHAIN JQ707624_HBe_P-A of FT:mat_peptide JQ707624_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707625_HBe_P-A Product feature CHAIN JQ707625_HBe_P-A of FT:mat_peptide JQ707625_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707626_HBe_P-A Product feature CHAIN JQ707626_HBe_P-A of FT:mat_peptide JQ707626_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707627_HBe_P-A Product feature CHAIN JQ707627_HBe_P-A of FT:mat_peptide JQ707627_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707628_HBe_P-A Product feature CHAIN JQ707628_HBe_P-A of FT:mat_peptide JQ707628_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707629_HBe_P-A Product feature CHAIN JQ707629_HBe_P-A of FT:mat_peptide JQ707629_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707630_HBe_P-A Product feature CHAIN JQ707630_HBe_P-A of FT:mat_peptide JQ707630_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707631_HBe_P-A Product feature CHAIN JQ707631_HBe_P-A of FT:mat_peptide JQ707631_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707632_HBe_P-A Product feature CHAIN JQ707632_HBe_P-A of FT:mat_peptide JQ707632_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707633_HBe_P-A Product feature CHAIN JQ707633_HBe_P-A of FT:mat_peptide JQ707633_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707634_HBe_P-A Product feature CHAIN JQ707634_HBe_P-A of FT:mat_peptide JQ707634_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRELVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707635_HBe_P-A Product feature CHAIN JQ707635_HBe_P-A of FT:mat_peptide JQ707635_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707636_HBe_P-A Product feature CHAIN JQ707636_HBe_P-A of FT:mat_peptide JQ707636_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707637_HBe_P-A Product feature CHAIN JQ707637_HBe_P-A of FT:mat_peptide JQ707637_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707638_HBe_P-A Product feature CHAIN JQ707638_HBe_P-A of FT:mat_peptide JQ707638_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707639_HBe_P-A Product feature CHAIN JQ707639_HBe_P-A of FT:mat_peptide JQ707639_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707640_HBe_P-A Product feature CHAIN JQ707640_HBe_P-A of FT:mat_peptide JQ707640_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707641_HBe_P-A Product feature CHAIN JQ707641_HBe_P-A of FT:mat_peptide JQ707641_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707642_HBe_P-A Product feature CHAIN JQ707642_HBe_P-A of FT:mat_peptide JQ707642_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707643_HBe_P-A Product feature CHAIN JQ707643_HBe_P-A of FT:mat_peptide JQ707643_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707644_HBe_P-A Product feature CHAIN JQ707644_HBe_P-A of FT:mat_peptide JQ707644_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707645_HBe_P-A Product feature CHAIN JQ707645_HBe_P-A of FT:mat_peptide JQ707645_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707646_HBe_P-A Product feature CHAIN JQ707646_HBe_P-A of FT:mat_peptide JQ707646_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707647_HBe_P-A Product feature CHAIN JQ707647_HBe_P-A of FT:mat_peptide JQ707647_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707648_HBe_P-A Product feature CHAIN JQ707648_HBe_P-A of FT:mat_peptide JQ707648_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707649_HBe_P-A Product feature CHAIN JQ707649_HBe_P-A of FT:mat_peptide JQ707649_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707650_HBe_P-A Product feature CHAIN JQ707650_HBe_P-A of FT:mat_peptide JQ707650_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707651_HBe_P-A Product feature CHAIN JQ707651_HBe_P-A of FT:mat_peptide JQ707651_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707652_HBe_P-A Product feature CHAIN JQ707652_HBe_P-A of FT:mat_peptide JQ707652_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707653_HBe_P-A Product feature CHAIN JQ707653_HBe_P-A of FT:mat_peptide JQ707653_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707654_HBe_P-A Product feature CHAIN JQ707654_HBe_P-A of FT:mat_peptide JQ707654_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707655_HBe_P-A Product feature CHAIN JQ707655_HBe_P-A of FT:mat_peptide JQ707655_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRELLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707656_HBe_P-A Product feature CHAIN JQ707656_HBe_P-A of FT:mat_peptide JQ707656_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RT3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707658_HBe_P-A Product feature CHAIN JQ707658_HBe_P-A of FT:mat_peptide JQ707658_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707659_HBe_P-A Product feature CHAIN JQ707659_HBe_P-A of FT:mat_peptide JQ707659_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707661_HBe_P-A Product feature CHAIN JQ707661_HBe_P-A of FT:mat_peptide JQ707661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_18). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707662_HBe_P-A Product feature CHAIN JQ707662_HBe_P-A of FT:mat_peptide JQ707662_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_19). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707663_HBe_P-A Product feature CHAIN JQ707663_HBe_P-A of FT:mat_peptide JQ707663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707664_HBe_P-A Product feature CHAIN JQ707664_HBe_P-A of FT:mat_peptide JQ707664_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_20). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707665_HBe_P-A Product feature CHAIN JQ707665_HBe_P-A of FT:mat_peptide JQ707665_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_21). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707667_HBe_P-A Product feature CHAIN JQ707667_HBe_P-A of FT:mat_peptide JQ707667_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_25). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707669_HBe_P-A Product feature CHAIN JQ707669_HBe_P-A of FT:mat_peptide JQ707669_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_28). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707670_HBe_P-A Product feature CHAIN JQ707670_HBe_P-A of FT:mat_peptide JQ707670_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_29). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707672_HBe_P-A Product feature CHAIN JQ707672_HBe_P-A of FT:mat_peptide JQ707672_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_32). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707674_HBe_P-A Product feature CHAIN JQ707674_HBe_P-A of FT:mat_peptide JQ707674_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_38). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707675_HBe_P-A Product feature CHAIN JQ707675_HBe_P-A of FT:mat_peptide JQ707675_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_41). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707676_HBe_P-A Product feature CHAIN JQ707676_HBe_P-A of FT:mat_peptide JQ707676_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_42). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ707681_HBe_P-A Product feature CHAIN JQ707681_HBe_P-A of FT:mat_peptide JQ707681_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate S11_9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX079944_HBe_P-A Product feature CHAIN JX079944_HBe_P-A of FT:mat_peptide JX079944_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FF4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX079945_HBe_P-A Product feature CHAIN JX079945_HBe_P-A of FT:mat_peptide JX079945_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FF6). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASMDLVVHYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX096952_HBe_P-A Product feature CHAIN JX096952_HBe_P-A of FT:mat_peptide JX096952_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX096953_HBe_P-A Product feature CHAIN JX096953_HBe_P-A of FT:mat_peptide JX096953_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELPSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX154579_HBe_P-A Product feature CHAIN JX154579_HBe_P-A of FT:mat_peptide JX154579_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS36). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX154580_HBe_P-A Product feature CHAIN JX154580_HBe_P-A of FT:mat_peptide JX154580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS46). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX154581_HBe_P-A Product feature CHAIN JX154581_HBe_P-A of FT:mat_peptide JX154581_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS51). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX154582_HBe_P-A Product feature CHAIN JX154582_HBe_P-A of FT:mat_peptide JX154582_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBVFLS64). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX310721_HBe_P-A Product feature CHAIN JX310721_HBe_P-A of FT:mat_peptide JX310721_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX310722_HBe_P-A Product feature CHAIN JX310722_HBe_P-A of FT:mat_peptide JX310722_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX310723_HBe_P-A Product feature CHAIN JX310723_HBe_P-A of FT:mat_peptide JX310723_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX310725_HBe_P-A Product feature CHAIN JX310725_HBe_P-A of FT:mat_peptide JX310725_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate D3). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC836831_HBe_P-A Product feature CHAIN KC836831_HBe_P-A of FT:mat_peptide KC836831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC836832_HBe_P-A Product feature CHAIN KC836832_HBe_P-A of FT:mat_peptide KC836832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC836834_HBe_P-A Product feature CHAIN KC836834_HBe_P-A of FT:mat_peptide KC836834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH5). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC836846_HBe_P-A Product feature CHAIN KC836846_HBe_P-A of FT:mat_peptide KC836846_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC836849_HBe_P-A Product feature CHAIN KC836849_HBe_P-A of FT:mat_peptide KC836849_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC836854_HBe_P-A Product feature CHAIN KC836854_HBe_P-A of FT:mat_peptide KC836854_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC836858_HBe_P-A Product feature CHAIN KC836858_HBe_P-A of FT:mat_peptide KC836858_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AH38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC875251_HBe_P-A Product feature CHAIN KC875251_HBe_P-A of FT:mat_peptide KC875251_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALGSPEHCSPHHPALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC875252_HBe_P-A Product feature CHAIN KC875252_HBe_P-A of FT:mat_peptide KC875252_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIHCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC875253_HBe_P-A Product feature CHAIN KC875253_HBe_P-A of FT:mat_peptide KC875253_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV23). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDVDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC875255_HBe_P-A Product feature CHAIN KC875255_HBe_P-A of FT:mat_peptide KC875255_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV24). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVPFGVW
>gnl|hbvpro|KC875256_HBe_P-A Product feature CHAIN KC875256_HBe_P-A of FT:mat_peptide KC875256_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV27). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCAPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC875257_HBe_P-A Product feature CHAIN KC875257_HBe_P-A of FT:mat_peptide KC875257_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WAGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC875258_HBe_P-A Product feature CHAIN KC875258_HBe_P-A of FT:mat_peptide KC875258_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV66). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC875259_HBe_P-A Product feature CHAIN KC875259_HBe_P-A of FT:mat_peptide KC875259_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV73). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYQEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC875260_HBe_P-A Product feature CHAIN KC875260_HBe_P-A of FT:mat_peptide KC875260_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HBV5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|KC885087_HBe_P-A Product feature CHAIN KC885087_HBe_P-A of FT:mat_peptide KC885087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885088_HBe_P-A Product feature CHAIN KC885088_HBe_P-A of FT:mat_peptide KC885088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885089_HBe_P-A Product feature CHAIN KC885089_HBe_P-A of FT:mat_peptide KC885089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885090_HBe_P-A Product feature CHAIN KC885090_HBe_P-A of FT:mat_peptide KC885090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sexual02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885091_HBe_P-A Product feature CHAIN KC885091_HBe_P-A of FT:mat_peptide KC885091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885092_HBe_P-A Product feature CHAIN KC885092_HBe_P-A of FT:mat_peptide KC885092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885093_HBe_P-A Product feature CHAIN KC885093_HBe_P-A of FT:mat_peptide KC885093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885094_HBe_P-A Product feature CHAIN KC885094_HBe_P-A of FT:mat_peptide KC885094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885095_HBe_P-A Product feature CHAIN KC885095_HBe_P-A of FT:mat_peptide KC885095_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885097_HBe_P-A Product feature CHAIN KC885097_HBe_P-A of FT:mat_peptide KC885097_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885099_HBe_P-A Product feature CHAIN KC885099_HBe_P-A of FT:mat_peptide KC885099_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885100_HBe_P-A Product feature CHAIN KC885100_HBe_P-A of FT:mat_peptide KC885100_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885103_HBe_P-A Product feature CHAIN KC885103_HBe_P-A of FT:mat_peptide KC885103_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885105_HBe_P-A Product feature CHAIN KC885105_HBe_P-A of FT:mat_peptide KC885105_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885106_HBe_P-A Product feature CHAIN KC885106_HBe_P-A of FT:mat_peptide KC885106_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885107_HBe_P-A Product feature CHAIN KC885107_HBe_P-A of FT:mat_peptide KC885107_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885109_HBe_P-A Product feature CHAIN KC885109_HBe_P-A of FT:mat_peptide KC885109_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885112_HBe_P-A Product feature CHAIN KC885112_HBe_P-A of FT:mat_peptide KC885112_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885113_HBe_P-A Product feature CHAIN KC885113_HBe_P-A of FT:mat_peptide KC885113_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885114_HBe_P-A Product feature CHAIN KC885114_HBe_P-A of FT:mat_peptide KC885114_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAXALYREALESPEHCSPHHTALRQAIVCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885115_HBe_P-A Product feature CHAIN KC885115_HBe_P-A of FT:mat_peptide KC885115_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885116_HBe_P-A Product feature CHAIN KC885116_HBe_P-A of FT:mat_peptide KC885116_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885117_HBe_P-A Product feature CHAIN KC885117_HBe_P-A of FT:mat_peptide KC885117_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885118_HBe_P-A Product feature CHAIN KC885118_HBe_P-A of FT:mat_peptide KC885118_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885119_HBe_P-A Product feature CHAIN KC885119_HBe_P-A of FT:mat_peptide KC885119_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885121_HBe_P-A Product feature CHAIN KC885121_HBe_P-A of FT:mat_peptide KC885121_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885122_HBe_P-A Product feature CHAIN KC885122_HBe_P-A of FT:mat_peptide KC885122_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885123_HBe_P-A Product feature CHAIN KC885123_HBe_P-A of FT:mat_peptide KC885123_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885125_HBe_P-A Product feature CHAIN KC885125_HBe_P-A of FT:mat_peptide KC885125_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885126_HBe_P-A Product feature CHAIN KC885126_HBe_P-A of FT:mat_peptide KC885126_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885127_HBe_P-A Product feature CHAIN KC885127_HBe_P-A of FT:mat_peptide KC885127_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885128_HBe_P-A Product feature CHAIN KC885128_HBe_P-A of FT:mat_peptide KC885128_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885129_HBe_P-A Product feature CHAIN KC885129_HBe_P-A of FT:mat_peptide KC885129_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885130_HBe_P-A Product feature CHAIN KC885130_HBe_P-A of FT:mat_peptide KC885130_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885131_HBe_P-A Product feature CHAIN KC885131_HBe_P-A of FT:mat_peptide KC885131_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885132_HBe_P-A Product feature CHAIN KC885132_HBe_P-A of FT:mat_peptide KC885132_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885133_HBe_P-A Product feature CHAIN KC885133_HBe_P-A of FT:mat_peptide KC885133_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885135_HBe_P-A Product feature CHAIN KC885135_HBe_P-A of FT:mat_peptide KC885135_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885136_HBe_P-A Product feature CHAIN KC885136_HBe_P-A of FT:mat_peptide KC885136_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885137_HBe_P-A Product feature CHAIN KC885137_HBe_P-A of FT:mat_peptide KC885137_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885138_HBe_P-A Product feature CHAIN KC885138_HBe_P-A of FT:mat_peptide KC885138_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885139_HBe_P-A Product feature CHAIN KC885139_HBe_P-A of FT:mat_peptide KC885139_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885140_HBe_P-A Product feature CHAIN KC885140_HBe_P-A of FT:mat_peptide KC885140_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885141_HBe_P-A Product feature CHAIN KC885141_HBe_P-A of FT:mat_peptide KC885141_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885142_HBe_P-A Product feature CHAIN KC885142_HBe_P-A of FT:mat_peptide KC885142_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885143_HBe_P-A Product feature CHAIN KC885143_HBe_P-A of FT:mat_peptide KC885143_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885144_HBe_P-A Product feature CHAIN KC885144_HBe_P-A of FT:mat_peptide KC885144_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885145_HBe_P-A Product feature CHAIN KC885145_HBe_P-A of FT:mat_peptide KC885145_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885146_HBe_P-A Product feature CHAIN KC885146_HBe_P-A of FT:mat_peptide KC885146_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885147_HBe_P-A Product feature CHAIN KC885147_HBe_P-A of FT:mat_peptide KC885147_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASSSLLSFLPSDFFPSIRDLLDTAAALFQEALESPEHCSPHHTAIRQAVICWGELMTLAT
WVGSNLPDPQSRDLVVNYVNANMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KC885151_HBe_P-A Product feature CHAIN KC885151_HBe_P-A of FT:mat_peptide KC885151_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885152_HBe_P-A Product feature CHAIN KC885152_HBe_P-A of FT:mat_peptide KC885152_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sexual03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885154_HBe_P-A Product feature CHAIN KC885154_HBe_P-A of FT:mat_peptide KC885154_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885155_HBe_P-A Product feature CHAIN KC885155_HBe_P-A of FT:mat_peptide KC885155_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885157_HBe_P-A Product feature CHAIN KC885157_HBe_P-A of FT:mat_peptide KC885157_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885158_HBe_P-A Product feature CHAIN KC885158_HBe_P-A of FT:mat_peptide KC885158_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885159_HBe_P-A Product feature CHAIN KC885159_HBe_P-A of FT:mat_peptide KC885159_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885161_HBe_P-A Product feature CHAIN KC885161_HBe_P-A of FT:mat_peptide KC885161_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KC885162_HBe_P-A Product feature CHAIN KC885162_HBe_P-A of FT:mat_peptide KC885162_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885163_HBe_P-A Product feature CHAIN KC885163_HBe_P-A of FT:mat_peptide KC885163_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885164_HBe_P-A Product feature CHAIN KC885164_HBe_P-A of FT:mat_peptide KC885164_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885165_HBe_P-A Product feature CHAIN KC885165_HBe_P-A of FT:mat_peptide KC885165_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885166_HBe_P-A Product feature CHAIN KC885166_HBe_P-A of FT:mat_peptide KC885166_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885168_HBe_P-A Product feature CHAIN KC885168_HBe_P-A of FT:mat_peptide KC885168_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885169_HBe_P-A Product feature CHAIN KC885169_HBe_P-A of FT:mat_peptide KC885169_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885170_HBe_P-A Product feature CHAIN KC885170_HBe_P-A of FT:mat_peptide KC885170_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885172_HBe_P-A Product feature CHAIN KC885172_HBe_P-A of FT:mat_peptide KC885172_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885173_HBe_P-A Product feature CHAIN KC885173_HBe_P-A of FT:mat_peptide KC885173_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885174_HBe_P-A Product feature CHAIN KC885174_HBe_P-A of FT:mat_peptide KC885174_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885176_HBe_P-A Product feature CHAIN KC885176_HBe_P-A of FT:mat_peptide KC885176_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885177_HBe_P-A Product feature CHAIN KC885177_HBe_P-A of FT:mat_peptide KC885177_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885178_HBe_P-A Product feature CHAIN KC885178_HBe_P-A of FT:mat_peptide KC885178_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885179_HBe_P-A Product feature CHAIN KC885179_HBe_P-A of FT:mat_peptide KC885179_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885180_HBe_P-A Product feature CHAIN KC885180_HBe_P-A of FT:mat_peptide KC885180_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885181_HBe_P-A Product feature CHAIN KC885181_HBe_P-A of FT:mat_peptide KC885181_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885182_HBe_P-A Product feature CHAIN KC885182_HBe_P-A of FT:mat_peptide KC885182_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885184_HBe_P-A Product feature CHAIN KC885184_HBe_P-A of FT:mat_peptide KC885184_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885186_HBe_P-A Product feature CHAIN KC885186_HBe_P-A of FT:mat_peptide KC885186_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM37). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885187_HBe_P-A Product feature CHAIN KC885187_HBe_P-A of FT:mat_peptide KC885187_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885188_HBe_P-A Product feature CHAIN KC885188_HBe_P-A of FT:mat_peptide KC885188_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885189_HBe_P-A Product feature CHAIN KC885189_HBe_P-A of FT:mat_peptide KC885189_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero46). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885190_HBe_P-A Product feature CHAIN KC885190_HBe_P-A of FT:mat_peptide KC885190_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885192_HBe_P-A Product feature CHAIN KC885192_HBe_P-A of FT:mat_peptide KC885192_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885194_HBe_P-A Product feature CHAIN KC885194_HBe_P-A of FT:mat_peptide KC885194_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885195_HBe_P-A Product feature CHAIN KC885195_HBe_P-A of FT:mat_peptide KC885195_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM39). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885196_HBe_P-A Product feature CHAIN KC885196_HBe_P-A of FT:mat_peptide KC885196_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM40). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885197_HBe_P-A Product feature CHAIN KC885197_HBe_P-A of FT:mat_peptide KC885197_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885198_HBe_P-A Product feature CHAIN KC885198_HBe_P-A of FT:mat_peptide KC885198_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885199_HBe_P-A Product feature CHAIN KC885199_HBe_P-A of FT:mat_peptide KC885199_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885201_HBe_P-A Product feature CHAIN KC885201_HBe_P-A of FT:mat_peptide KC885201_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885202_HBe_P-A Product feature CHAIN KC885202_HBe_P-A of FT:mat_peptide KC885202_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885203_HBe_P-A Product feature CHAIN KC885203_HBe_P-A of FT:mat_peptide KC885203_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885204_HBe_P-A Product feature CHAIN KC885204_HBe_P-A of FT:mat_peptide KC885204_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885205_HBe_P-A Product feature CHAIN KC885205_HBe_P-A of FT:mat_peptide KC885205_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885206_HBe_P-A Product feature CHAIN KC885206_HBe_P-A of FT:mat_peptide KC885206_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885208_HBe_P-A Product feature CHAIN KC885208_HBe_P-A of FT:mat_peptide KC885208_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885209_HBe_P-A Product feature CHAIN KC885209_HBe_P-A of FT:mat_peptide KC885209_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885213_HBe_P-A Product feature CHAIN KC885213_HBe_P-A of FT:mat_peptide KC885213_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885215_HBe_P-A Product feature CHAIN KC885215_HBe_P-A of FT:mat_peptide KC885215_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885216_HBe_P-A Product feature CHAIN KC885216_HBe_P-A of FT:mat_peptide KC885216_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885217_HBe_P-A Product feature CHAIN KC885217_HBe_P-A of FT:mat_peptide KC885217_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885218_HBe_P-A Product feature CHAIN KC885218_HBe_P-A of FT:mat_peptide KC885218_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885219_HBe_P-A Product feature CHAIN KC885219_HBe_P-A of FT:mat_peptide KC885219_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885221_HBe_P-A Product feature CHAIN KC885221_HBe_P-A of FT:mat_peptide KC885221_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885222_HBe_P-A Product feature CHAIN KC885222_HBe_P-A of FT:mat_peptide KC885222_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885223_HBe_P-A Product feature CHAIN KC885223_HBe_P-A of FT:mat_peptide KC885223_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885224_HBe_P-A Product feature CHAIN KC885224_HBe_P-A of FT:mat_peptide KC885224_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885225_HBe_P-A Product feature CHAIN KC885225_HBe_P-A of FT:mat_peptide KC885225_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885226_HBe_P-A Product feature CHAIN KC885226_HBe_P-A of FT:mat_peptide KC885226_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885227_HBe_P-A Product feature CHAIN KC885227_HBe_P-A of FT:mat_peptide KC885227_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885228_HBe_P-A Product feature CHAIN KC885228_HBe_P-A of FT:mat_peptide KC885228_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885229_HBe_P-A Product feature CHAIN KC885229_HBe_P-A of FT:mat_peptide KC885229_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885230_HBe_P-A Product feature CHAIN KC885230_HBe_P-A of FT:mat_peptide KC885230_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown03). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885232_HBe_P-A Product feature CHAIN KC885232_HBe_P-A of FT:mat_peptide KC885232_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885236_HBe_P-A Product feature CHAIN KC885236_HBe_P-A of FT:mat_peptide KC885236_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885237_HBe_P-A Product feature CHAIN KC885237_HBe_P-A of FT:mat_peptide KC885237_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885238_HBe_P-A Product feature CHAIN KC885238_HBe_P-A of FT:mat_peptide KC885238_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885239_HBe_P-A Product feature CHAIN KC885239_HBe_P-A of FT:mat_peptide KC885239_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885240_HBe_P-A Product feature CHAIN KC885240_HBe_P-A of FT:mat_peptide KC885240_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885241_HBe_P-A Product feature CHAIN KC885241_HBe_P-A of FT:mat_peptide KC885241_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sexual02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885242_HBe_P-A Product feature CHAIN KC885242_HBe_P-A of FT:mat_peptide KC885242_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885243_HBe_P-A Product feature CHAIN KC885243_HBe_P-A of FT:mat_peptide KC885243_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885244_HBe_P-A Product feature CHAIN KC885244_HBe_P-A of FT:mat_peptide KC885244_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885245_HBe_P-A Product feature CHAIN KC885245_HBe_P-A of FT:mat_peptide KC885245_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885246_HBe_P-A Product feature CHAIN KC885246_HBe_P-A of FT:mat_peptide KC885246_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885247_HBe_P-A Product feature CHAIN KC885247_HBe_P-A of FT:mat_peptide KC885247_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sexual03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885248_HBe_P-A Product feature CHAIN KC885248_HBe_P-A of FT:mat_peptide KC885248_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885249_HBe_P-A Product feature CHAIN KC885249_HBe_P-A of FT:mat_peptide KC885249_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885252_HBe_P-A Product feature CHAIN KC885252_HBe_P-A of FT:mat_peptide KC885252_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885253_HBe_P-A Product feature CHAIN KC885253_HBe_P-A of FT:mat_peptide KC885253_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885255_HBe_P-A Product feature CHAIN KC885255_HBe_P-A of FT:mat_peptide KC885255_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885256_HBe_P-A Product feature CHAIN KC885256_HBe_P-A of FT:mat_peptide KC885256_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885257_HBe_P-A Product feature CHAIN KC885257_HBe_P-A of FT:mat_peptide KC885257_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885258_HBe_P-A Product feature CHAIN KC885258_HBe_P-A of FT:mat_peptide KC885258_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885259_HBe_P-A Product feature CHAIN KC885259_HBe_P-A of FT:mat_peptide KC885259_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885261_HBe_P-A Product feature CHAIN KC885261_HBe_P-A of FT:mat_peptide KC885261_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885262_HBe_P-A Product feature CHAIN KC885262_HBe_P-A of FT:mat_peptide KC885262_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885263_HBe_P-A Product feature CHAIN KC885263_HBe_P-A of FT:mat_peptide KC885263_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sexual04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885264_HBe_P-A Product feature CHAIN KC885264_HBe_P-A of FT:mat_peptide KC885264_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885266_HBe_P-A Product feature CHAIN KC885266_HBe_P-A of FT:mat_peptide KC885266_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885269_HBe_P-A Product feature CHAIN KC885269_HBe_P-A of FT:mat_peptide KC885269_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885270_HBe_P-A Product feature CHAIN KC885270_HBe_P-A of FT:mat_peptide KC885270_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885271_HBe_P-A Product feature CHAIN KC885271_HBe_P-A of FT:mat_peptide KC885271_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sexual05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885273_HBe_P-A Product feature CHAIN KC885273_HBe_P-A of FT:mat_peptide KC885273_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885274_HBe_P-A Product feature CHAIN KC885274_HBe_P-A of FT:mat_peptide KC885274_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885275_HBe_P-A Product feature CHAIN KC885275_HBe_P-A of FT:mat_peptide KC885275_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero39). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885276_HBe_P-A Product feature CHAIN KC885276_HBe_P-A of FT:mat_peptide KC885276_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885280_HBe_P-A Product feature CHAIN KC885280_HBe_P-A of FT:mat_peptide KC885280_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885282_HBe_P-A Product feature CHAIN KC885282_HBe_P-A of FT:mat_peptide KC885282_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885283_HBe_P-A Product feature CHAIN KC885283_HBe_P-A of FT:mat_peptide KC885283_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885284_HBe_P-A Product feature CHAIN KC885284_HBe_P-A of FT:mat_peptide KC885284_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885287_HBe_P-A Product feature CHAIN KC885287_HBe_P-A of FT:mat_peptide KC885287_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885288_HBe_P-A Product feature CHAIN KC885288_HBe_P-A of FT:mat_peptide KC885288_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885289_HBe_P-A Product feature CHAIN KC885289_HBe_P-A of FT:mat_peptide KC885289_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885290_HBe_P-A Product feature CHAIN KC885290_HBe_P-A of FT:mat_peptide KC885290_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885292_HBe_P-A Product feature CHAIN KC885292_HBe_P-A of FT:mat_peptide KC885292_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885293_HBe_P-A Product feature CHAIN KC885293_HBe_P-A of FT:mat_peptide KC885293_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885295_HBe_P-A Product feature CHAIN KC885295_HBe_P-A of FT:mat_peptide KC885295_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885296_HBe_P-A Product feature CHAIN KC885296_HBe_P-A of FT:mat_peptide KC885296_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885297_HBe_P-A Product feature CHAIN KC885297_HBe_P-A of FT:mat_peptide KC885297_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885298_HBe_P-A Product feature CHAIN KC885298_HBe_P-A of FT:mat_peptide KC885298_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885299_HBe_P-A Product feature CHAIN KC885299_HBe_P-A of FT:mat_peptide KC885299_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885300_HBe_P-A Product feature CHAIN KC885300_HBe_P-A of FT:mat_peptide KC885300_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885301_HBe_P-A Product feature CHAIN KC885301_HBe_P-A of FT:mat_peptide KC885301_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885302_HBe_P-A Product feature CHAIN KC885302_HBe_P-A of FT:mat_peptide KC885302_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885303_HBe_P-A Product feature CHAIN KC885303_HBe_P-A of FT:mat_peptide KC885303_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM08). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885306_HBe_P-A Product feature CHAIN KC885306_HBe_P-A of FT:mat_peptide KC885306_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885307_HBe_P-A Product feature CHAIN KC885307_HBe_P-A of FT:mat_peptide KC885307_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885310_HBe_P-A Product feature CHAIN KC885310_HBe_P-A of FT:mat_peptide KC885310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885311_HBe_P-A Product feature CHAIN KC885311_HBe_P-A of FT:mat_peptide KC885311_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885312_HBe_P-A Product feature CHAIN KC885312_HBe_P-A of FT:mat_peptide KC885312_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885313_HBe_P-A Product feature CHAIN KC885313_HBe_P-A of FT:mat_peptide KC885313_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885314_HBe_P-A Product feature CHAIN KC885314_HBe_P-A of FT:mat_peptide KC885314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885315_HBe_P-A Product feature CHAIN KC885315_HBe_P-A of FT:mat_peptide KC885315_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885316_HBe_P-A Product feature CHAIN KC885316_HBe_P-A of FT:mat_peptide KC885316_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885318_HBe_P-A Product feature CHAIN KC885318_HBe_P-A of FT:mat_peptide KC885318_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885319_HBe_P-A Product feature CHAIN KC885319_HBe_P-A of FT:mat_peptide KC885319_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885320_HBe_P-A Product feature CHAIN KC885320_HBe_P-A of FT:mat_peptide KC885320_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885322_HBe_P-A Product feature CHAIN KC885322_HBe_P-A of FT:mat_peptide KC885322_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885323_HBe_P-A Product feature CHAIN KC885323_HBe_P-A of FT:mat_peptide KC885323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885324_HBe_P-A Product feature CHAIN KC885324_HBe_P-A of FT:mat_peptide KC885324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885325_HBe_P-A Product feature CHAIN KC885325_HBe_P-A of FT:mat_peptide KC885325_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885328_HBe_P-A Product feature CHAIN KC885328_HBe_P-A of FT:mat_peptide KC885328_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sexual02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885329_HBe_P-A Product feature CHAIN KC885329_HBe_P-A of FT:mat_peptide KC885329_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885330_HBe_P-A Product feature CHAIN KC885330_HBe_P-A of FT:mat_peptide KC885330_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885332_HBe_P-A Product feature CHAIN KC885332_HBe_P-A of FT:mat_peptide KC885332_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885335_HBe_P-A Product feature CHAIN KC885335_HBe_P-A of FT:mat_peptide KC885335_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885337_HBe_P-A Product feature CHAIN KC885337_HBe_P-A of FT:mat_peptide KC885337_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885338_HBe_P-A Product feature CHAIN KC885338_HBe_P-A of FT:mat_peptide KC885338_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885339_HBe_P-A Product feature CHAIN KC885339_HBe_P-A of FT:mat_peptide KC885339_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885340_HBe_P-A Product feature CHAIN KC885340_HBe_P-A of FT:mat_peptide KC885340_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885342_HBe_P-A Product feature CHAIN KC885342_HBe_P-A of FT:mat_peptide KC885342_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885343_HBe_P-A Product feature CHAIN KC885343_HBe_P-A of FT:mat_peptide KC885343_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885344_HBe_P-A Product feature CHAIN KC885344_HBe_P-A of FT:mat_peptide KC885344_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885346_HBe_P-A Product feature CHAIN KC885346_HBe_P-A of FT:mat_peptide KC885346_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885347_HBe_P-A Product feature CHAIN KC885347_HBe_P-A of FT:mat_peptide KC885347_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885348_HBe_P-A Product feature CHAIN KC885348_HBe_P-A of FT:mat_peptide KC885348_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown05). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885349_HBe_P-A Product feature CHAIN KC885349_HBe_P-A of FT:mat_peptide KC885349_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885350_HBe_P-A Product feature CHAIN KC885350_HBe_P-A of FT:mat_peptide KC885350_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885353_HBe_P-A Product feature CHAIN KC885353_HBe_P-A of FT:mat_peptide KC885353_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885355_HBe_P-A Product feature CHAIN KC885355_HBe_P-A of FT:mat_peptide KC885355_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM39). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885356_HBe_P-A Product feature CHAIN KC885356_HBe_P-A of FT:mat_peptide KC885356_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885359_HBe_P-A Product feature CHAIN KC885359_HBe_P-A of FT:mat_peptide KC885359_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885360_HBe_P-A Product feature CHAIN KC885360_HBe_P-A of FT:mat_peptide KC885360_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885361_HBe_P-A Product feature CHAIN KC885361_HBe_P-A of FT:mat_peptide KC885361_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885364_HBe_P-A Product feature CHAIN KC885364_HBe_P-A of FT:mat_peptide KC885364_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885365_HBe_P-A Product feature CHAIN KC885365_HBe_P-A of FT:mat_peptide KC885365_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM44). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885366_HBe_P-A Product feature CHAIN KC885366_HBe_P-A of FT:mat_peptide KC885366_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sexual03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|KC885371_HBe_P-A Product feature CHAIN KC885371_HBe_P-A of FT:mat_peptide KC885371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM49). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885373_HBe_P-A Product feature CHAIN KC885373_HBe_P-A of FT:mat_peptide KC885373_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885375_HBe_P-A Product feature CHAIN KC885375_HBe_P-A of FT:mat_peptide KC885375_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885376_HBe_P-A Product feature CHAIN KC885376_HBe_P-A of FT:mat_peptide KC885376_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM55). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885377_HBe_P-A Product feature CHAIN KC885377_HBe_P-A of FT:mat_peptide KC885377_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885378_HBe_P-A Product feature CHAIN KC885378_HBe_P-A of FT:mat_peptide KC885378_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM56). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885379_HBe_P-A Product feature CHAIN KC885379_HBe_P-A of FT:mat_peptide KC885379_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM62). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885381_HBe_P-A Product feature CHAIN KC885381_HBe_P-A of FT:mat_peptide KC885381_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885382_HBe_P-A Product feature CHAIN KC885382_HBe_P-A of FT:mat_peptide KC885382_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown33). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885383_HBe_P-A Product feature CHAIN KC885383_HBe_P-A of FT:mat_peptide KC885383_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM57). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885384_HBe_P-A Product feature CHAIN KC885384_HBe_P-A of FT:mat_peptide KC885384_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885388_HBe_P-A Product feature CHAIN KC885388_HBe_P-A of FT:mat_peptide KC885388_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885389_HBe_P-A Product feature CHAIN KC885389_HBe_P-A of FT:mat_peptide KC885389_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM60). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885390_HBe_P-A Product feature CHAIN KC885390_HBe_P-A of FT:mat_peptide KC885390_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate sexual01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885391_HBe_P-A Product feature CHAIN KC885391_HBe_P-A of FT:mat_peptide KC885391_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885393_HBe_P-A Product feature CHAIN KC885393_HBe_P-A of FT:mat_peptide KC885393_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885394_HBe_P-A Product feature CHAIN KC885394_HBe_P-A of FT:mat_peptide KC885394_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885396_HBe_P-A Product feature CHAIN KC885396_HBe_P-A of FT:mat_peptide KC885396_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885397_HBe_P-A Product feature CHAIN KC885397_HBe_P-A of FT:mat_peptide KC885397_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885398_HBe_P-A Product feature CHAIN KC885398_HBe_P-A of FT:mat_peptide KC885398_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885399_HBe_P-A Product feature CHAIN KC885399_HBe_P-A of FT:mat_peptide KC885399_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885402_HBe_P-A Product feature CHAIN KC885402_HBe_P-A of FT:mat_peptide KC885402_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885405_HBe_P-A Product feature CHAIN KC885405_HBe_P-A of FT:mat_peptide KC885405_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885406_HBe_P-A Product feature CHAIN KC885406_HBe_P-A of FT:mat_peptide KC885406_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM61). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885407_HBe_P-A Product feature CHAIN KC885407_HBe_P-A of FT:mat_peptide KC885407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885408_HBe_P-A Product feature CHAIN KC885408_HBe_P-A of FT:mat_peptide KC885408_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885409_HBe_P-A Product feature CHAIN KC885409_HBe_P-A of FT:mat_peptide KC885409_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885411_HBe_P-A Product feature CHAIN KC885411_HBe_P-A of FT:mat_peptide KC885411_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885412_HBe_P-A Product feature CHAIN KC885412_HBe_P-A of FT:mat_peptide KC885412_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885416_HBe_P-A Product feature CHAIN KC885416_HBe_P-A of FT:mat_peptide KC885416_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885417_HBe_P-A Product feature CHAIN KC885417_HBe_P-A of FT:mat_peptide KC885417_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885418_HBe_P-A Product feature CHAIN KC885418_HBe_P-A of FT:mat_peptide KC885418_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALETPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVW
>gnl|hbvpro|KC885419_HBe_P-A Product feature CHAIN KC885419_HBe_P-A of FT:mat_peptide KC885419_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885420_HBe_P-A Product feature CHAIN KC885420_HBe_P-A of FT:mat_peptide KC885420_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero55). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885422_HBe_P-A Product feature CHAIN KC885422_HBe_P-A of FT:mat_peptide KC885422_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885423_HBe_P-A Product feature CHAIN KC885423_HBe_P-A of FT:mat_peptide KC885423_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885425_HBe_P-A Product feature CHAIN KC885425_HBe_P-A of FT:mat_peptide KC885425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885427_HBe_P-A Product feature CHAIN KC885427_HBe_P-A of FT:mat_peptide KC885427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885428_HBe_P-A Product feature CHAIN KC885428_HBe_P-A of FT:mat_peptide KC885428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885430_HBe_P-A Product feature CHAIN KC885430_HBe_P-A of FT:mat_peptide KC885430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885431_HBe_P-A Product feature CHAIN KC885431_HBe_P-A of FT:mat_peptide KC885431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885432_HBe_P-A Product feature CHAIN KC885432_HBe_P-A of FT:mat_peptide KC885432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885434_HBe_P-A Product feature CHAIN KC885434_HBe_P-A of FT:mat_peptide KC885434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885435_HBe_P-A Product feature CHAIN KC885435_HBe_P-A of FT:mat_peptide KC885435_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885436_HBe_P-A Product feature CHAIN KC885436_HBe_P-A of FT:mat_peptide KC885436_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885437_HBe_P-A Product feature CHAIN KC885437_HBe_P-A of FT:mat_peptide KC885437_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885438_HBe_P-A Product feature CHAIN KC885438_HBe_P-A of FT:mat_peptide KC885438_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885439_HBe_P-A Product feature CHAIN KC885439_HBe_P-A of FT:mat_peptide KC885439_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885440_HBe_P-A Product feature CHAIN KC885440_HBe_P-A of FT:mat_peptide KC885440_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM42). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885445_HBe_P-A Product feature CHAIN KC885445_HBe_P-A of FT:mat_peptide KC885445_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885447_HBe_P-A Product feature CHAIN KC885447_HBe_P-A of FT:mat_peptide KC885447_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885449_HBe_P-A Product feature CHAIN KC885449_HBe_P-A of FT:mat_peptide KC885449_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885451_HBe_P-A Product feature CHAIN KC885451_HBe_P-A of FT:mat_peptide KC885451_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885452_HBe_P-A Product feature CHAIN KC885452_HBe_P-A of FT:mat_peptide KC885452_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885453_HBe_P-A Product feature CHAIN KC885453_HBe_P-A of FT:mat_peptide KC885453_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885454_HBe_P-A Product feature CHAIN KC885454_HBe_P-A of FT:mat_peptide KC885454_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885455_HBe_P-A Product feature CHAIN KC885455_HBe_P-A of FT:mat_peptide KC885455_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885456_HBe_P-A Product feature CHAIN KC885456_HBe_P-A of FT:mat_peptide KC885456_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885461_HBe_P-A Product feature CHAIN KC885461_HBe_P-A of FT:mat_peptide KC885461_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885466_HBe_P-A Product feature CHAIN KC885466_HBe_P-A of FT:mat_peptide KC885466_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885467_HBe_P-A Product feature CHAIN KC885467_HBe_P-A of FT:mat_peptide KC885467_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885473_HBe_P-A Product feature CHAIN KC885473_HBe_P-A of FT:mat_peptide KC885473_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885474_HBe_P-A Product feature CHAIN KC885474_HBe_P-A of FT:mat_peptide KC885474_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885476_HBe_P-A Product feature CHAIN KC885476_HBe_P-A of FT:mat_peptide KC885476_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885478_HBe_P-A Product feature CHAIN KC885478_HBe_P-A of FT:mat_peptide KC885478_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885479_HBe_P-A Product feature CHAIN KC885479_HBe_P-A of FT:mat_peptide KC885479_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885480_HBe_P-A Product feature CHAIN KC885480_HBe_P-A of FT:mat_peptide KC885480_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885481_HBe_P-A Product feature CHAIN KC885481_HBe_P-A of FT:mat_peptide KC885481_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885482_HBe_P-A Product feature CHAIN KC885482_HBe_P-A of FT:mat_peptide KC885482_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885483_HBe_P-A Product feature CHAIN KC885483_HBe_P-A of FT:mat_peptide KC885483_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM14). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885484_HBe_P-A Product feature CHAIN KC885484_HBe_P-A of FT:mat_peptide KC885484_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero12). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885485_HBe_P-A Product feature CHAIN KC885485_HBe_P-A of FT:mat_peptide KC885485_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885487_HBe_P-A Product feature CHAIN KC885487_HBe_P-A of FT:mat_peptide KC885487_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885488_HBe_P-A Product feature CHAIN KC885488_HBe_P-A of FT:mat_peptide KC885488_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885489_HBe_P-A Product feature CHAIN KC885489_HBe_P-A of FT:mat_peptide KC885489_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885491_HBe_P-A Product feature CHAIN KC885491_HBe_P-A of FT:mat_peptide KC885491_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM18). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885494_HBe_P-A Product feature CHAIN KC885494_HBe_P-A of FT:mat_peptide KC885494_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885495_HBe_P-A Product feature CHAIN KC885495_HBe_P-A of FT:mat_peptide KC885495_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM22). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885496_HBe_P-A Product feature CHAIN KC885496_HBe_P-A of FT:mat_peptide KC885496_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885497_HBe_P-A Product feature CHAIN KC885497_HBe_P-A of FT:mat_peptide KC885497_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero21). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885502_HBe_P-A Product feature CHAIN KC885502_HBe_P-A of FT:mat_peptide KC885502_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885504_HBe_P-A Product feature CHAIN KC885504_HBe_P-A of FT:mat_peptide KC885504_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero25). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885505_HBe_P-A Product feature CHAIN KC885505_HBe_P-A of FT:mat_peptide KC885505_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown16). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885506_HBe_P-A Product feature CHAIN KC885506_HBe_P-A of FT:mat_peptide KC885506_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other02). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885507_HBe_P-A Product feature CHAIN KC885507_HBe_P-A of FT:mat_peptide KC885507_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885509_HBe_P-A Product feature CHAIN KC885509_HBe_P-A of FT:mat_peptide KC885509_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885513_HBe_P-A Product feature CHAIN KC885513_HBe_P-A of FT:mat_peptide KC885513_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885514_HBe_P-A Product feature CHAIN KC885514_HBe_P-A of FT:mat_peptide KC885514_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885515_HBe_P-A Product feature CHAIN KC885515_HBe_P-A of FT:mat_peptide KC885515_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885516_HBe_P-A Product feature CHAIN KC885516_HBe_P-A of FT:mat_peptide KC885516_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885520_HBe_P-A Product feature CHAIN KC885520_HBe_P-A of FT:mat_peptide KC885520_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885521_HBe_P-A Product feature CHAIN KC885521_HBe_P-A of FT:mat_peptide KC885521_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero31). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885524_HBe_P-A Product feature CHAIN KC885524_HBe_P-A of FT:mat_peptide KC885524_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM35). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885525_HBe_P-A Product feature CHAIN KC885525_HBe_P-A of FT:mat_peptide KC885525_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero39). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885526_HBe_P-A Product feature CHAIN KC885526_HBe_P-A of FT:mat_peptide KC885526_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885528_HBe_P-A Product feature CHAIN KC885528_HBe_P-A of FT:mat_peptide KC885528_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885530_HBe_P-A Product feature CHAIN KC885530_HBe_P-A of FT:mat_peptide KC885530_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885531_HBe_P-A Product feature CHAIN KC885531_HBe_P-A of FT:mat_peptide KC885531_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown08). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885533_HBe_P-A Product feature CHAIN KC885533_HBe_P-A of FT:mat_peptide KC885533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885534_HBe_P-A Product feature CHAIN KC885534_HBe_P-A of FT:mat_peptide KC885534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885535_HBe_P-A Product feature CHAIN KC885535_HBe_P-A of FT:mat_peptide KC885535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885536_HBe_P-A Product feature CHAIN KC885536_HBe_P-A of FT:mat_peptide KC885536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IDU01). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885538_HBe_P-A Product feature CHAIN KC885538_HBe_P-A of FT:mat_peptide KC885538_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM17). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885539_HBe_P-A Product feature CHAIN KC885539_HBe_P-A of FT:mat_peptide KC885539_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate unknown15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885541_HBe_P-A Product feature CHAIN KC885541_HBe_P-A of FT:mat_peptide KC885541_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero03). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885544_HBe_P-A Product feature CHAIN KC885544_HBe_P-A of FT:mat_peptide KC885544_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other06). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885546_HBe_P-A Product feature CHAIN KC885546_HBe_P-A of FT:mat_peptide KC885546_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885548_HBe_P-A Product feature CHAIN KC885548_HBe_P-A of FT:mat_peptide KC885548_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero04). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885549_HBe_P-A Product feature CHAIN KC885549_HBe_P-A of FT:mat_peptide KC885549_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM18). Partial genome (Contains: HBe, HBc, HBx). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885551_HBe_P-A Product feature CHAIN KC885551_HBe_P-A of FT:mat_peptide KC885551_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate other09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885552_HBe_P-A Product feature CHAIN KC885552_HBe_P-A of FT:mat_peptide KC885552_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate hetero11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885553_HBe_P-A Product feature CHAIN KC885553_HBe_P-A of FT:mat_peptide KC885553_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885554_HBe_P-A Product feature CHAIN KC885554_HBe_P-A of FT:mat_peptide KC885554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM26). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885555_HBe_P-A Product feature CHAIN KC885555_HBe_P-A of FT:mat_peptide KC885555_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM27). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC885557_HBe_P-A Product feature CHAIN KC885557_HBe_P-A of FT:mat_peptide KC885557_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MSM28). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999420_HBe_P-A Product feature CHAIN KC999420_HBe_P-A of FT:mat_peptide KC999420_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg05). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999422_HBe_P-A Product feature CHAIN KC999422_HBe_P-A of FT:mat_peptide KC999422_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg07). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999424_HBe_P-A Product feature CHAIN KC999424_HBe_P-A of FT:mat_peptide KC999424_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg09). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999425_HBe_P-A Product feature CHAIN KC999425_HBe_P-A of FT:mat_peptide KC999425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg10). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999428_HBe_P-A Product feature CHAIN KC999428_HBe_P-A of FT:mat_peptide KC999428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg13). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999430_HBe_P-A Product feature CHAIN KC999430_HBe_P-A of FT:mat_peptide KC999430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg15). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999433_HBe_P-A Product feature CHAIN KC999433_HBe_P-A of FT:mat_peptide KC999433_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg19). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999434_HBe_P-A Product feature CHAIN KC999434_HBe_P-A of FT:mat_peptide KC999434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg20). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999437_HBe_P-A Product feature CHAIN KC999437_HBe_P-A of FT:mat_peptide KC999437_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg23). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999438_HBe_P-A Product feature CHAIN KC999438_HBe_P-A of FT:mat_peptide KC999438_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg24). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999441_HBe_P-A Product feature CHAIN KC999441_HBe_P-A of FT:mat_peptide KC999441_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg29). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAQALFREALESPEHCSSHHTALRQAILCWGELMNLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGREIVLEYLVSFGVW
>gnl|hbvpro|KC999442_HBe_P-A Product feature CHAIN KC999442_HBe_P-A of FT:mat_peptide KC999442_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg30). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999444_HBe_P-A Product feature CHAIN KC999444_HBe_P-A of FT:mat_peptide KC999444_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg32). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELISFLPHDFFPSVRDLLDTASALYREALESAEHCSPHHTALRQCSLCWGELMSLAN
WVGNNLQDPASRDQVVNYVNTNMGLKLRQLLWFHISCLTFGRQTVVDYLVSFGVW
>gnl|hbvpro|KC999445_HBe_P-A Product feature CHAIN KC999445_HBe_P-A of FT:mat_peptide KC999445_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg34). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999447_HBe_P-A Product feature CHAIN KC999447_HBe_P-A of FT:mat_peptide KC999447_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg36). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999448_HBe_P-A Product feature CHAIN KC999448_HBe_P-A of FT:mat_peptide KC999448_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg37). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999449_HBe_P-A Product feature CHAIN KC999449_HBe_P-A of FT:mat_peptide KC999449_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg38). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFFPSAKDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELTTLAT
WVGNNLQDAASRDQVVTYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999451_HBe_P-A Product feature CHAIN KC999451_HBe_P-A of FT:mat_peptide KC999451_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg41). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999452_HBe_P-A Product feature CHAIN KC999452_HBe_P-A of FT:mat_peptide KC999452_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg43). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTAAALFREALESPDHCTPHHTALRQAVVCWGEVMTLAT
WVGSNLQDQASRDLVVNYVNINMGLKMRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999454_HBe_P-A Product feature CHAIN KC999454_HBe_P-A of FT:mat_peptide KC999454_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg45). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999457_HBe_P-A Product feature CHAIN KC999457_HBe_P-A of FT:mat_peptide KC999457_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg49). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDLYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999459_HBe_P-A Product feature CHAIN KC999459_HBe_P-A of FT:mat_peptide KC999459_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg52). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC999460_HBe_P-A Product feature CHAIN KC999460_HBe_P-A of FT:mat_peptide KC999460_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate CbaArg53). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF214657_HBe_P-A Product feature CHAIN KF214657_HBe_P-A of FT:mat_peptide KF214657_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KF214658_HBe_P-A Product feature CHAIN KF214658_HBe_P-A of FT:mat_peptide KF214658_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SQLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF214659_HBe_P-A Product feature CHAIN KF214659_HBe_P-A of FT:mat_peptide KF214659_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF214660_HBe_P-A Product feature CHAIN KF214660_HBe_P-A of FT:mat_peptide KF214660_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLQDTASALYREALESPEHCSHHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF214661_HBe_P-A Product feature CHAIN KF214661_HBe_P-A of FT:mat_peptide KF214661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRRAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF214662_HBe_P-A Product feature CHAIN KF214662_HBe_P-A of FT:mat_peptide KF214662_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF214663_HBe_P-A Product feature CHAIN KF214663_HBe_P-A of FT:mat_peptide KF214663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF214665_HBe_P-A Product feature CHAIN KF214665_HBe_P-A of FT:mat_peptide KF214665_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF214666_HBe_P-A Product feature CHAIN KF214666_HBe_P-A of FT:mat_peptide KF214666_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IND). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELTTLAG
WVGHNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779213_HBe_P-A Product feature CHAIN KF779213_HBe_P-A of FT:mat_peptide KF779213_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5744). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779215_HBe_P-A Product feature CHAIN KF779215_HBe_P-A of FT:mat_peptide KF779215_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN5763). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779227_HBe_P-A Product feature CHAIN KF779227_HBe_P-A of FT:mat_peptide KF779227_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779231_HBe_P-A Product feature CHAIN KF779231_HBe_P-A of FT:mat_peptide KF779231_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779232_HBe_P-A Product feature CHAIN KF779232_HBe_P-A of FT:mat_peptide KF779232_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6088). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779234_HBe_P-A Product feature CHAIN KF779234_HBe_P-A of FT:mat_peptide KF779234_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6104). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779238_HBe_P-A Product feature CHAIN KF779238_HBe_P-A of FT:mat_peptide KF779238_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6119). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779239_HBe_P-A Product feature CHAIN KF779239_HBe_P-A of FT:mat_peptide KF779239_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6120). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779240_HBe_P-A Product feature CHAIN KF779240_HBe_P-A of FT:mat_peptide KF779240_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6123). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779243_HBe_P-A Product feature CHAIN KF779243_HBe_P-A of FT:mat_peptide KF779243_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6142). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779244_HBe_P-A Product feature CHAIN KF779244_HBe_P-A of FT:mat_peptide KF779244_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6152). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779245_HBe_P-A Product feature CHAIN KF779245_HBe_P-A of FT:mat_peptide KF779245_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6156). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779246_HBe_P-A Product feature CHAIN KF779246_HBe_P-A of FT:mat_peptide KF779246_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6163). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779247_HBe_P-A Product feature CHAIN KF779247_HBe_P-A of FT:mat_peptide KF779247_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6164). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779248_HBe_P-A Product feature CHAIN KF779248_HBe_P-A of FT:mat_peptide KF779248_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6168). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779249_HBe_P-A Product feature CHAIN KF779249_HBe_P-A of FT:mat_peptide KF779249_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DEN6173). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779251_HBe_P-A Product feature CHAIN KF779251_HBe_P-A of FT:mat_peptide KF779251_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779252_HBe_P-A Product feature CHAIN KF779252_HBe_P-A of FT:mat_peptide KF779252_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3809). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779253_HBe_P-A Product feature CHAIN KF779253_HBe_P-A of FT:mat_peptide KF779253_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3817). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779254_HBe_P-A Product feature CHAIN KF779254_HBe_P-A of FT:mat_peptide KF779254_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3820). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPFVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779255_HBe_P-A Product feature CHAIN KF779255_HBe_P-A of FT:mat_peptide KF779255_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3825). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779256_HBe_P-A Product feature CHAIN KF779256_HBe_P-A of FT:mat_peptide KF779256_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3829). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779257_HBe_P-A Product feature CHAIN KF779257_HBe_P-A of FT:mat_peptide KF779257_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3857). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779258_HBe_P-A Product feature CHAIN KF779258_HBe_P-A of FT:mat_peptide KF779258_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3864). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779259_HBe_P-A Product feature CHAIN KF779259_HBe_P-A of FT:mat_peptide KF779259_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3892). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779260_HBe_P-A Product feature CHAIN KF779260_HBe_P-A of FT:mat_peptide KF779260_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3894). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLNIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779261_HBe_P-A Product feature CHAIN KF779261_HBe_P-A of FT:mat_peptide KF779261_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3896). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779262_HBe_P-A Product feature CHAIN KF779262_HBe_P-A of FT:mat_peptide KF779262_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3898). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779263_HBe_P-A Product feature CHAIN KF779263_HBe_P-A of FT:mat_peptide KF779263_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3903). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779264_HBe_P-A Product feature CHAIN KF779264_HBe_P-A of FT:mat_peptide KF779264_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3945). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779265_HBe_P-A Product feature CHAIN KF779265_HBe_P-A of FT:mat_peptide KF779265_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3946). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779266_HBe_P-A Product feature CHAIN KF779266_HBe_P-A of FT:mat_peptide KF779266_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3949). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779268_HBe_P-A Product feature CHAIN KF779268_HBe_P-A of FT:mat_peptide KF779268_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA3966). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779269_HBe_P-A Product feature CHAIN KF779269_HBe_P-A of FT:mat_peptide KF779269_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4207). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779270_HBe_P-A Product feature CHAIN KF779270_HBe_P-A of FT:mat_peptide KF779270_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4219). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779271_HBe_P-A Product feature CHAIN KF779271_HBe_P-A of FT:mat_peptide KF779271_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4233). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779272_HBe_P-A Product feature CHAIN KF779272_HBe_P-A of FT:mat_peptide KF779272_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4236). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779273_HBe_P-A Product feature CHAIN KF779273_HBe_P-A of FT:mat_peptide KF779273_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4237). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779274_HBe_P-A Product feature CHAIN KF779274_HBe_P-A of FT:mat_peptide KF779274_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4259). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779275_HBe_P-A Product feature CHAIN KF779275_HBe_P-A of FT:mat_peptide KF779275_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4283). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779276_HBe_P-A Product feature CHAIN KF779276_HBe_P-A of FT:mat_peptide KF779276_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4314). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779277_HBe_P-A Product feature CHAIN KF779277_HBe_P-A of FT:mat_peptide KF779277_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4322). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779279_HBe_P-A Product feature CHAIN KF779279_HBe_P-A of FT:mat_peptide KF779279_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4359). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779281_HBe_P-A Product feature CHAIN KF779281_HBe_P-A of FT:mat_peptide KF779281_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4390). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVW
>gnl|hbvpro|KF779282_HBe_P-A Product feature CHAIN KF779282_HBe_P-A of FT:mat_peptide KF779282_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4392). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779283_HBe_P-A Product feature CHAIN KF779283_HBe_P-A of FT:mat_peptide KF779283_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JFA4394). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779284_HBe_P-A Product feature CHAIN KF779284_HBe_P-A of FT:mat_peptide KF779284_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0574). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779286_HBe_P-A Product feature CHAIN KF779286_HBe_P-A of FT:mat_peptide KF779286_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0606). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779290_HBe_P-A Product feature CHAIN KF779290_HBe_P-A of FT:mat_peptide KF779290_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779291_HBe_P-A Product feature CHAIN KF779291_HBe_P-A of FT:mat_peptide KF779291_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0765). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779293_HBe_P-A Product feature CHAIN KF779293_HBe_P-A of FT:mat_peptide KF779293_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0787). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779294_HBe_P-A Product feature CHAIN KF779294_HBe_P-A of FT:mat_peptide KF779294_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0796). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779295_HBe_P-A Product feature CHAIN KF779295_HBe_P-A of FT:mat_peptide KF779295_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0854). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779297_HBe_P-A Product feature CHAIN KF779297_HBe_P-A of FT:mat_peptide KF779297_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0874). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779298_HBe_P-A Product feature CHAIN KF779298_HBe_P-A of FT:mat_peptide KF779298_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0908). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779299_HBe_P-A Product feature CHAIN KF779299_HBe_P-A of FT:mat_peptide KF779299_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT0943). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779304_HBe_P-A Product feature CHAIN KF779304_HBe_P-A of FT:mat_peptide KF779304_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1039). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779305_HBe_P-A Product feature CHAIN KF779305_HBe_P-A of FT:mat_peptide KF779305_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1043). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779306_HBe_P-A Product feature CHAIN KF779306_HBe_P-A of FT:mat_peptide KF779306_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1093). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779307_HBe_P-A Product feature CHAIN KF779307_HBe_P-A of FT:mat_peptide KF779307_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1227). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779308_HBe_P-A Product feature CHAIN KF779308_HBe_P-A of FT:mat_peptide KF779308_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1293). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779309_HBe_P-A Product feature CHAIN KF779309_HBe_P-A of FT:mat_peptide KF779309_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MLT1294). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779310_HBe_P-A Product feature CHAIN KF779310_HBe_P-A of FT:mat_peptide KF779310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3845). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779311_HBe_P-A Product feature CHAIN KF779311_HBe_P-A of FT:mat_peptide KF779311_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3863). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779312_HBe_P-A Product feature CHAIN KF779312_HBe_P-A of FT:mat_peptide KF779312_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3907). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779313_HBe_P-A Product feature CHAIN KF779313_HBe_P-A of FT:mat_peptide KF779313_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3958). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779314_HBe_P-A Product feature CHAIN KF779314_HBe_P-A of FT:mat_peptide KF779314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF3985). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779315_HBe_P-A Product feature CHAIN KF779315_HBe_P-A of FT:mat_peptide KF779315_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4204). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779316_HBe_P-A Product feature CHAIN KF779316_HBe_P-A of FT:mat_peptide KF779316_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4247). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779317_HBe_P-A Product feature CHAIN KF779317_HBe_P-A of FT:mat_peptide KF779317_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4308). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779319_HBe_P-A Product feature CHAIN KF779319_HBe_P-A of FT:mat_peptide KF779319_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4323). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779320_HBe_P-A Product feature CHAIN KF779320_HBe_P-A of FT:mat_peptide KF779320_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779321_HBe_P-A Product feature CHAIN KF779321_HBe_P-A of FT:mat_peptide KF779321_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4362). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779322_HBe_P-A Product feature CHAIN KF779322_HBe_P-A of FT:mat_peptide KF779322_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4406). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779323_HBe_P-A Product feature CHAIN KF779323_HBe_P-A of FT:mat_peptide KF779323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4414). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779324_HBe_P-A Product feature CHAIN KF779324_HBe_P-A of FT:mat_peptide KF779324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4416). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779325_HBe_P-A Product feature CHAIN KF779325_HBe_P-A of FT:mat_peptide KF779325_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4422). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779326_HBe_P-A Product feature CHAIN KF779326_HBe_P-A of FT:mat_peptide KF779326_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4424). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779328_HBe_P-A Product feature CHAIN KF779328_HBe_P-A of FT:mat_peptide KF779328_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4532). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779329_HBe_P-A Product feature CHAIN KF779329_HBe_P-A of FT:mat_peptide KF779329_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4540). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779330_HBe_P-A Product feature CHAIN KF779330_HBe_P-A of FT:mat_peptide KF779330_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4541). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779331_HBe_P-A Product feature CHAIN KF779331_HBe_P-A of FT:mat_peptide KF779331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4543). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779332_HBe_P-A Product feature CHAIN KF779332_HBe_P-A of FT:mat_peptide KF779332_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4549). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779333_HBe_P-A Product feature CHAIN KF779333_HBe_P-A of FT:mat_peptide KF779333_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4661). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779334_HBe_P-A Product feature CHAIN KF779334_HBe_P-A of FT:mat_peptide KF779334_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4673). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779335_HBe_P-A Product feature CHAIN KF779335_HBe_P-A of FT:mat_peptide KF779335_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4687). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779336_HBe_P-A Product feature CHAIN KF779336_HBe_P-A of FT:mat_peptide KF779336_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4730). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779337_HBe_P-A Product feature CHAIN KF779337_HBe_P-A of FT:mat_peptide KF779337_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4733). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779338_HBe_P-A Product feature CHAIN KF779338_HBe_P-A of FT:mat_peptide KF779338_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4756). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779339_HBe_P-A Product feature CHAIN KF779339_HBe_P-A of FT:mat_peptide KF779339_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4804). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779342_HBe_P-A Product feature CHAIN KF779342_HBe_P-A of FT:mat_peptide KF779342_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4865). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGLW
>gnl|hbvpro|KF779344_HBe_P-A Product feature CHAIN KF779344_HBe_P-A of FT:mat_peptide KF779344_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4928). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779345_HBe_P-A Product feature CHAIN KF779345_HBe_P-A of FT:mat_peptide KF779345_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4936). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779346_HBe_P-A Product feature CHAIN KF779346_HBe_P-A of FT:mat_peptide KF779346_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4938). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779347_HBe_P-A Product feature CHAIN KF779347_HBe_P-A of FT:mat_peptide KF779347_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4950). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779348_HBe_P-A Product feature CHAIN KF779348_HBe_P-A of FT:mat_peptide KF779348_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4951). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779349_HBe_P-A Product feature CHAIN KF779349_HBe_P-A of FT:mat_peptide KF779349_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF4999). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779350_HBe_P-A Product feature CHAIN KF779350_HBe_P-A of FT:mat_peptide KF779350_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5005). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779351_HBe_P-A Product feature CHAIN KF779351_HBe_P-A of FT:mat_peptide KF779351_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5017). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779352_HBe_P-A Product feature CHAIN KF779352_HBe_P-A of FT:mat_peptide KF779352_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5034). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779354_HBe_P-A Product feature CHAIN KF779354_HBe_P-A of FT:mat_peptide KF779354_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5084). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779355_HBe_P-A Product feature CHAIN KF779355_HBe_P-A of FT:mat_peptide KF779355_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5121). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779356_HBe_P-A Product feature CHAIN KF779356_HBe_P-A of FT:mat_peptide KF779356_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5185). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779358_HBe_P-A Product feature CHAIN KF779358_HBe_P-A of FT:mat_peptide KF779358_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5263). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779359_HBe_P-A Product feature CHAIN KF779359_HBe_P-A of FT:mat_peptide KF779359_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5268). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779360_HBe_P-A Product feature CHAIN KF779360_HBe_P-A of FT:mat_peptide KF779360_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5279). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779361_HBe_P-A Product feature CHAIN KF779361_HBe_P-A of FT:mat_peptide KF779361_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5291). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNFEDPASRDLVVNYVNTNMGLKIRQLSRFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779362_HBe_P-A Product feature CHAIN KF779362_HBe_P-A of FT:mat_peptide KF779362_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779363_HBe_P-A Product feature CHAIN KF779363_HBe_P-A of FT:mat_peptide KF779363_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5350). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779364_HBe_P-A Product feature CHAIN KF779364_HBe_P-A of FT:mat_peptide KF779364_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5374). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779365_HBe_P-A Product feature CHAIN KF779365_HBe_P-A of FT:mat_peptide KF779365_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5380). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779366_HBe_P-A Product feature CHAIN KF779366_HBe_P-A of FT:mat_peptide KF779366_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5383). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779367_HBe_P-A Product feature CHAIN KF779367_HBe_P-A of FT:mat_peptide KF779367_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5403). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779368_HBe_P-A Product feature CHAIN KF779368_HBe_P-A of FT:mat_peptide KF779368_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5421). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779369_HBe_P-A Product feature CHAIN KF779369_HBe_P-A of FT:mat_peptide KF779369_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5521). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779370_HBe_P-A Product feature CHAIN KF779370_HBe_P-A of FT:mat_peptide KF779370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5594). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779371_HBe_P-A Product feature CHAIN KF779371_HBe_P-A of FT:mat_peptide KF779371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5608). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLRFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779372_HBe_P-A Product feature CHAIN KF779372_HBe_P-A of FT:mat_peptide KF779372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5654). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779373_HBe_P-A Product feature CHAIN KF779373_HBe_P-A of FT:mat_peptide KF779373_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5680). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779374_HBe_P-A Product feature CHAIN KF779374_HBe_P-A of FT:mat_peptide KF779374_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5743). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779375_HBe_P-A Product feature CHAIN KF779375_HBe_P-A of FT:mat_peptide KF779375_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PNF5760). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779378_HBe_P-A Product feature CHAIN KF779378_HBe_P-A of FT:mat_peptide KF779378_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6064). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779379_HBe_P-A Product feature CHAIN KF779379_HBe_P-A of FT:mat_peptide KF779379_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6136). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779381_HBe_P-A Product feature CHAIN KF779381_HBe_P-A of FT:mat_peptide KF779381_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6268). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779383_HBe_P-A Product feature CHAIN KF779383_HBe_P-A of FT:mat_peptide KF779383_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PRC6296). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779384_HBe_P-A Product feature CHAIN KF779384_HBe_P-A of FT:mat_peptide KF779384_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0061). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779385_HBe_P-A Product feature CHAIN KF779385_HBe_P-A of FT:mat_peptide KF779385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0098). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF779386_HBe_P-A Product feature CHAIN KF779386_HBe_P-A of FT:mat_peptide KF779386_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SFN0138). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798265_HBe_P-A Product feature CHAIN KF798265_HBe_P-A of FT:mat_peptide KF798265_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798266_HBe_P-A Product feature CHAIN KF798266_HBe_P-A of FT:mat_peptide KF798266_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798267_HBe_P-A Product feature CHAIN KF798267_HBe_P-A of FT:mat_peptide KF798267_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798271_HBe_P-A Product feature CHAIN KF798271_HBe_P-A of FT:mat_peptide KF798271_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798278_HBe_P-A Product feature CHAIN KF798278_HBe_P-A of FT:mat_peptide KF798278_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798279_HBe_P-A Product feature CHAIN KF798279_HBe_P-A of FT:mat_peptide KF798279_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798285_HBe_P-A Product feature CHAIN KF798285_HBe_P-A of FT:mat_peptide KF798285_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798286_HBe_P-A Product feature CHAIN KF798286_HBe_P-A of FT:mat_peptide KF798286_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798289_HBe_P-A Product feature CHAIN KF798289_HBe_P-A of FT:mat_peptide KF798289_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798290_HBe_P-A Product feature CHAIN KF798290_HBe_P-A of FT:mat_peptide KF798290_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798291_HBe_P-A Product feature CHAIN KF798291_HBe_P-A of FT:mat_peptide KF798291_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798292_HBe_P-A Product feature CHAIN KF798292_HBe_P-A of FT:mat_peptide KF798292_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798302_HBe_P-A Product feature CHAIN KF798302_HBe_P-A of FT:mat_peptide KF798302_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798308_HBe_P-A Product feature CHAIN KF798308_HBe_P-A of FT:mat_peptide KF798308_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798309_HBe_P-A Product feature CHAIN KF798309_HBe_P-A of FT:mat_peptide KF798309_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798310_HBe_P-A Product feature CHAIN KF798310_HBe_P-A of FT:mat_peptide KF798310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798311_HBe_P-A Product feature CHAIN KF798311_HBe_P-A of FT:mat_peptide KF798311_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF798314_HBe_P-A Product feature CHAIN KF798314_HBe_P-A of FT:mat_peptide KF798314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICIB). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922406_HBe_P-A Product feature CHAIN KF922406_HBe_P-A of FT:mat_peptide KF922406_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922407_HBe_P-A Product feature CHAIN KF922407_HBe_P-A of FT:mat_peptide KF922407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922408_HBe_P-A Product feature CHAIN KF922408_HBe_P-A of FT:mat_peptide KF922408_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCPTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922409_HBe_P-A Product feature CHAIN KF922409_HBe_P-A of FT:mat_peptide KF922409_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791v4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922414_HBe_P-A Product feature CHAIN KF922414_HBe_P-A of FT:mat_peptide KF922414_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922415_HBe_P-A Product feature CHAIN KF922415_HBe_P-A of FT:mat_peptide KF922415_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922416_HBe_P-A Product feature CHAIN KF922416_HBe_P-A of FT:mat_peptide KF922416_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922418_HBe_P-A Product feature CHAIN KF922418_HBe_P-A of FT:mat_peptide KF922418_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922419_HBe_P-A Product feature CHAIN KF922419_HBe_P-A of FT:mat_peptide KF922419_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922420_HBe_P-A Product feature CHAIN KF922420_HBe_P-A of FT:mat_peptide KF922420_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v7). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922421_HBe_P-A Product feature CHAIN KF922421_HBe_P-A of FT:mat_peptide KF922421_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N005v8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLEDPASRDQVVNYVNINMGIKIRQLLWFHISCITFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922424_HBe_P-A Product feature CHAIN KF922424_HBe_P-A of FT:mat_peptide KF922424_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922425_HBe_P-A Product feature CHAIN KF922425_HBe_P-A of FT:mat_peptide KF922425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070v2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922426_HBe_P-A Product feature CHAIN KF922426_HBe_P-A of FT:mat_peptide KF922426_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922427_HBe_P-A Product feature CHAIN KF922427_HBe_P-A of FT:mat_peptide KF922427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922428_HBe_P-A Product feature CHAIN KF922428_HBe_P-A of FT:mat_peptide KF922428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312v3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922429_HBe_P-A Product feature CHAIN KF922429_HBe_P-A of FT:mat_peptide KF922429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922430_HBe_P-A Product feature CHAIN KF922430_HBe_P-A of FT:mat_peptide KF922430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMIFAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF922431_HBe_P-A Product feature CHAIN KF922431_HBe_P-A of FT:mat_peptide KF922431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274v3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985190_HBe_P-A Product feature CHAIN KF985190_HBe_P-A of FT:mat_peptide KF985190_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3975). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985191_HBe_P-A Product feature CHAIN KF985191_HBe_P-A of FT:mat_peptide KF985191_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3869). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985192_HBe_P-A Product feature CHAIN KF985192_HBe_P-A of FT:mat_peptide KF985192_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4070). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985193_HBe_P-A Product feature CHAIN KF985193_HBe_P-A of FT:mat_peptide KF985193_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 4312). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985194_HBe_P-A Product feature CHAIN KF985194_HBe_P-A of FT:mat_peptide KF985194_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3791). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985195_HBe_P-A Product feature CHAIN KF985195_HBe_P-A of FT:mat_peptide KF985195_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate T033). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985196_HBe_P-A Product feature CHAIN KF985196_HBe_P-A of FT:mat_peptide KF985196_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3832). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985197_HBe_P-A Product feature CHAIN KF985197_HBe_P-A of FT:mat_peptide KF985197_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3671). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985198_HBe_P-A Product feature CHAIN KF985198_HBe_P-A of FT:mat_peptide KF985198_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2950). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985199_HBe_P-A Product feature CHAIN KF985199_HBe_P-A of FT:mat_peptide KF985199_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3261). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985200_HBe_P-A Product feature CHAIN KF985200_HBe_P-A of FT:mat_peptide KF985200_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3734). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985201_HBe_P-A Product feature CHAIN KF985201_HBe_P-A of FT:mat_peptide KF985201_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3812). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985202_HBe_P-A Product feature CHAIN KF985202_HBe_P-A of FT:mat_peptide KF985202_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3464). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985203_HBe_P-A Product feature CHAIN KF985203_HBe_P-A of FT:mat_peptide KF985203_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3321). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985204_HBe_P-A Product feature CHAIN KF985204_HBe_P-A of FT:mat_peptide KF985204_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3678). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985205_HBe_P-A Product feature CHAIN KF985205_HBe_P-A of FT:mat_peptide KF985205_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3354). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPTSRDLVVNYVNTNMGLRIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985206_HBe_P-A Product feature CHAIN KF985206_HBe_P-A of FT:mat_peptide KF985206_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N60). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESQEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|KF985208_HBe_P-A Product feature CHAIN KF985208_HBe_P-A of FT:mat_peptide KF985208_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3269). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985210_HBe_P-A Product feature CHAIN KF985210_HBe_P-A of FT:mat_peptide KF985210_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate N199). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMTLAA
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985211_HBe_P-A Product feature CHAIN KF985211_HBe_P-A of FT:mat_peptide KF985211_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3274). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF985212_HBe_P-A Product feature CHAIN KF985212_HBe_P-A of FT:mat_peptide KF985212_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3658). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPHDFFPSVRDLLDTASALYREGLESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ010776_HBe_P-A Product feature CHAIN KJ010776_HBe_P-A of FT:mat_peptide KJ010776_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ010777_HBe_P-A Product feature CHAIN KJ010777_HBe_P-A of FT:mat_peptide KJ010777_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ010778_HBe_P-A Product feature CHAIN KJ010778_HBe_P-A of FT:mat_peptide KJ010778_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3358v3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ586809_HBe_P-A Product feature CHAIN KJ586809_HBe_P-A of FT:mat_peptide KJ586809_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLNTASALYREALESPEHCSPHHTALRQAILCWGELMTLST
WVGNNLEDPASRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ810852_HBe_P-A Product feature CHAIN KJ810852_HBe_P-A of FT:mat_peptide KJ810852_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 113). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALXSPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ810853_HBe_P-A Product feature CHAIN KJ810853_HBe_P-A of FT:mat_peptide KJ810853_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALXSPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ810856_HBe_P-A Product feature CHAIN KJ810856_HBe_P-A of FT:mat_peptide KJ810856_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 432). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ810857_HBe_P-A Product feature CHAIN KJ810857_HBe_P-A of FT:mat_peptide KJ810857_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 426). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ810858_HBe_P-A Product feature CHAIN KJ810858_HBe_P-A of FT:mat_peptide KJ810858_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 425). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ810893_HBe_P-A Product feature CHAIN KJ810893_HBe_P-A of FT:mat_peptide KJ810893_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate IC_87). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSXHHTALRQAILCWGELMTLAT
WVGNNLXDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843166_HBe_P-A Product feature CHAIN KJ843166_HBe_P-A of FT:mat_peptide KJ843166_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag04). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843172_HBe_P-A Product feature CHAIN KJ843172_HBe_P-A of FT:mat_peptide KJ843172_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843173_HBe_P-A Product feature CHAIN KJ843173_HBe_P-A of FT:mat_peptide KJ843173_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843182_HBe_P-A Product feature CHAIN KJ843182_HBe_P-A of FT:mat_peptide KJ843182_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag21). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843183_HBe_P-A Product feature CHAIN KJ843183_HBe_P-A of FT:mat_peptide KJ843183_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag22). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843184_HBe_P-A Product feature CHAIN KJ843184_HBe_P-A of FT:mat_peptide KJ843184_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag23). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843186_HBe_P-A Product feature CHAIN KJ843186_HBe_P-A of FT:mat_peptide KJ843186_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag25). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843188_HBe_P-A Product feature CHAIN KJ843188_HBe_P-A of FT:mat_peptide KJ843188_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag27). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843192_HBe_P-A Product feature CHAIN KJ843192_HBe_P-A of FT:mat_peptide KJ843192_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag31). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843214_HBe_P-A Product feature CHAIN KJ843214_HBe_P-A of FT:mat_peptide KJ843214_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag55). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843215_HBe_P-A Product feature CHAIN KJ843215_HBe_P-A of FT:mat_peptide KJ843215_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag56). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843216_HBe_P-A Product feature CHAIN KJ843216_HBe_P-A of FT:mat_peptide KJ843216_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag57). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843217_HBe_P-A Product feature CHAIN KJ843217_HBe_P-A of FT:mat_peptide KJ843217_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag62). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ843218_HBe_P-A Product feature CHAIN KJ843218_HBe_P-A of FT:mat_peptide KJ843218_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Ag63). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854685_HBe_P-A Product feature CHAIN KJ854685_HBe_P-A of FT:mat_peptide KJ854685_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 116). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMAIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELSTLGT
WVGNNLQDQASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854686_HBe_P-A Product feature CHAIN KJ854686_HBe_P-A of FT:mat_peptide KJ854686_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1356). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854687_HBe_P-A Product feature CHAIN KJ854687_HBe_P-A of FT:mat_peptide KJ854687_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1377). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854688_HBe_P-A Product feature CHAIN KJ854688_HBe_P-A of FT:mat_peptide KJ854688_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1379). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854689_HBe_P-A Product feature CHAIN KJ854689_HBe_P-A of FT:mat_peptide KJ854689_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16202). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854690_HBe_P-A Product feature CHAIN KJ854690_HBe_P-A of FT:mat_peptide KJ854690_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16338). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTSSALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854691_HBe_P-A Product feature CHAIN KJ854691_HBe_P-A of FT:mat_peptide KJ854691_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16650). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854692_HBe_P-A Product feature CHAIN KJ854692_HBe_P-A of FT:mat_peptide KJ854692_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17372). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854693_HBe_P-A Product feature CHAIN KJ854693_HBe_P-A of FT:mat_peptide KJ854693_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17545). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854694_HBe_P-A Product feature CHAIN KJ854694_HBe_P-A of FT:mat_peptide KJ854694_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 17822). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854696_HBe_P-A Product feature CHAIN KJ854696_HBe_P-A of FT:mat_peptide KJ854696_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 18158). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854697_HBe_P-A Product feature CHAIN KJ854697_HBe_P-A of FT:mat_peptide KJ854697_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1969). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854698_HBe_P-A Product feature CHAIN KJ854698_HBe_P-A of FT:mat_peptide KJ854698_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1993). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854699_HBe_P-A Product feature CHAIN KJ854699_HBe_P-A of FT:mat_peptide KJ854699_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 2340). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854700_HBe_P-A Product feature CHAIN KJ854700_HBe_P-A of FT:mat_peptide KJ854700_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 313). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRXVVLEYLVSFGVW
>gnl|hbvpro|KJ854701_HBe_P-A Product feature CHAIN KJ854701_HBe_P-A of FT:mat_peptide KJ854701_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 349). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPTARDLLDTASALYREALESPEHCSPHHTALRQAILCWGDILTLGT
WVGNNLEDQTSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVW
>gnl|hbvpro|KJ854702_HBe_P-A Product feature CHAIN KJ854702_HBe_P-A of FT:mat_peptide KJ854702_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 41). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854703_HBe_P-A Product feature CHAIN KJ854703_HBe_P-A of FT:mat_peptide KJ854703_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 65). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDFDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLXXNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854704_HBe_P-A Product feature CHAIN KJ854704_HBe_P-A of FT:mat_peptide KJ854704_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 66). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854705_HBe_P-A Product feature CHAIN KJ854705_HBe_P-A of FT:mat_peptide KJ854705_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 67). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854706_HBe_P-A Product feature CHAIN KJ854706_HBe_P-A of FT:mat_peptide KJ854706_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 753). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854707_HBe_P-A Product feature CHAIN KJ854707_HBe_P-A of FT:mat_peptide KJ854707_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 895). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854708_HBe_P-A Product feature CHAIN KJ854708_HBe_P-A of FT:mat_peptide KJ854708_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854709_HBe_P-A Product feature CHAIN KJ854709_HBe_P-A of FT:mat_peptide KJ854709_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 24). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ854710_HBe_P-A Product feature CHAIN KJ854710_HBe_P-A of FT:mat_peptide KJ854710_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 274). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM243029_HBe_P-A Product feature CHAIN KM243029_HBe_P-A of FT:mat_peptide KM243029_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate TAC455). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM519452_HBe_P-A Product feature CHAIN KM519452_HBe_P-A of FT:mat_peptide KM519452_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_G1862T_Mutant_SA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM519453_HBe_P-A Product feature CHAIN KM519453_HBe_P-A of FT:mat_peptide KM519453_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A1_Wild_SA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM519454_HBe_P-A Product feature CHAIN KM519454_HBe_P-A of FT:mat_peptide KM519454_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_WT_BEL). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606647_HBe_P-A Product feature CHAIN KM606647_HBe_P-A of FT:mat_peptide KM606647_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba10a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGATVELLSFLPLDFFPSARDLLETASALYRESLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRDTVLQYLVSFGVW
>gnl|hbvpro|KM606648_HBe_P-A Product feature CHAIN KM606648_HBe_P-A of FT:mat_peptide KM606648_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606649_HBe_P-A Product feature CHAIN KM606649_HBe_P-A of FT:mat_peptide KM606649_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba15a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKLRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|KM606650_HBe_P-A Product feature CHAIN KM606650_HBe_P-A of FT:mat_peptide KM606650_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba16a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDLYKEFGATVELLSFLPSDFFPAVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMTLGT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606652_HBe_P-A Product feature CHAIN KM606652_HBe_P-A of FT:mat_peptide KM606652_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba20a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606653_HBe_P-A Product feature CHAIN KM606653_HBe_P-A of FT:mat_peptide KM606653_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba21a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQEILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606656_HBe_P-A Product feature CHAIN KM606656_HBe_P-A of FT:mat_peptide KM606656_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba26a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606658_HBe_P-A Product feature CHAIN KM606658_HBe_P-A of FT:mat_peptide KM606658_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba31a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606660_HBe_P-A Product feature CHAIN KM606660_HBe_P-A of FT:mat_peptide KM606660_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba34a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606661_HBe_P-A Product feature CHAIN KM606661_HBe_P-A of FT:mat_peptide KM606661_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba35a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|KM606663_HBe_P-A Product feature CHAIN KM606663_HBe_P-A of FT:mat_peptide KM606663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba38a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606665_HBe_P-A Product feature CHAIN KM606665_HBe_P-A of FT:mat_peptide KM606665_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba40a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606666_HBe_P-A Product feature CHAIN KM606666_HBe_P-A of FT:mat_peptide KM606666_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba41a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606668_HBe_P-A Product feature CHAIN KM606668_HBe_P-A of FT:mat_peptide KM606668_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba44a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606669_HBe_P-A Product feature CHAIN KM606669_HBe_P-A of FT:mat_peptide KM606669_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba45a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606672_HBe_P-A Product feature CHAIN KM606672_HBe_P-A of FT:mat_peptide KM606672_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba54a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606673_HBe_P-A Product feature CHAIN KM606673_HBe_P-A of FT:mat_peptide KM606673_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba55a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606674_HBe_P-A Product feature CHAIN KM606674_HBe_P-A of FT:mat_peptide KM606674_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606676_HBe_P-A Product feature CHAIN KM606676_HBe_P-A of FT:mat_peptide KM606676_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba59a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606677_HBe_P-A Product feature CHAIN KM606677_HBe_P-A of FT:mat_peptide KM606677_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba60a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606678_HBe_P-A Product feature CHAIN KM606678_HBe_P-A of FT:mat_peptide KM606678_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba61a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606679_HBe_P-A Product feature CHAIN KM606679_HBe_P-A of FT:mat_peptide KM606679_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba62a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLAT
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606680_HBe_P-A Product feature CHAIN KM606680_HBe_P-A of FT:mat_peptide KM606680_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba66a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606683_HBe_P-A Product feature CHAIN KM606683_HBe_P-A of FT:mat_peptide KM606683_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba69a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606684_HBe_P-A Product feature CHAIN KM606684_HBe_P-A of FT:mat_peptide KM606684_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba71a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606685_HBe_P-A Product feature CHAIN KM606685_HBe_P-A of FT:mat_peptide KM606685_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba72a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606687_HBe_P-A Product feature CHAIN KM606687_HBe_P-A of FT:mat_peptide KM606687_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba75a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606688_HBe_P-A Product feature CHAIN KM606688_HBe_P-A of FT:mat_peptide KM606688_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba78a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KM606691_HBe_P-A Product feature CHAIN KM606691_HBe_P-A of FT:mat_peptide KM606691_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba82a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606694_HBe_P-A Product feature CHAIN KM606694_HBe_P-A of FT:mat_peptide KM606694_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba85a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606695_HBe_P-A Product feature CHAIN KM606695_HBe_P-A of FT:mat_peptide KM606695_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba86a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
YKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESHEHCSPHHTALRQAILCWGELMTLAT
WAGNNLEDPASRDLVVNYVNTNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606696_HBe_P-A Product feature CHAIN KM606696_HBe_P-A of FT:mat_peptide KM606696_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba89a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATTELVSFLPSDFFPNTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGSNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KM606700_HBe_P-A Product feature CHAIN KM606700_HBe_P-A of FT:mat_peptide KM606700_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba100a). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606723_HBe_P-A Product feature CHAIN KM606723_HBe_P-A of FT:mat_peptide KM606723_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba40). Partial genome (Contains: HBe, HBc, HBx, Pol). [Hepadnaviridae] (length=134 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGV
>gnl|hbvpro|KM606737_HBe_P-A Product feature CHAIN KM606737_HBe_P-A of FT:mat_peptide KM606737_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba13a). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606742_HBe_P-A Product feature CHAIN KM606742_HBe_P-A of FT:mat_peptide KM606742_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPFDFFPSVRDFLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606746_HBe_P-A Product feature CHAIN KM606746_HBe_P-A of FT:mat_peptide KM606746_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM606749_HBe_P-A Product feature CHAIN KM606749_HBe_P-A of FT:mat_peptide KM606749_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Cuba56). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168423_HBe_P-A Product feature CHAIN KP168423_HBe_P-A of FT:mat_peptide KP168423_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB517). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168424_HBe_P-A Product feature CHAIN KP168424_HBe_P-A of FT:mat_peptide KP168424_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM571). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168425_HBe_P-A Product feature CHAIN KP168425_HBe_P-A of FT:mat_peptide KP168425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS119). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIFWWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168426_HBe_P-A Product feature CHAIN KP168426_HBe_P-A of FT:mat_peptide KP168426_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM05). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTALALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168427_HBe_P-A Product feature CHAIN KP168427_HBe_P-A of FT:mat_peptide KP168427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB201). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVW
>gnl|hbvpro|KP168428_HBe_P-A Product feature CHAIN KP168428_HBe_P-A of FT:mat_peptide KP168428_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN195). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWGELMTLAT
WVGNNLDDXASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRXTVLEYLVSFGVW
>gnl|hbvpro|KP168429_HBe_P-A Product feature CHAIN KP168429_HBe_P-A of FT:mat_peptide KP168429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KN033). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLXSDFFPSVRDLLDTXSALYREALESPEHCSPHHTALRQAILWWXELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168430_HBe_P-A Product feature CHAIN KP168430_HBe_P-A of FT:mat_peptide KP168430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168432_HBe_P-A Product feature CHAIN KP168432_HBe_P-A of FT:mat_peptide KP168432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EMB213). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168433_HBe_P-A Product feature CHAIN KP168433_HBe_P-A of FT:mat_peptide KP168433_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NRB04). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168434_HBe_P-A Product feature CHAIN KP168434_HBe_P-A of FT:mat_peptide KP168434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate KSM564). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168435_HBe_P-A Product feature CHAIN KP168435_HBe_P-A of FT:mat_peptide KP168435_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MBS117). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243201_HBe_P-A Product feature CHAIN KP243201_HBe_P-A of FT:mat_peptide KP243201_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1000523_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243202_HBe_P-A Product feature CHAIN KP243202_HBe_P-A of FT:mat_peptide KP243202_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1000977_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243204_HBe_P-A Product feature CHAIN KP243204_HBe_P-A of FT:mat_peptide KP243204_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1001941_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243206_HBe_P-A Product feature CHAIN KP243206_HBe_P-A of FT:mat_peptide KP243206_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1004441_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243207_HBe_P-A Product feature CHAIN KP243207_HBe_P-A of FT:mat_peptide KP243207_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1004649_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243208_HBe_P-A Product feature CHAIN KP243208_HBe_P-A of FT:mat_peptide KP243208_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1005053_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243209_HBe_P-A Product feature CHAIN KP243209_HBe_P-A of FT:mat_peptide KP243209_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1005299_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243210_HBe_P-A Product feature CHAIN KP243210_HBe_P-A of FT:mat_peptide KP243210_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1005657_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243211_HBe_P-A Product feature CHAIN KP243211_HBe_P-A of FT:mat_peptide KP243211_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1005831_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243212_HBe_P-A Product feature CHAIN KP243212_HBe_P-A of FT:mat_peptide KP243212_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1008369_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243213_HBe_P-A Product feature CHAIN KP243213_HBe_P-A of FT:mat_peptide KP243213_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1008467_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243214_HBe_P-A Product feature CHAIN KP243214_HBe_P-A of FT:mat_peptide KP243214_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1008551_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243215_HBe_P-A Product feature CHAIN KP243215_HBe_P-A of FT:mat_peptide KP243215_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1009145_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243217_HBe_P-A Product feature CHAIN KP243217_HBe_P-A of FT:mat_peptide KP243217_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1011323_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243218_HBe_P-A Product feature CHAIN KP243218_HBe_P-A of FT:mat_peptide KP243218_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1011797_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243219_HBe_P-A Product feature CHAIN KP243219_HBe_P-A of FT:mat_peptide KP243219_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1013731_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243220_HBe_P-A Product feature CHAIN KP243220_HBe_P-A of FT:mat_peptide KP243220_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1013807_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243221_HBe_P-A Product feature CHAIN KP243221_HBe_P-A of FT:mat_peptide KP243221_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1014095_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243222_HBe_P-A Product feature CHAIN KP243222_HBe_P-A of FT:mat_peptide KP243222_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1014281_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243223_HBe_P-A Product feature CHAIN KP243223_HBe_P-A of FT:mat_peptide KP243223_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1014351_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243224_HBe_P-A Product feature CHAIN KP243224_HBe_P-A of FT:mat_peptide KP243224_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1014533_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243225_HBe_P-A Product feature CHAIN KP243225_HBe_P-A of FT:mat_peptide KP243225_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1014975_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243226_HBe_P-A Product feature CHAIN KP243226_HBe_P-A of FT:mat_peptide KP243226_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1015211_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243227_HBe_P-A Product feature CHAIN KP243227_HBe_P-A of FT:mat_peptide KP243227_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1017187_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243229_HBe_P-A Product feature CHAIN KP243229_HBe_P-A of FT:mat_peptide KP243229_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1018539_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243230_HBe_P-A Product feature CHAIN KP243230_HBe_P-A of FT:mat_peptide KP243230_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1020701_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243232_HBe_P-A Product feature CHAIN KP243232_HBe_P-A of FT:mat_peptide KP243232_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1021571_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243233_HBe_P-A Product feature CHAIN KP243233_HBe_P-A of FT:mat_peptide KP243233_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1021825_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243235_HBe_P-A Product feature CHAIN KP243235_HBe_P-A of FT:mat_peptide KP243235_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1023213_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243236_HBe_P-A Product feature CHAIN KP243236_HBe_P-A of FT:mat_peptide KP243236_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1025905_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243237_HBe_P-A Product feature CHAIN KP243237_HBe_P-A of FT:mat_peptide KP243237_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1025913_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243238_HBe_P-A Product feature CHAIN KP243238_HBe_P-A of FT:mat_peptide KP243238_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1027641_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243241_HBe_P-A Product feature CHAIN KP243241_HBe_P-A of FT:mat_peptide KP243241_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1030961_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243243_HBe_P-A Product feature CHAIN KP243243_HBe_P-A of FT:mat_peptide KP243243_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1032857_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243244_HBe_P-A Product feature CHAIN KP243244_HBe_P-A of FT:mat_peptide KP243244_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1032889_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243245_HBe_P-A Product feature CHAIN KP243245_HBe_P-A of FT:mat_peptide KP243245_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1037747_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243246_HBe_P-A Product feature CHAIN KP243246_HBe_P-A of FT:mat_peptide KP243246_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1040697_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243248_HBe_P-A Product feature CHAIN KP243248_HBe_P-A of FT:mat_peptide KP243248_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1041765_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243249_HBe_P-A Product feature CHAIN KP243249_HBe_P-A of FT:mat_peptide KP243249_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1042923_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243250_HBe_P-A Product feature CHAIN KP243250_HBe_P-A of FT:mat_peptide KP243250_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1044921_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243251_HBe_P-A Product feature CHAIN KP243251_HBe_P-A of FT:mat_peptide KP243251_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1045015_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243253_HBe_P-A Product feature CHAIN KP243253_HBe_P-A of FT:mat_peptide KP243253_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1046795_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243254_HBe_P-A Product feature CHAIN KP243254_HBe_P-A of FT:mat_peptide KP243254_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1047179_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243255_HBe_P-A Product feature CHAIN KP243255_HBe_P-A of FT:mat_peptide KP243255_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1048693_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243256_HBe_P-A Product feature CHAIN KP243256_HBe_P-A of FT:mat_peptide KP243256_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1048945_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243258_HBe_P-A Product feature CHAIN KP243258_HBe_P-A of FT:mat_peptide KP243258_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1051437_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243259_HBe_P-A Product feature CHAIN KP243259_HBe_P-A of FT:mat_peptide KP243259_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1051705_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243261_HBe_P-A Product feature CHAIN KP243261_HBe_P-A of FT:mat_peptide KP243261_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1055131_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243262_HBe_P-A Product feature CHAIN KP243262_HBe_P-A of FT:mat_peptide KP243262_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1055151_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243264_HBe_P-A Product feature CHAIN KP243264_HBe_P-A of FT:mat_peptide KP243264_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1057185_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243265_HBe_P-A Product feature CHAIN KP243265_HBe_P-A of FT:mat_peptide KP243265_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1057251_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243266_HBe_P-A Product feature CHAIN KP243266_HBe_P-A of FT:mat_peptide KP243266_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1057995_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243267_HBe_P-A Product feature CHAIN KP243267_HBe_P-A of FT:mat_peptide KP243267_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300007_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243270_HBe_P-A Product feature CHAIN KP243270_HBe_P-A of FT:mat_peptide KP243270_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300011_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243272_HBe_P-A Product feature CHAIN KP243272_HBe_P-A of FT:mat_peptide KP243272_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300013_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243273_HBe_P-A Product feature CHAIN KP243273_HBe_P-A of FT:mat_peptide KP243273_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300015_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243274_HBe_P-A Product feature CHAIN KP243274_HBe_P-A of FT:mat_peptide KP243274_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300016_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243275_HBe_P-A Product feature CHAIN KP243275_HBe_P-A of FT:mat_peptide KP243275_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300017_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243276_HBe_P-A Product feature CHAIN KP243276_HBe_P-A of FT:mat_peptide KP243276_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300019_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243280_HBe_P-A Product feature CHAIN KP243280_HBe_P-A of FT:mat_peptide KP243280_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300025_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243281_HBe_P-A Product feature CHAIN KP243281_HBe_P-A of FT:mat_peptide KP243281_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300026_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243282_HBe_P-A Product feature CHAIN KP243282_HBe_P-A of FT:mat_peptide KP243282_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300027_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243283_HBe_P-A Product feature CHAIN KP243283_HBe_P-A of FT:mat_peptide KP243283_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300028_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243284_HBe_P-A Product feature CHAIN KP243284_HBe_P-A of FT:mat_peptide KP243284_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300031_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243285_HBe_P-A Product feature CHAIN KP243285_HBe_P-A of FT:mat_peptide KP243285_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300032_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243286_HBe_P-A Product feature CHAIN KP243286_HBe_P-A of FT:mat_peptide KP243286_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300035_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243289_HBe_P-A Product feature CHAIN KP243289_HBe_P-A of FT:mat_peptide KP243289_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300058_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243290_HBe_P-A Product feature CHAIN KP243290_HBe_P-A of FT:mat_peptide KP243290_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300059_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243292_HBe_P-A Product feature CHAIN KP243292_HBe_P-A of FT:mat_peptide KP243292_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300064_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243294_HBe_P-A Product feature CHAIN KP243294_HBe_P-A of FT:mat_peptide KP243294_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300066_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243295_HBe_P-A Product feature CHAIN KP243295_HBe_P-A of FT:mat_peptide KP243295_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300070_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243296_HBe_P-A Product feature CHAIN KP243296_HBe_P-A of FT:mat_peptide KP243296_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300072_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243297_HBe_P-A Product feature CHAIN KP243297_HBe_P-A of FT:mat_peptide KP243297_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300074_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243298_HBe_P-A Product feature CHAIN KP243298_HBe_P-A of FT:mat_peptide KP243298_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300077_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243299_HBe_P-A Product feature CHAIN KP243299_HBe_P-A of FT:mat_peptide KP243299_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300078_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243300_HBe_P-A Product feature CHAIN KP243300_HBe_P-A of FT:mat_peptide KP243300_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300080_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243301_HBe_P-A Product feature CHAIN KP243301_HBe_P-A of FT:mat_peptide KP243301_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300081_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243302_HBe_P-A Product feature CHAIN KP243302_HBe_P-A of FT:mat_peptide KP243302_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300082_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243303_HBe_P-A Product feature CHAIN KP243303_HBe_P-A of FT:mat_peptide KP243303_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300084_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243306_HBe_P-A Product feature CHAIN KP243306_HBe_P-A of FT:mat_peptide KP243306_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300087_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243308_HBe_P-A Product feature CHAIN KP243308_HBe_P-A of FT:mat_peptide KP243308_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300091_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243310_HBe_P-A Product feature CHAIN KP243310_HBe_P-A of FT:mat_peptide KP243310_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300096_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243311_HBe_P-A Product feature CHAIN KP243311_HBe_P-A of FT:mat_peptide KP243311_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300097_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243312_HBe_P-A Product feature CHAIN KP243312_HBe_P-A of FT:mat_peptide KP243312_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300098_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243313_HBe_P-A Product feature CHAIN KP243313_HBe_P-A of FT:mat_peptide KP243313_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300099_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243314_HBe_P-A Product feature CHAIN KP243314_HBe_P-A of FT:mat_peptide KP243314_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1300100_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243318_HBe_P-A Product feature CHAIN KP243318_HBe_P-A of FT:mat_peptide KP243318_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1400006_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243322_HBe_P-A Product feature CHAIN KP243322_HBe_P-A of FT:mat_peptide KP243322_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1400016_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243323_HBe_P-A Product feature CHAIN KP243323_HBe_P-A of FT:mat_peptide KP243323_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1400017_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243324_HBe_P-A Product feature CHAIN KP243324_HBe_P-A of FT:mat_peptide KP243324_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1400018_NL_2013). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVW
>gnl|hbvpro|KP243327_HBe_P-A Product feature CHAIN KP243327_HBe_P-A of FT:mat_peptide KP243327_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 807143_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243328_HBe_P-A Product feature CHAIN KP243328_HBe_P-A of FT:mat_peptide KP243328_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 807393_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243329_HBe_P-A Product feature CHAIN KP243329_HBe_P-A of FT:mat_peptide KP243329_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 807813_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243331_HBe_P-A Product feature CHAIN KP243331_HBe_P-A of FT:mat_peptide KP243331_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 813141_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243332_HBe_P-A Product feature CHAIN KP243332_HBe_P-A of FT:mat_peptide KP243332_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 818067_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243333_HBe_P-A Product feature CHAIN KP243333_HBe_P-A of FT:mat_peptide KP243333_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 819995_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243334_HBe_P-A Product feature CHAIN KP243334_HBe_P-A of FT:mat_peptide KP243334_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 821459_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243335_HBe_P-A Product feature CHAIN KP243335_HBe_P-A of FT:mat_peptide KP243335_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 821993_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243336_HBe_P-A Product feature CHAIN KP243336_HBe_P-A of FT:mat_peptide KP243336_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 822415_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243338_HBe_P-A Product feature CHAIN KP243338_HBe_P-A of FT:mat_peptide KP243338_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823237_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243339_HBe_P-A Product feature CHAIN KP243339_HBe_P-A of FT:mat_peptide KP243339_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 823535_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243342_HBe_P-A Product feature CHAIN KP243342_HBe_P-A of FT:mat_peptide KP243342_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 826381_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243343_HBe_P-A Product feature CHAIN KP243343_HBe_P-A of FT:mat_peptide KP243343_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 826613_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243344_HBe_P-A Product feature CHAIN KP243344_HBe_P-A of FT:mat_peptide KP243344_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 826647_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243345_HBe_P-A Product feature CHAIN KP243345_HBe_P-A of FT:mat_peptide KP243345_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 828083_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243346_HBe_P-A Product feature CHAIN KP243346_HBe_P-A of FT:mat_peptide KP243346_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 828177_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243348_HBe_P-A Product feature CHAIN KP243348_HBe_P-A of FT:mat_peptide KP243348_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 830007_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243349_HBe_P-A Product feature CHAIN KP243349_HBe_P-A of FT:mat_peptide KP243349_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 830305_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243350_HBe_P-A Product feature CHAIN KP243350_HBe_P-A of FT:mat_peptide KP243350_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 830987_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243351_HBe_P-A Product feature CHAIN KP243351_HBe_P-A of FT:mat_peptide KP243351_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 831369_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243352_HBe_P-A Product feature CHAIN KP243352_HBe_P-A of FT:mat_peptide KP243352_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 832871_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243353_HBe_P-A Product feature CHAIN KP243353_HBe_P-A of FT:mat_peptide KP243353_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833397_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243354_HBe_P-A Product feature CHAIN KP243354_HBe_P-A of FT:mat_peptide KP243354_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 833803_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243355_HBe_P-A Product feature CHAIN KP243355_HBe_P-A of FT:mat_peptide KP243355_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 834435_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243356_HBe_P-A Product feature CHAIN KP243356_HBe_P-A of FT:mat_peptide KP243356_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 834733_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243357_HBe_P-A Product feature CHAIN KP243357_HBe_P-A of FT:mat_peptide KP243357_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 834843_NL_2009). Partial genome (Contains: HBe, HBc, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243359_HBe_P-A Product feature CHAIN KP243359_HBe_P-A of FT:mat_peptide KP243359_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 836189_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243361_HBe_P-A Product feature CHAIN KP243361_HBe_P-A of FT:mat_peptide KP243361_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 838747_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243363_HBe_P-A Product feature CHAIN KP243363_HBe_P-A of FT:mat_peptide KP243363_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 840591_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243364_HBe_P-A Product feature CHAIN KP243364_HBe_P-A of FT:mat_peptide KP243364_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 841899_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243365_HBe_P-A Product feature CHAIN KP243365_HBe_P-A of FT:mat_peptide KP243365_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 841923_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243366_HBe_P-A Product feature CHAIN KP243366_HBe_P-A of FT:mat_peptide KP243366_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 843045_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243367_HBe_P-A Product feature CHAIN KP243367_HBe_P-A of FT:mat_peptide KP243367_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 845417_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243368_HBe_P-A Product feature CHAIN KP243368_HBe_P-A of FT:mat_peptide KP243368_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 847729_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243369_HBe_P-A Product feature CHAIN KP243369_HBe_P-A of FT:mat_peptide KP243369_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 848067_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243370_HBe_P-A Product feature CHAIN KP243370_HBe_P-A of FT:mat_peptide KP243370_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 848515_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243371_HBe_P-A Product feature CHAIN KP243371_HBe_P-A of FT:mat_peptide KP243371_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 848521_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243372_HBe_P-A Product feature CHAIN KP243372_HBe_P-A of FT:mat_peptide KP243372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 848897_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243373_HBe_P-A Product feature CHAIN KP243373_HBe_P-A of FT:mat_peptide KP243373_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 849177_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243374_HBe_P-A Product feature CHAIN KP243374_HBe_P-A of FT:mat_peptide KP243374_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 849979_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243375_HBe_P-A Product feature CHAIN KP243375_HBe_P-A of FT:mat_peptide KP243375_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 850935_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243376_HBe_P-A Product feature CHAIN KP243376_HBe_P-A of FT:mat_peptide KP243376_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 856155_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243377_HBe_P-A Product feature CHAIN KP243377_HBe_P-A of FT:mat_peptide KP243377_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 859273_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243378_HBe_P-A Product feature CHAIN KP243378_HBe_P-A of FT:mat_peptide KP243378_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 859275_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243380_HBe_P-A Product feature CHAIN KP243380_HBe_P-A of FT:mat_peptide KP243380_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 861249_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243381_HBe_P-A Product feature CHAIN KP243381_HBe_P-A of FT:mat_peptide KP243381_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 861365_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243382_HBe_P-A Product feature CHAIN KP243382_HBe_P-A of FT:mat_peptide KP243382_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 862435_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243383_HBe_P-A Product feature CHAIN KP243383_HBe_P-A of FT:mat_peptide KP243383_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 863731_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243384_HBe_P-A Product feature CHAIN KP243384_HBe_P-A of FT:mat_peptide KP243384_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 863785_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243386_HBe_P-A Product feature CHAIN KP243386_HBe_P-A of FT:mat_peptide KP243386_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 865697_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243387_HBe_P-A Product feature CHAIN KP243387_HBe_P-A of FT:mat_peptide KP243387_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 866333_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243388_HBe_P-A Product feature CHAIN KP243388_HBe_P-A of FT:mat_peptide KP243388_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 866409_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243389_HBe_P-A Product feature CHAIN KP243389_HBe_P-A of FT:mat_peptide KP243389_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 866425_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243393_HBe_P-A Product feature CHAIN KP243393_HBe_P-A of FT:mat_peptide KP243393_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 867663_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243396_HBe_P-A Product feature CHAIN KP243396_HBe_P-A of FT:mat_peptide KP243396_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 869781_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243397_HBe_P-A Product feature CHAIN KP243397_HBe_P-A of FT:mat_peptide KP243397_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 871717_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243398_HBe_P-A Product feature CHAIN KP243398_HBe_P-A of FT:mat_peptide KP243398_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 874995_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243400_HBe_P-A Product feature CHAIN KP243400_HBe_P-A of FT:mat_peptide KP243400_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 877693_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243401_HBe_P-A Product feature CHAIN KP243401_HBe_P-A of FT:mat_peptide KP243401_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 878697_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243402_HBe_P-A Product feature CHAIN KP243402_HBe_P-A of FT:mat_peptide KP243402_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 878877_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243404_HBe_P-A Product feature CHAIN KP243404_HBe_P-A of FT:mat_peptide KP243404_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 881831_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243406_HBe_P-A Product feature CHAIN KP243406_HBe_P-A of FT:mat_peptide KP243406_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 882225_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243407_HBe_P-A Product feature CHAIN KP243407_HBe_P-A of FT:mat_peptide KP243407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 882817_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243408_HBe_P-A Product feature CHAIN KP243408_HBe_P-A of FT:mat_peptide KP243408_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 882839_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243411_HBe_P-A Product feature CHAIN KP243411_HBe_P-A of FT:mat_peptide KP243411_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 883733_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243412_HBe_P-A Product feature CHAIN KP243412_HBe_P-A of FT:mat_peptide KP243412_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 884303_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243413_HBe_P-A Product feature CHAIN KP243413_HBe_P-A of FT:mat_peptide KP243413_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 884739_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243414_HBe_P-A Product feature CHAIN KP243414_HBe_P-A of FT:mat_peptide KP243414_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 885841_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243415_HBe_P-A Product feature CHAIN KP243415_HBe_P-A of FT:mat_peptide KP243415_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 886131_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243418_HBe_P-A Product feature CHAIN KP243418_HBe_P-A of FT:mat_peptide KP243418_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 887951_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243419_HBe_P-A Product feature CHAIN KP243419_HBe_P-A of FT:mat_peptide KP243419_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 889017_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243420_HBe_P-A Product feature CHAIN KP243420_HBe_P-A of FT:mat_peptide KP243420_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 889607_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243422_HBe_P-A Product feature CHAIN KP243422_HBe_P-A of FT:mat_peptide KP243422_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 890045_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243423_HBe_P-A Product feature CHAIN KP243423_HBe_P-A of FT:mat_peptide KP243423_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 891045_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243424_HBe_P-A Product feature CHAIN KP243424_HBe_P-A of FT:mat_peptide KP243424_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 891203_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243425_HBe_P-A Product feature CHAIN KP243425_HBe_P-A of FT:mat_peptide KP243425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 891727_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243426_HBe_P-A Product feature CHAIN KP243426_HBe_P-A of FT:mat_peptide KP243426_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 893075_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243427_HBe_P-A Product feature CHAIN KP243427_HBe_P-A of FT:mat_peptide KP243427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 893303_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243429_HBe_P-A Product feature CHAIN KP243429_HBe_P-A of FT:mat_peptide KP243429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 893567_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243431_HBe_P-A Product feature CHAIN KP243431_HBe_P-A of FT:mat_peptide KP243431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 894763_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243432_HBe_P-A Product feature CHAIN KP243432_HBe_P-A of FT:mat_peptide KP243432_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 896045_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243433_HBe_P-A Product feature CHAIN KP243433_HBe_P-A of FT:mat_peptide KP243433_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 897189_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243434_HBe_P-A Product feature CHAIN KP243434_HBe_P-A of FT:mat_peptide KP243434_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 898037_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243435_HBe_P-A Product feature CHAIN KP243435_HBe_P-A of FT:mat_peptide KP243435_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 898933_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243438_HBe_P-A Product feature CHAIN KP243438_HBe_P-A of FT:mat_peptide KP243438_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 900203_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243439_HBe_P-A Product feature CHAIN KP243439_HBe_P-A of FT:mat_peptide KP243439_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 901311_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243442_HBe_P-A Product feature CHAIN KP243442_HBe_P-A of FT:mat_peptide KP243442_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 901989_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243443_HBe_P-A Product feature CHAIN KP243443_HBe_P-A of FT:mat_peptide KP243443_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 902721_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243444_HBe_P-A Product feature CHAIN KP243444_HBe_P-A of FT:mat_peptide KP243444_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 902841_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243447_HBe_P-A Product feature CHAIN KP243447_HBe_P-A of FT:mat_peptide KP243447_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 903545_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243448_HBe_P-A Product feature CHAIN KP243448_HBe_P-A of FT:mat_peptide KP243448_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 903999_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243449_HBe_P-A Product feature CHAIN KP243449_HBe_P-A of FT:mat_peptide KP243449_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 904001_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243450_HBe_P-A Product feature CHAIN KP243450_HBe_P-A of FT:mat_peptide KP243450_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 904021_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243452_HBe_P-A Product feature CHAIN KP243452_HBe_P-A of FT:mat_peptide KP243452_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 904637_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243453_HBe_P-A Product feature CHAIN KP243453_HBe_P-A of FT:mat_peptide KP243453_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 904807_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243454_HBe_P-A Product feature CHAIN KP243454_HBe_P-A of FT:mat_peptide KP243454_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 904903_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243455_HBe_P-A Product feature CHAIN KP243455_HBe_P-A of FT:mat_peptide KP243455_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 905533_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243456_HBe_P-A Product feature CHAIN KP243456_HBe_P-A of FT:mat_peptide KP243456_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 906093_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243457_HBe_P-A Product feature CHAIN KP243457_HBe_P-A of FT:mat_peptide KP243457_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 906109_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243460_HBe_P-A Product feature CHAIN KP243460_HBe_P-A of FT:mat_peptide KP243460_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 907645_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243461_HBe_P-A Product feature CHAIN KP243461_HBe_P-A of FT:mat_peptide KP243461_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 908213_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243462_HBe_P-A Product feature CHAIN KP243462_HBe_P-A of FT:mat_peptide KP243462_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 908677_NL_2009). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243463_HBe_P-A Product feature CHAIN KP243463_HBe_P-A of FT:mat_peptide KP243463_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 908843_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243464_HBe_P-A Product feature CHAIN KP243464_HBe_P-A of FT:mat_peptide KP243464_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 909527_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243466_HBe_P-A Product feature CHAIN KP243466_HBe_P-A of FT:mat_peptide KP243466_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 911469_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243471_HBe_P-A Product feature CHAIN KP243471_HBe_P-A of FT:mat_peptide KP243471_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 912713_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243473_HBe_P-A Product feature CHAIN KP243473_HBe_P-A of FT:mat_peptide KP243473_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 915259_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243474_HBe_P-A Product feature CHAIN KP243474_HBe_P-A of FT:mat_peptide KP243474_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 916291_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243475_HBe_P-A Product feature CHAIN KP243475_HBe_P-A of FT:mat_peptide KP243475_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 916523_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243477_HBe_P-A Product feature CHAIN KP243477_HBe_P-A of FT:mat_peptide KP243477_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 917087_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243479_HBe_P-A Product feature CHAIN KP243479_HBe_P-A of FT:mat_peptide KP243479_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 917435_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243482_HBe_P-A Product feature CHAIN KP243482_HBe_P-A of FT:mat_peptide KP243482_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 919413_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243483_HBe_P-A Product feature CHAIN KP243483_HBe_P-A of FT:mat_peptide KP243483_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 921603_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243487_HBe_P-A Product feature CHAIN KP243487_HBe_P-A of FT:mat_peptide KP243487_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 921877_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243489_HBe_P-A Product feature CHAIN KP243489_HBe_P-A of FT:mat_peptide KP243489_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 923727_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243490_HBe_P-A Product feature CHAIN KP243490_HBe_P-A of FT:mat_peptide KP243490_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 924527_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243491_HBe_P-A Product feature CHAIN KP243491_HBe_P-A of FT:mat_peptide KP243491_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 925047_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243492_HBe_P-A Product feature CHAIN KP243492_HBe_P-A of FT:mat_peptide KP243492_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 925669_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243496_HBe_P-A Product feature CHAIN KP243496_HBe_P-A of FT:mat_peptide KP243496_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 927871_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243498_HBe_P-A Product feature CHAIN KP243498_HBe_P-A of FT:mat_peptide KP243498_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 930881_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243499_HBe_P-A Product feature CHAIN KP243499_HBe_P-A of FT:mat_peptide KP243499_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 930983_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243500_HBe_P-A Product feature CHAIN KP243500_HBe_P-A of FT:mat_peptide KP243500_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 931403_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243501_HBe_P-A Product feature CHAIN KP243501_HBe_P-A of FT:mat_peptide KP243501_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 933365_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243504_HBe_P-A Product feature CHAIN KP243504_HBe_P-A of FT:mat_peptide KP243504_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 937389_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243505_HBe_P-A Product feature CHAIN KP243505_HBe_P-A of FT:mat_peptide KP243505_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 937947_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243506_HBe_P-A Product feature CHAIN KP243506_HBe_P-A of FT:mat_peptide KP243506_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 938599_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243507_HBe_P-A Product feature CHAIN KP243507_HBe_P-A of FT:mat_peptide KP243507_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 938799_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243509_HBe_P-A Product feature CHAIN KP243509_HBe_P-A of FT:mat_peptide KP243509_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 939255_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243511_HBe_P-A Product feature CHAIN KP243511_HBe_P-A of FT:mat_peptide KP243511_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 939479_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243512_HBe_P-A Product feature CHAIN KP243512_HBe_P-A of FT:mat_peptide KP243512_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 940229_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243513_HBe_P-A Product feature CHAIN KP243513_HBe_P-A of FT:mat_peptide KP243513_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 941383_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243515_HBe_P-A Product feature CHAIN KP243515_HBe_P-A of FT:mat_peptide KP243515_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 943025_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243516_HBe_P-A Product feature CHAIN KP243516_HBe_P-A of FT:mat_peptide KP243516_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 943943_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243517_HBe_P-A Product feature CHAIN KP243517_HBe_P-A of FT:mat_peptide KP243517_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 943947_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243518_HBe_P-A Product feature CHAIN KP243518_HBe_P-A of FT:mat_peptide KP243518_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 944215_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243519_HBe_P-A Product feature CHAIN KP243519_HBe_P-A of FT:mat_peptide KP243519_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 944271_NL_2010). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243520_HBe_P-A Product feature CHAIN KP243520_HBe_P-A of FT:mat_peptide KP243520_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 944591_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243521_HBe_P-A Product feature CHAIN KP243521_HBe_P-A of FT:mat_peptide KP243521_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 944861_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243523_HBe_P-A Product feature CHAIN KP243523_HBe_P-A of FT:mat_peptide KP243523_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 946209_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243524_HBe_P-A Product feature CHAIN KP243524_HBe_P-A of FT:mat_peptide KP243524_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 946761_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243526_HBe_P-A Product feature CHAIN KP243526_HBe_P-A of FT:mat_peptide KP243526_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 946839_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243527_HBe_P-A Product feature CHAIN KP243527_HBe_P-A of FT:mat_peptide KP243527_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 948711_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243528_HBe_P-A Product feature CHAIN KP243528_HBe_P-A of FT:mat_peptide KP243528_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 948925_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243529_HBe_P-A Product feature CHAIN KP243529_HBe_P-A of FT:mat_peptide KP243529_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 949529_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243530_HBe_P-A Product feature CHAIN KP243530_HBe_P-A of FT:mat_peptide KP243530_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 949761_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243531_HBe_P-A Product feature CHAIN KP243531_HBe_P-A of FT:mat_peptide KP243531_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 951089_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243532_HBe_P-A Product feature CHAIN KP243532_HBe_P-A of FT:mat_peptide KP243532_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 952233_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243533_HBe_P-A Product feature CHAIN KP243533_HBe_P-A of FT:mat_peptide KP243533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 952343_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243534_HBe_P-A Product feature CHAIN KP243534_HBe_P-A of FT:mat_peptide KP243534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 952611_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243535_HBe_P-A Product feature CHAIN KP243535_HBe_P-A of FT:mat_peptide KP243535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953001_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243536_HBe_P-A Product feature CHAIN KP243536_HBe_P-A of FT:mat_peptide KP243536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953087_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLXWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243537_HBe_P-A Product feature CHAIN KP243537_HBe_P-A of FT:mat_peptide KP243537_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953089_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243538_HBe_P-A Product feature CHAIN KP243538_HBe_P-A of FT:mat_peptide KP243538_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953365_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243539_HBe_P-A Product feature CHAIN KP243539_HBe_P-A of FT:mat_peptide KP243539_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 953691_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243540_HBe_P-A Product feature CHAIN KP243540_HBe_P-A of FT:mat_peptide KP243540_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 955699_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243542_HBe_P-A Product feature CHAIN KP243542_HBe_P-A of FT:mat_peptide KP243542_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 956665_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243544_HBe_P-A Product feature CHAIN KP243544_HBe_P-A of FT:mat_peptide KP243544_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 956897_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243545_HBe_P-A Product feature CHAIN KP243545_HBe_P-A of FT:mat_peptide KP243545_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 957415_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243546_HBe_P-A Product feature CHAIN KP243546_HBe_P-A of FT:mat_peptide KP243546_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 958449_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243547_HBe_P-A Product feature CHAIN KP243547_HBe_P-A of FT:mat_peptide KP243547_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 958517_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243549_HBe_P-A Product feature CHAIN KP243549_HBe_P-A of FT:mat_peptide KP243549_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 959603_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243550_HBe_P-A Product feature CHAIN KP243550_HBe_P-A of FT:mat_peptide KP243550_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 959747_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243552_HBe_P-A Product feature CHAIN KP243552_HBe_P-A of FT:mat_peptide KP243552_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 960341_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243553_HBe_P-A Product feature CHAIN KP243553_HBe_P-A of FT:mat_peptide KP243553_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 962353_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243554_HBe_P-A Product feature CHAIN KP243554_HBe_P-A of FT:mat_peptide KP243554_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 962405_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243555_HBe_P-A Product feature CHAIN KP243555_HBe_P-A of FT:mat_peptide KP243555_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 963165_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243558_HBe_P-A Product feature CHAIN KP243558_HBe_P-A of FT:mat_peptide KP243558_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 966133_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243559_HBe_P-A Product feature CHAIN KP243559_HBe_P-A of FT:mat_peptide KP243559_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 968595_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243561_HBe_P-A Product feature CHAIN KP243561_HBe_P-A of FT:mat_peptide KP243561_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 969381_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243562_HBe_P-A Product feature CHAIN KP243562_HBe_P-A of FT:mat_peptide KP243562_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 970021_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243563_HBe_P-A Product feature CHAIN KP243563_HBe_P-A of FT:mat_peptide KP243563_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 970191_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243564_HBe_P-A Product feature CHAIN KP243564_HBe_P-A of FT:mat_peptide KP243564_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 971181_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243565_HBe_P-A Product feature CHAIN KP243565_HBe_P-A of FT:mat_peptide KP243565_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 971921_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243566_HBe_P-A Product feature CHAIN KP243566_HBe_P-A of FT:mat_peptide KP243566_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 972585_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243568_HBe_P-A Product feature CHAIN KP243568_HBe_P-A of FT:mat_peptide KP243568_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 975451_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243570_HBe_P-A Product feature CHAIN KP243570_HBe_P-A of FT:mat_peptide KP243570_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 977819_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243571_HBe_P-A Product feature CHAIN KP243571_HBe_P-A of FT:mat_peptide KP243571_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 979755_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243573_HBe_P-A Product feature CHAIN KP243573_HBe_P-A of FT:mat_peptide KP243573_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 979991_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243574_HBe_P-A Product feature CHAIN KP243574_HBe_P-A of FT:mat_peptide KP243574_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 980359_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243575_HBe_P-A Product feature CHAIN KP243575_HBe_P-A of FT:mat_peptide KP243575_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 980573_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243576_HBe_P-A Product feature CHAIN KP243576_HBe_P-A of FT:mat_peptide KP243576_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 981277_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243578_HBe_P-A Product feature CHAIN KP243578_HBe_P-A of FT:mat_peptide KP243578_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 983899_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243580_HBe_P-A Product feature CHAIN KP243580_HBe_P-A of FT:mat_peptide KP243580_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 984331_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243581_HBe_P-A Product feature CHAIN KP243581_HBe_P-A of FT:mat_peptide KP243581_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 984865_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243582_HBe_P-A Product feature CHAIN KP243582_HBe_P-A of FT:mat_peptide KP243582_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 985029_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243584_HBe_P-A Product feature CHAIN KP243584_HBe_P-A of FT:mat_peptide KP243584_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 986395_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243587_HBe_P-A Product feature CHAIN KP243587_HBe_P-A of FT:mat_peptide KP243587_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 989913_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243588_HBe_P-A Product feature CHAIN KP243588_HBe_P-A of FT:mat_peptide KP243588_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 990019_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243589_HBe_P-A Product feature CHAIN KP243589_HBe_P-A of FT:mat_peptide KP243589_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 990537_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVW
>gnl|hbvpro|KP243590_HBe_P-A Product feature CHAIN KP243590_HBe_P-A of FT:mat_peptide KP243590_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 990725_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243591_HBe_P-A Product feature CHAIN KP243591_HBe_P-A of FT:mat_peptide KP243591_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 990767_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243593_HBe_P-A Product feature CHAIN KP243593_HBe_P-A of FT:mat_peptide KP243593_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 992241_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243594_HBe_P-A Product feature CHAIN KP243594_HBe_P-A of FT:mat_peptide KP243594_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 995287_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243595_HBe_P-A Product feature CHAIN KP243595_HBe_P-A of FT:mat_peptide KP243595_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 995397_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243596_HBe_P-A Product feature CHAIN KP243596_HBe_P-A of FT:mat_peptide KP243596_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 996453_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP243598_HBe_P-A Product feature CHAIN KP243598_HBe_P-A of FT:mat_peptide KP243598_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 997565_NL_2012). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP274925_HBe_P-A Product feature CHAIN KP274925_HBe_P-A of FT:mat_peptide KP274925_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP274927_HBe_P-A Product feature CHAIN KP274927_HBe_P-A of FT:mat_peptide KP274927_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP274928_HBe_P-A Product feature CHAIN KP274928_HBe_P-A of FT:mat_peptide KP274928_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GS). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718085_HBe_P-A Product feature CHAIN KP718085_HBe_P-A of FT:mat_peptide KP718085_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718086_HBe_P-A Product feature CHAIN KP718086_HBe_P-A of FT:mat_peptide KP718086_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718087_HBe_P-A Product feature CHAIN KP718087_HBe_P-A of FT:mat_peptide KP718087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718088_HBe_P-A Product feature CHAIN KP718088_HBe_P-A of FT:mat_peptide KP718088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718089_HBe_P-A Product feature CHAIN KP718089_HBe_P-A of FT:mat_peptide KP718089_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEXPEHCSPHHTALRQAIXCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718090_HBe_P-A Product feature CHAIN KP718090_HBe_P-A of FT:mat_peptide KP718090_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA). Complete genome. [Hepadnaviridae] (length=135 residues).
XKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718091_HBe_P-A Product feature CHAIN KP718091_HBe_P-A of FT:mat_peptide KP718091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718092_HBe_P-A Product feature CHAIN KP718092_HBe_P-A of FT:mat_peptide KP718092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA). Complete genome. [Hepadnaviridae] (length=135 residues).
XKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718093_HBe_P-A Product feature CHAIN KP718093_HBe_P-A of FT:mat_peptide KP718093_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718094_HBe_P-A Product feature CHAIN KP718094_HBe_P-A of FT:mat_peptide KP718094_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8757_TR). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGVKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718095_HBe_P-A Product feature CHAIN KP718095_HBe_P-A of FT:mat_peptide KP718095_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 8809_TR). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718096_HBe_P-A Product feature CHAIN KP718096_HBe_P-A of FT:mat_peptide KP718096_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate PA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718097_HBe_P-A Product feature CHAIN KP718097_HBe_P-A of FT:mat_peptide KP718097_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718098_HBe_P-A Product feature CHAIN KP718098_HBe_P-A of FT:mat_peptide KP718098_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 3106_HIV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718099_HBe_P-A Product feature CHAIN KP718099_HBe_P-A of FT:mat_peptide KP718099_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718100_HBe_P-A Product feature CHAIN KP718100_HBe_P-A of FT:mat_peptide KP718100_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 137_HIV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDXLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP718101_HBe_P-A Product feature CHAIN KP718101_HBe_P-A of FT:mat_peptide KP718101_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate GP11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPHPRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857058_HBe_P-A Product feature CHAIN KP857058_HBe_P-A of FT:mat_peptide KP857058_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857059_HBe_P-A Product feature CHAIN KP857059_HBe_P-A of FT:mat_peptide KP857059_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDLVLEYLVSFGVW
>gnl|hbvpro|KP857060_HBe_P-A Product feature CHAIN KP857060_HBe_P-A of FT:mat_peptide KP857060_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSARDLLDTAAALFREALESPEHCSPHHTALRQASLCWVELMTLAT
WVGNNLQDTASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857061_HBe_P-A Product feature CHAIN KP857061_HBe_P-A of FT:mat_peptide KP857061_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857062_HBe_P-A Product feature CHAIN KP857062_HBe_P-A of FT:mat_peptide KP857062_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|KP857063_HBe_P-A Product feature CHAIN KP857063_HBe_P-A of FT:mat_peptide KP857063_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KP857064_HBe_P-A Product feature CHAIN KP857064_HBe_P-A of FT:mat_peptide KP857064_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYREALEAPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTHMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857065_HBe_P-A Product feature CHAIN KP857065_HBe_P-A of FT:mat_peptide KP857065_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYREALESPEHCSAHHTAIRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|KP857066_HBe_P-A Product feature CHAIN KP857066_HBe_P-A of FT:mat_peptide KP857066_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVKDLYDTALALHREALESPEHCTHHHTALRQAILCWGDLMNLAN
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857067_HBe_P-A Product feature CHAIN KP857067_HBe_P-A of FT:mat_peptide KP857067_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESAEHCSPHHTALRQAILCWGDVMTLGT
WVGNNLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLISFGVW
>gnl|hbvpro|KP857068_HBe_P-A Product feature CHAIN KP857068_HBe_P-A of FT:mat_peptide KP857068_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTAIRQIVLCWGDVMNLAT
WVGSNLQDPASRDQVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVVEYLVSFGVW
>gnl|hbvpro|KP857069_HBe_P-A Product feature CHAIN KP857069_HBe_P-A of FT:mat_peptide KP857069_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSSHHTALRQAILCWGELTTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857070_HBe_P-A Product feature CHAIN KP857070_HBe_P-A of FT:mat_peptide KP857070_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQAILCWGDLTTLGS
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KP857071_HBe_P-A Product feature CHAIN KP857071_HBe_P-A of FT:mat_peptide KP857071_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREXLESPEHCSPHHTALRQAILCWGDLTTLGS
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KP857072_HBe_P-A Product feature CHAIN KP857072_HBe_P-A of FT:mat_peptide KP857072_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALFREALESPEHGSSHHTALRQAILCWQEVTTLAS
WVGTNLDDPSSRDQVVHYVNTNMGLKIRQLLWFHISCLTFGRDIVLEYLVSFGVW
>gnl|hbvpro|KP857073_HBe_P-A Product feature CHAIN KP857073_HBe_P-A of FT:mat_peptide KP857073_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFYPSVRDLLDTATALYREALESPEHCSAHHTAIRQAILCWGELMTLAS
WVGANLDDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRHTVLEYLVSFGVW
>gnl|hbvpro|KP857074_HBe_P-A Product feature CHAIN KP857074_HBe_P-A of FT:mat_peptide KP857074_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATAELLSFLPNDFYPSVKDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLAT
WVGNNLEDQASRNLVVDYVNNNVGLRLRQLLWFHVSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857075_HBe_P-A Product feature CHAIN KP857075_HBe_P-A of FT:mat_peptide KP857075_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESSEHCSPHHTALRQAALCWWELTTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVVEYLISFGVW
>gnl|hbvpro|KP857076_HBe_P-A Product feature CHAIN KP857076_HBe_P-A of FT:mat_peptide KP857076_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGEVTXLAT
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857077_HBe_P-A Product feature CHAIN KP857077_HBe_P-A of FT:mat_peptide KP857077_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPIDFYPSVRDLIETASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVVEYLVSFGVW
>gnl|hbvpro|KP857078_HBe_P-A Product feature CHAIN KP857078_HBe_P-A of FT:mat_peptide KP857078_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSTKDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVMTLGT
WVGNNLEDQASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857079_HBe_P-A Product feature CHAIN KP857079_HBe_P-A of FT:mat_peptide KP857079_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHXSPHHTALRQAILCWGXVMTLGT
WVGBNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KP857080_HBe_P-A Product feature CHAIN KP857080_HBe_P-A of FT:mat_peptide KP857080_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP857091_HBe_P-A Product feature CHAIN KP857091_HBe_P-A of FT:mat_peptide KP857091_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSIRDLLDTASALYREALESPEHCSHHHTAIRQAILCWGELTTLAT
WVGTNLDDPGSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEFLVSFGVW
>gnl|hbvpro|KP857092_HBe_P-A Product feature CHAIN KP857092_HBe_P-A of FT:mat_peptide KP857092_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWVELXTLAT
WVGNNLEDPASRDQVVNYVNTNMGLKLRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP995108_HBe_P-A Product feature CHAIN KP995108_HBe_P-A of FT:mat_peptide KP995108_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 203). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGATVELLSFLPSDFYPSVRDLVDTASALYREALESPEHGSPHHTALRQAIVCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KR905425_HBe_P-A Product feature CHAIN KR905425_HBe_P-A of FT:mat_peptide KR905425_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KR905426_HBe_P-A Product feature CHAIN KR905426_HBe_P-A of FT:mat_peptide KR905426_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KR905427_HBe_P-A Product feature CHAIN KR905427_HBe_P-A of FT:mat_peptide KR905427_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALEAPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KR905429_HBe_P-A Product feature CHAIN KR905429_HBe_P-A of FT:mat_peptide KR905429_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KR905430_HBe_P-A Product feature CHAIN KR905430_HBe_P-A of FT:mat_peptide KR905430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KR905431_HBe_P-A Product feature CHAIN KR905431_HBe_P-A of FT:mat_peptide KR905431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate EICI). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT151611_HBe_P-A Product feature CHAIN KT151611_HBe_P-A of FT:mat_peptide KT151611_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 398). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT151612_HBe_P-A Product feature CHAIN KT151612_HBe_P-A of FT:mat_peptide KT151612_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 500). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT151613_HBe_P-A Product feature CHAIN KT151613_HBe_P-A of FT:mat_peptide KT151613_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 792). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT151614_HBe_P-A Product feature CHAIN KT151614_HBe_P-A of FT:mat_peptide KT151614_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 969). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT151615_HBe_P-A Product feature CHAIN KT151615_HBe_P-A of FT:mat_peptide KT151615_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 191). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGATVELLSFLPXDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT151616_HBe_P-A Product feature CHAIN KT151616_HBe_P-A of FT:mat_peptide KT151616_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 655). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT151617_HBe_P-A Product feature CHAIN KT151617_HBe_P-A of FT:mat_peptide KT151617_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 803). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATSELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT151618_HBe_P-A Product feature CHAIN KT151618_HBe_P-A of FT:mat_peptide KT151618_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 590). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT347087_HBe_P-A Product feature CHAIN KT347087_HBe_P-A of FT:mat_peptide KT347087_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM265). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT347088_HBe_P-A Product feature CHAIN KT347088_HBe_P-A of FT:mat_peptide KT347088_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM285). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT366466_HBe_P-A Product feature CHAIN KT366466_HBe_P-A of FT:mat_peptide KT366466_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT366467_HBe_P-A Product feature CHAIN KT366467_HBe_P-A of FT:mat_peptide KT366467_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT366468_HBe_P-A Product feature CHAIN KT366468_HBe_P-A of FT:mat_peptide KT366468_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT366469_HBe_P-A Product feature CHAIN KT366469_HBe_P-A of FT:mat_peptide KT366469_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT366470_HBe_P-A Product feature CHAIN KT366470_HBe_P-A of FT:mat_peptide KT366470_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT366471_HBe_P-A Product feature CHAIN KT366471_HBe_P-A of FT:mat_peptide KT366471_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate C). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749824_HBe_P-A Product feature CHAIN KT749824_HBe_P-A of FT:mat_peptide KT749824_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL2b). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLGFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749825_HBe_P-A Product feature CHAIN KT749825_HBe_P-A of FT:mat_peptide KT749825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4a). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749826_HBe_P-A Product feature CHAIN KT749826_HBe_P-A of FT:mat_peptide KT749826_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4b). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749829_HBe_P-A Product feature CHAIN KT749829_HBe_P-A of FT:mat_peptide KT749829_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL7). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749830_HBe_P-A Product feature CHAIN KT749830_HBe_P-A of FT:mat_peptide KT749830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5b). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749831_HBe_P-A Product feature CHAIN KT749831_HBe_P-A of FT:mat_peptide KT749831_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749832_HBe_P-A Product feature CHAIN KT749832_HBe_P-A of FT:mat_peptide KT749832_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELISFLPADFFPSVRDLLDTASALFREALESPEHCSAHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749833_HBe_P-A Product feature CHAIN KT749833_HBe_P-A of FT:mat_peptide KT749833_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9b). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGATVELLSFLPSDFFPSVRDLVDTASALHREALESPEHCSPHHTALRQAIVCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749834_HBe_P-A Product feature CHAIN KT749834_HBe_P-A of FT:mat_peptide KT749834_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9a). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749835_HBe_P-A Product feature CHAIN KT749835_HBe_P-A of FT:mat_peptide KT749835_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL9c). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749836_HBe_P-A Product feature CHAIN KT749836_HBe_P-A of FT:mat_peptide KT749836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749837_HBe_P-A Product feature CHAIN KT749837_HBe_P-A of FT:mat_peptide KT749837_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL15). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749838_HBe_P-A Product feature CHAIN KT749838_HBe_P-A of FT:mat_peptide KT749838_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749839_HBe_P-A Product feature CHAIN KT749839_HBe_P-A of FT:mat_peptide KT749839_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5d). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749840_HBe_P-A Product feature CHAIN KT749840_HBe_P-A of FT:mat_peptide KT749840_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL18). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749842_HBe_P-A Product feature CHAIN KT749842_HBe_P-A of FT:mat_peptide KT749842_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4e). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749843_HBe_P-A Product feature CHAIN KT749843_HBe_P-A of FT:mat_peptide KT749843_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL5c). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAMYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749844_HBe_P-A Product feature CHAIN KT749844_HBe_P-A of FT:mat_peptide KT749844_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL25). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749846_HBe_P-A Product feature CHAIN KT749846_HBe_P-A of FT:mat_peptide KT749846_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4f). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749847_HBe_P-A Product feature CHAIN KT749847_HBe_P-A of FT:mat_peptide KT749847_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4d). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749849_HBe_P-A Product feature CHAIN KT749849_HBe_P-A of FT:mat_peptide KT749849_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL4c). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT749850_HBe_P-A Product feature CHAIN KT749850_HBe_P-A of FT:mat_peptide KT749850_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate FL21). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605516_HBe_P-A Product feature CHAIN KU605516_HBe_P-A of FT:mat_peptide KU605516_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605517_HBe_P-A Product feature CHAIN KU605517_HBe_P-A of FT:mat_peptide KU605517_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486F2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605518_HBe_P-A Product feature CHAIN KU605518_HBe_P-A of FT:mat_peptide KU605518_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605519_HBe_P-A Product feature CHAIN KU605519_HBe_P-A of FT:mat_peptide KU605519_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F3). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605520_HBe_P-A Product feature CHAIN KU605520_HBe_P-A of FT:mat_peptide KU605520_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F1). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605521_HBe_P-A Product feature CHAIN KU605521_HBe_P-A of FT:mat_peptide KU605521_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F2). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605522_HBe_P-A Product feature CHAIN KU605522_HBe_P-A of FT:mat_peptide KU605522_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163F4). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605532_HBe_P-A Product feature CHAIN KU605532_HBe_P-A of FT:mat_peptide KU605532_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1486Baseline). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605533_HBe_P-A Product feature CHAIN KU605533_HBe_P-A of FT:mat_peptide KU605533_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787Baseline). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605534_HBe_P-A Product feature CHAIN KU605534_HBe_P-A of FT:mat_peptide KU605534_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM8787F2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605535_HBe_P-A Product feature CHAIN KU605535_HBe_P-A of FT:mat_peptide KU605535_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM1163Baseline). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605536_HBe_P-A Product feature CHAIN KU605536_HBe_P-A of FT:mat_peptide KU605536_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643Baseline). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605537_HBe_P-A Product feature CHAIN KU605537_HBe_P-A of FT:mat_peptide KU605537_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605538_HBe_P-A Product feature CHAIN KU605538_HBe_P-A of FT:mat_peptide KU605538_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU605539_HBe_P-A Product feature CHAIN KU605539_HBe_P-A of FT:mat_peptide KU605539_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate ZADGM4643F3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU736918_HBe_P-A Product feature CHAIN KU736918_HBe_P-A of FT:mat_peptide KU736918_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU736919_HBe_P-A Product feature CHAIN KU736919_HBe_P-A of FT:mat_peptide KU736919_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Tanzania_2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU736920_HBe_P-A Product feature CHAIN KU736920_HBe_P-A of FT:mat_peptide KU736920_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Sudan_10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKXFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX276769_HBe_P-A Product feature CHAIN KX276769_HBe_P-A of FT:mat_peptide KX276769_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSSHHTALRQAILCWGELMTLAS
WVGNNLQDPASRDQVVSYVNTNMGLKIRQLLWFHISCLTFGRDAVLEYLVSFGVW
>gnl|hbvpro|KX357640_HBe_P-A Product feature CHAIN KX357640_HBe_P-A of FT:mat_peptide KX357640_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA11ETH). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDVTNLAT
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX357642_HBe_P-A Product feature CHAIN KX357642_HBe_P-A of FT:mat_peptide KX357642_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate JM16ETH). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX357643_HBe_P-A Product feature CHAIN KX357643_HBe_P-A of FT:mat_peptide KX357643_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MK156ETH). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX357644_HBe_P-A Product feature CHAIN KX357644_HBe_P-A of FT:mat_peptide KX357644_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA152ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVW
>gnl|hbvpro|KX357645_HBe_P-A Product feature CHAIN KX357645_HBe_P-A of FT:mat_peptide KX357645_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA162ETH). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX357646_HBe_P-A Product feature CHAIN KX357646_HBe_P-A of FT:mat_peptide KX357646_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL185ETH). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX357647_HBe_P-A Product feature CHAIN KX357647_HBe_P-A of FT:mat_peptide KX357647_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BL13ETH). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX357649_HBe_P-A Product feature CHAIN KX357649_HBe_P-A of FT:mat_peptide KX357649_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate AA86ETH). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPRDFYPSVRDLIDTASALFREALESPEHCSPHHTALRQAVLCWGELMTLAX
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KX648547_HBe_P-A Product feature CHAIN KX648547_HBe_P-A of FT:mat_peptide KX648547_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi12_103). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATXELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX648548_HBe_P-A Product feature CHAIN KX648548_HBe_P-A of FT:mat_peptide KX648548_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_091). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX648549_HBe_P-A Product feature CHAIN KX648549_HBe_P-A of FT:mat_peptide KX648549_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate Zi14_172). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX686607_HBe_P-A Product feature CHAIN KX686607_HBe_P-A of FT:mat_peptide KX686607_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1522). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNNNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX827293_HBe_P-A Product feature CHAIN KX827293_HBe_P-A of FT:mat_peptide KX827293_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIGQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX827294_HBe_P-A Product feature CHAIN KX827294_HBe_P-A of FT:mat_peptide KX827294_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX827295_HBe_P-A Product feature CHAIN KX827295_HBe_P-A of FT:mat_peptide KX827295_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIPCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX827296_HBe_P-A Product feature CHAIN KX827296_HBe_P-A of FT:mat_peptide KX827296_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVGDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX827298_HBe_P-A Product feature CHAIN KX827298_HBe_P-A of FT:mat_peptide KX827298_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate geno9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVDYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY003230_HBe_P-A Product feature CHAIN KY003230_HBe_P-A of FT:mat_peptide KY003230_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY382410_HBe_P-A Product feature CHAIN KY382410_HBe_P-A of FT:mat_peptide KY382410_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate A2_wt). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY886219_HBe_P-A Product feature CHAIN KY886219_HBe_P-A of FT:mat_peptide KY886219_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|L13994_HBe_P-A Product feature CHAIN L13994_HBe_P-A of FT:mat_peptide L13994_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC051141_HBe_P-A Product feature CHAIN LC051141_HBe_P-A of FT:mat_peptide LC051141_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate HB14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC074724_HBe_P-A Product feature CHAIN LC074724_HBe_P-A of FT:mat_peptide LC074724_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p621). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC311241_HBe_P-A Product feature CHAIN LC311241_HBe_P-A of FT:mat_peptide LC311241_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p509). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC311242_HBe_P-A Product feature CHAIN LC311242_HBe_P-A of FT:mat_peptide LC311242_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p90). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPNHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC311243_HBe_P-A Product feature CHAIN LC311243_HBe_P-A of FT:mat_peptide LC311243_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate p121). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC430617_HBe_P-A Product feature CHAIN LC430617_HBe_P-A of FT:mat_peptide LC430617_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC458430_HBe_P-A Product feature CHAIN LC458430_HBe_P-A of FT:mat_peptide LC458430_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC458431_HBe_P-A Product feature CHAIN LC458431_HBe_P-A of FT:mat_peptide LC458431_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC462120_HBe_P-A Product feature CHAIN LC462120_HBe_P-A of FT:mat_peptide LC462120_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLBTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC517161_HBe_P-A Product feature CHAIN LC517161_HBe_P-A of FT:mat_peptide LC517161_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC592168_HBe_P-A Product feature CHAIN LC592168_HBe_P-A of FT:mat_peptide LC592168_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC592169_HBe_P-A Product feature CHAIN LC592169_HBe_P-A of FT:mat_peptide LC592169_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC592170_HBe_P-A Product feature CHAIN LC592170_HBe_P-A of FT:mat_peptide LC592170_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LK995385_HBe_P-A Product feature CHAIN LK995385_HBe_P-A of FT:mat_peptide LK995385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate NAT2037658). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LT992440_HBe_P-A Product feature CHAIN LT992440_HBe_P-A of FT:mat_peptide LT992440_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA119). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LT992441_HBe_P-A Product feature CHAIN LT992441_HBe_P-A of FT:mat_peptide LT992441_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate DA195). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LT992448_HBe_P-A Product feature CHAIN LT992448_HBe_P-A of FT:mat_peptide LT992448_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate RISE386). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|M57663_HBe_P-A Product feature CHAIN M57663_HBe_P-A of FT:mat_peptide M57663_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGKLMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|M74501_HBe_P-A Product feature CHAIN M74501_HBe_P-A of FT:mat_peptide M74501_HBe_P-A of [Viruses] Hepatitis B Virus genotype A. Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF536836_HBe_P-A Product feature CHAIN MF536836_HBe_P-A of FT:mat_peptide MF536836_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate T2029C). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=136 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLHTASALYREALESPEHCSSHHTALRQAILCWGELLYSLP
TWVGNNLQDPASRDLHVNYVNTNMGLKIRQLLWFHISCLTFGRLVVLEYLVSFGVW
>gnl|hbvpro|MF772344_HBe_P-A Product feature CHAIN MF772344_HBe_P-A of FT:mat_peptide MF772344_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV1662). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEYGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF772346_HBe_P-A Product feature CHAIN MF772346_HBe_P-A of FT:mat_peptide MF772346_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 855_16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATTELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF772348_HBe_P-A Product feature CHAIN MF772348_HBe_P-A of FT:mat_peptide MF772348_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV120). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MF772350_HBe_P-A Product feature CHAIN MF772350_HBe_P-A of FT:mat_peptide MF772350_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 64106). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF772351_HBe_P-A Product feature CHAIN MF772351_HBe_P-A of FT:mat_peptide MF772351_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate 1141). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF772353_HBe_P-A Product feature CHAIN MF772353_HBe_P-A of FT:mat_peptide MF772353_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate SV580). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WXGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF925361_HBe_P-A Product feature CHAIN MF925361_HBe_P-A of FT:mat_peptide MF925361_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF925362_HBe_P-A Product feature CHAIN MF925362_HBe_P-A of FT:mat_peptide MF925362_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPNVRDLLDTASALFREALESPEHCSPHHTALRQAILCWGDVMNLAT
WVGTNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEFLVSFGVW
>gnl|hbvpro|MF925368_HBe_P-A Product feature CHAIN MF925368_HBe_P-A of FT:mat_peptide MF925368_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|MF925372_HBe_P-A Product feature CHAIN MF925372_HBe_P-A of FT:mat_peptide MF925372_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLDDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF925373_HBe_P-A Product feature CHAIN MF925373_HBe_P-A of FT:mat_peptide MF925373_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF925385_HBe_P-A Product feature CHAIN MF925385_HBe_P-A of FT:mat_peptide MF925385_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF925400_HBe_P-A Product feature CHAIN MF925400_HBe_P-A of FT:mat_peptide MF925400_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MF925407_HBe_P-A Product feature CHAIN MF925407_HBe_P-A of FT:mat_peptide MF925407_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate BD). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MG877723_HBe_P-A Product feature CHAIN MG877723_HBe_P-A of FT:mat_peptide MG877723_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I_t1). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFXPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MG877724_HBe_P-A Product feature CHAIN MG877724_HBe_P-A of FT:mat_peptide MG877724_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I_t2). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFXPSVRDLLDTASALYREALESPEHCSSHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MG877725_HBe_P-A Product feature CHAIN MG877725_HBe_P-A of FT:mat_peptide MG877725_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate I_t3). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPXDFXPSVRDLLDTASALYREALESPEHCSXHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MH464808_HBe_P-A Product feature CHAIN MH464808_HBe_P-A of FT:mat_peptide MH464808_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA86). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKKFGAXVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTAXRQAILCWGEXMXLAX
WVGNNLZDPXSRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH464810_HBe_P-A Product feature CHAIN MH464810_HBe_P-A of FT:mat_peptide MH464810_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA88). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH464813_HBe_P-A Product feature CHAIN MH464813_HBe_P-A of FT:mat_peptide MH464813_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA91). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH464814_HBe_P-A Product feature CHAIN MH464814_HBe_P-A of FT:mat_peptide MH464814_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA92). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSXRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH464815_HBe_P-A Product feature CHAIN MH464815_HBe_P-A of FT:mat_peptide MH464815_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA93). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH464817_HBe_P-A Product feature CHAIN MH464817_HBe_P-A of FT:mat_peptide MH464817_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA95). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATXELLSFLPPDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGNNLDDPASRDLVVNYVNTNVGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH464818_HBe_P-A Product feature CHAIN MH464818_HBe_P-A of FT:mat_peptide MH464818_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA96). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH464825_HBe_P-A Product feature CHAIN MH464825_HBe_P-A of FT:mat_peptide MH464825_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA103). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPPVRDLLGTAAALYREALESSDHCSPHHTALRQALLCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH464828_HBe_P-A Product feature CHAIN MH464828_HBe_P-A of FT:mat_peptide MH464828_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA106). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH464830_HBe_P-A Product feature CHAIN MH464830_HBe_P-A of FT:mat_peptide MH464830_HBe_P-A of [Viruses] Hepatitis B Virus genotype A (isolate MA108). Complete genome. [He