HBVdb

Dataset for protein HBe of genotype all

[Download (right click)] [Edit] [Sequences] [Repertoires]

10666 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KY762277_HBe_P-H          -KLCLGWLWGMDIDPYQEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762278_HBe_P-H          -KLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762282_HBe_P-H          ---CLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
JX429911_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLSFFLPSDFFPSIRDLLDTASALYQ
KP148472_HBe_P-C          SKLCLGWFWGMDIDPYKEFGASVELLSLFLPSDFFPSIRDLLDTASALYR
KP148477_HBe_P-C          SKLCLGWFWGMDIDPYKEFGASVELLSLFLPSDFFPSIRDLLDTASALYR
MH464832_HBe_P-D          ---CLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700515_HBe_P-RF-CB      ---CLGWLWGMDIYPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC999452_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTAAALFR
MG826132_HBe_P-C          SPLCLGWVWGMDIDPYIEFGASVEILS-FLPSAIFPSILDLLDTASALYL
MN310712_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSARDLLDTASALYR
GQ227696_HBe_P-C          SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
GQ227693_HBe_P-C          SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
GQ259588_HBe_P-C          SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
GQ227694_HBe_P-C          SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
KY881884_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881960_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ904433_HBe_C-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY269108_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSIRELLDTASAQYR
FJ023624_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSFEDLLDTASALYR
FJ023573_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-LLPSDFFPSIRDLLDTASALYR
FJ023605_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023606_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023607_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023609_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023610_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023611_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023612_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023613_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023614_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023617_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023618_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023620_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023626_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023627_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023628_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023629_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023630_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ667207_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF775482_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF775483_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023566_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023567_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023568_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023587_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023589_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023590_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023591_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023625_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023664_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023667_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023670_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023673_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ882610_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ882614_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FR714490_HBe_P-RF-GB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC172106_HBe_P-RF-GB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148442_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVALLS-FLPSDFFPSIRDLLDTASALYR
MG826145_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH746811_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH746812_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH746813_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023608_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN683669_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPTVRDLIDTASALYR
LT623847_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVQLLS-FLPPDFFPSVRDLLDTASALYR
EU726855_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AY603433_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ801523_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSLLDPLYTASALYR
KX012624_HBe_P-B          SKLCLGWLWDMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406273_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GU815747_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
GU815748_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
FJ562287_HBe_P-RF-CB      FKVCLGGLWGMGLDPYKEFGAFGELLF-FLPFDFFPSIRDLLDTASALYR
FJ386644_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPFEFFLSIRDLLDTASALYR
FJ386640_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPTDFFPSVRDLLDTASALYR
FJ386616_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
GQ161814_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFHSVRDLLDTASALYR
KU668444_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KY881812_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924642_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPNDFFPSMRDLLDTASALYR
KU576691_HBe_P-B          SKLCLEWLWDMDIDPYKEFGASAELLS-FLPSDFFPNVRDLLDTASALYR
KU576856_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576623_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYG
KU576240_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576619_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576620_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576629_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576630_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576633_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576640_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576641_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576645_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576647_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLNTASALYR
KU576656_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576681_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576692_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-LLPTDFFPSIRDLLDTASALYR
KU576693_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576698_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576703_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576704_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576714_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576738_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576748_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576751_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576766_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576843_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576845_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576848_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576854_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576874_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
FJ032346_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
GU815701_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB334299_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB334300_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB334301_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB334302_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB334303_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB355454_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB493833_HBe_P-B          SNLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF480337_HBe_P-B          SKLCLGWPWGMDIDPYKEFGASGELLS-FLPSDFFPSVRDLLDTASALYR
AF480344_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSVRDLLDTASALYR
AF480356_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASGELLS-FLPSDFFPSVRDLLDTASALYR
FJ386660_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB014360_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB697494_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MH725045_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724227_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925403_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
MF488701_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPKDFFPSVRDLLDTASALYR
KY881971_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYR
DQ089761_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AY382489_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB074755_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576754_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
KU576626_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDPLDTASALYR
KP406260_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406262_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406266_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406280_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406257_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AF480341_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDFIDTASALYR
AB355453_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AF480342_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
D00330_HBe_P-B            SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ882611_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MK598679_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVQLLS-FLPSDFFPSVRDLLDTASALFR
MH725097_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPGDFFPSVRDLLDTASALFR
KJ410511_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
EU919165_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
DQ089777_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037633_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MF568491_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPNIRDLLDTASALYR
AF480355_HBe_P-B          SKLCLGWLRGMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
MT426263_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038386_HBe_P-C          SKQCLGWLWGMDIDPYKEFGASVELLS-LLPSDFFPSIRDLLDTASALYR
KR013942_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803757_HBe_P-C          SRLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ904423_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYR
AB367413_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRELIDTASALYR
MK038060_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDSFPSIRDLLDTASALYR
MG571361_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYQ
KU668216_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
KF166875_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPTIRDLLDTASALYR
EU487256_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU330997_HBe_P-B          SKLCLGWLRGMDIDPYKGFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993707_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB493827_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRXLLNPVLVLYR
HQ700485_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAXALYR
HQ700574_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700573_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700572_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700570_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700568_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700567_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700566_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700565_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700564_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700563_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700562_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700561_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700559_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700558_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700556_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700555_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700544_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700504_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700502_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700496_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700495_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
X75656_HBe_P-RF-CB        SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700560_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700557_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700509_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700476_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
HQ700577_HBe_P-C          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
MN683627_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023659_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB109476_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT426750_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939599_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
EU717214_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASRELLS-FLPSDFFPSIRDLLDTASALYR
EF494379_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYR
DQ089787_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
AB697510_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYR
MK040808_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVESLS-FLPSDLFPSIRDLLDTASALYR
MK038448_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038204_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRNLLDTASALYR
KF165332_HBe_P-B          SKLCLEWLWGMDIDPYKEFGASAELLS-FLPSDFFPTIRDLLDTASALYR
KF165326_HBe_P-B          SKLCLEWLWGMDIDPYKEFGASAELLS-FLPSDFFPTIRDLLDTASALYR
GU815754_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815751_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYR
GU815700_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815640_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYR
GU815639_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GU815635_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU815619_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386676_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ032353_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144550_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFSPSIRDLLDTASALYR
AB073831_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
M38454_HBe_P-RF-CB        SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750144_HBe_P-RF-DC      SKQCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715387_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FN594758_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLDTASALYR
MH725012_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT426827_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426373_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426347_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038389_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG893558_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY882001_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881994_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881979_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881961_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881887_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881885_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881874_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881871_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALSR
KY689518_HBe_P-C          SKLCLGWLWDMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX276840_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964045_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013871_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013793_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148525_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDYFPSIRDLLDTASALYR
KP148475_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF485390_HBe_P-C          SKLCLGWLWGMDIDPYKESGASVEILS-FLPSDFFPXIRDLLDTASALYR
KC875269_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774306_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
KC774182_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX870000_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848014_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801489_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827416_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYR
JN104435_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF828937_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYR
HQ700456_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377628_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYR
GQ377545_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787455_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSTRDLLDTASALYR
FJ715367_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FVPSDFFPSIRDLLDTASALYR
FJ386651_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
FJ386589_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
FJ023652_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
EU939647_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU796069_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
EU554541_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU554539_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF494377_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF137802_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ922651_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ478900_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYR
DQ089801_HBe_P-C          SKRCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089790_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089784_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089782_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FWPSDFFPSIRDLLDTASALYR
D50518_HBe_P-C            SKLCLGWLWGMDIDPYKEFGASVELLS-FMPSDFFPSIRDLLDTASALYR
D50517_HBe_P-C            SKLCLGWLWGMDIDPYKEFGASVELLS-FMPSDFFPSIRDLLDTASALYR
AY862869_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY206389_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYR
AY206386_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF241410_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB900115_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASAELLS-FLPSDFFPNIRDLLDTASALYR
AB670309_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670261_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB367408_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
AB300361_HBe_P-C          SKLCLGWLWGMDIDPYKEFGGSVEPLS-FLPSDFFPSIRDLLDTASALYR
AB195945_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB112065_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
AB111125_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
AB014395_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB014364_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALHR
MT427108_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELIA-FLPSDFFPSIRDLLDTASALYR
MT427097_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FFPSDFSLSIRDLLDTASALYR
MT427037_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426999_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426994_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040865_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYR
MK040809_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038461_HBe_P-B          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038449_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038435_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038291_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038284_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYR
MK038183_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038090_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
MK038046_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037960_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FSPSDFFPSIRDLLDTASALYR
MK037942_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037789_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037673_HBe_P-B          SKLCLGWLWGTDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037644_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037641_HBe_P-B          SKRCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037639_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037525_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571374_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470961_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASTLYR
KY470960_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASTLYR
KU668328_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668289_HBe_P-B          SKLCLGWLWGMDIDPYKEFGTSVELLS-FLPSDFFPNIRDLLDTASALYR
KU667955_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667859_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU576189_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576041_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU575977_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148433_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148410_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148407_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148392_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVESLS-FLPSDFFPPIRDLLDTASALYR
KP148382_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYR
KP148366_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP148364_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRALLDTASALYR
KJ803796_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ803795_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ803781_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF166807_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF164936_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPLDFFPSVRELLDTASALYR
KF164901_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPFDFFPSIRDLLDTASALYR
JX848240_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848154_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847950_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429897_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAPALYR
JQ341490_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475340_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JQ040132_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYX
KY881981_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYR
Y18856_HBe_P-RF-CB        SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MT426533_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU577083_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYR
KJ803798_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JX661486_HBe_P-RF-CB      RELCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661485_HBe_P-RF-CB      LQLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN664920_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT426792_HBe_P-C          STLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426279_HBe_P-C          STLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426252_HBe_P-C          SQLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG893556_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925395_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
LC279253_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
LC279252_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
KY881993_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYR
KY881972_HBe_P-C          SELCLGWLWGMDIEPYKEFGASVKLLS-FLPSDFFPSVRDLLDTASALYR
KY881889_HBe_P-C          SKPCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
KY881886_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
KY881881_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KX276851_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPTIRDLLDTASALYR
KX276846_HBe_P-C          SKLCLGWLWNMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALFR
KU964180_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
KU964002_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
KU963997_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
KU963996_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
KU963992_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
KP148532_HBe_P-C          SRLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148473_HBe_P-C          SKLCFGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803823_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KF214651_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774353_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JQ027324_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700571_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924620_HBe_C-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ787439_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715350_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715343_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386672_HBe_P-C          SKLCLGWLWGMDIDPYKEFGSSVELLS-FLPSDFFPSIRDLLDTASALYR
FJ151413_HBe_P-C          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDLFPSIRDLLDTASALYR
AB112408_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASEELLS-FLPSDYFPSIRDLLDTASALYR
AB111118_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
MK038298_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038209_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038199_HBe_P-B          SKLCLGWLWGMDIGPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038187_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038184_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038182_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038180_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038172_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MK038109_HBe_P-B          SRLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037794_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674507_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MF674462_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MF674423_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MF674419_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
MF674396_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYR
KX276805_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTXSALYR
KU668336_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU667936_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667540_HBe_P-B          SELCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667493_HBe_P-B          SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU576624_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYR
KP406294_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP148345_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDIFPSIRDLLDTASALYR
KP148335_HBe_P-B          SKLCPGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ843165_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIQDLLDTASALYR
KJ173386_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KF166709_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF165321_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KC774362_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
JX848048_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848041_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847933_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYR
JX661480_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
JX661479_HBe_P-B          SQLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661477_HBe_P-B          LQLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ429081_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYR
AB100695_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRELLDTASALYR
MK037554_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN683611_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052968_HBe_P-RF-BD      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470893_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGTSVELLS-FLPSDFFPSIRDLLDTASALYR
KM875422_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ803782_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC774490_HBe_P-RF-DC      PKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700542_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700532_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700531_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700530_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700528_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700527_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700519_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700518_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700499_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700498_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358156_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358155_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386643_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY057948_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVEVLS-FLPSDFFPSNRDLLDTASALDR
AP011103_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011102_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB493847_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB493842_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB493840_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB493838_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB493837_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB367800_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB105172_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
X75665_HBe_P-C            SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426808_HBe_P-C          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426807_HBe_P-C          SKLCLGGLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426803_HBe_P-C          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426779_HBe_P-C          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426772_HBe_P-C          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426746_HBe_P-C          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426740_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426691_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426639_HBe_P-C          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426631_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426579_HBe_P-C          SKLCLRWLLGMDIDPYKEFGASVELLS-FLPSDFFRSIRDLLDTASALYR
MT426449_HBe_P-C          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426426_HBe_P-C          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426418_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFSSIRDLLDTASALYR
MT426331_HBe_P-C          FKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426289_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFTSIRDLLDTASALYR
MT426288_HBe_P-C          SKLCLGWLWGMDIDPYKGFGASVELLS-FLPSDFFSPIRDLLDTASALYR
MG826129_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925394_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MF925376_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674428_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881978_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRGLLDTASALYR
KY881878_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881819_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881815_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFSSIRDLLDTASALYR
KY881814_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFSSIRDLLDTASALYR
KY881810_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881807_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881806_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALSR
KY363257_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY363256_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-SLPSDFFPSIRDLLDTASALYR
KX774503_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765851_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964223_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
KR013993_HBe_P-C          SKLCLGWFWGMDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYR
KR013974_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYR
KR013935_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013908_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYR
KR013840_HBe_P-C          SKLCLGWLWGMDIDPYKGFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KR013819_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013792_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013781_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVESLS-FLPSDFFPSIRDLLDTASALYR
KR013770_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148520_HBe_P-C          SKLCLGWLWGMDIDPYKEFGVSVELLS-FLPSDFFPSIRDLLDTASALYR
KP148462_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM875430_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598772_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF166970_HBe_P-C          YKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429912_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801502_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801500_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JQ801473_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ027323_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
JQ027322_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ027319_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700522_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700516_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700506_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855543_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
GQ475320_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
GQ358157_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ751765_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFSSIRDLLDTASALYR
FJ562324_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVQDLLDTASALYR
FJ386650_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ386628_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
EU939597_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU872005_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASRELLS-FLPSDFFPPVRDLLDTASALYR
EU439005_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306727_HBe_P-C          SKLCLGWPWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ377163_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ377160_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFLSIRDLLDTASALYR
DQ089788_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASLELLS-FLPSDFFPSIRDLLETASALYR
AF533983_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF223961_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB670278_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYR
AB367435_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB176643_HBe_P-C          SKLCLGWLWXMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB117758_HBe_P-C          SKLCLGWLCGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AB112348_HBe_P-C          SKLCLGGLWGMDIDPYKVFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB111117_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
AB111116_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
AB074047_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MT427043_HBe_P-B          SKLCLGCLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426980_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426878_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040838_HBe_P-B          SKLCLGRLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK040815_HBe_P-B          SKLCLGRLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK038454_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038452_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038431_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038357_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MK038321_HBe_P-B          SKLCLGRLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038319_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038293_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038063_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038058_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037971_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037869_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037675_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037672_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037622_HBe_P-B          PKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037528_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037512_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674506_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MF674414_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FXPSDFFPSIRDLLDTASALYR
MF674392_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KY470954_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYR
KU964107_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964105_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964104_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964102_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964101_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964100_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964098_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964096_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU668318_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPNIRDLLDTDSALYR
KU667980_HBe_P-B          YKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667956_HBe_P-B          SKLCLGRLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU667448_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPNIRDLLDTASALYR
KU577004_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFLSIRDLLDTASALYR
KU576309_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYR
KP148413_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166967_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KF166311_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KF165415_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KC774375_HBe_P-B          PKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774369_HBe_P-B          PKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX869998_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848211_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
JX661476_HBe_P-B          RKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689557_HBe_P-B          SKLCLGWLWGMDIDPYKXFGASVELLS-FLPSDFFPSIRDLLDTASALXR
AB670254_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX276821_HBe_P-B          SKLCLGWLWXMDIDPYKEFGASVELLS-FLPSDFXPSIRDLLDTASALXR
AB670252_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089792_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY689471_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MF925389_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KX660677_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KU679942_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU679941_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU519423_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU519422_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT991421_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT003704_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013816_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP276256_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP276255_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP276254_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP276253_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148352_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148337_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803804_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803802_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803785_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALCR
KJ803772_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410520_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173358_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGAFVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173350_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173349_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173330_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173329_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173326_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173325_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173322_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173320_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173300_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173299_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173279_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF917451_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF873543_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF873542_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF873538_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF873534_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF873532_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF873531_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF873527_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF873524_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774499_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774497_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774495_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774494_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774492_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774489_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774487_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774484_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774482_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774480_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774471_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774470_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774463_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774461_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774458_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774457_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774456_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774455_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774454_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774452_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774448_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774447_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC774426_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774424_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774423_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774414_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774349_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774344_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774341_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774332_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774328_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774324_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774322_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774317_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774294_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774258_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774234_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774212_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774201_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774198_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774186_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774183_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC315400_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661498_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661494_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661487_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429898_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801477_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801476_HBe_P-RF-CG      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ732168_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040175_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040174_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040146_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN400086_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
JN104442_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104438_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF491456_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF491455_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF491451_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF491449_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF491448_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF436919_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
HQ700547_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700526_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
HQ700521_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700508_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700507_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700505_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750150_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750149_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750147_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750146_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750145_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750143_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750133_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924618_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377635_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377634_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377633_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377630_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377626_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377614_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377613_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377611_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377602_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377596_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377595_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377594_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377590_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
GQ377581_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377573_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377565_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377564_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377560_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377549_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377548_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377544_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377539_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377534_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377520_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377516_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787480_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787446_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715414_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715413_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715412_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715411_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715385_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715384_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562314_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386649_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ349241_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
EU916241_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916239_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916232_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU881995_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU835240_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU787434_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ478897_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ478892_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ478890_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ478889_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ478887_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144601_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY862866_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY862865_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY817515_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY817512_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY817511_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY817510_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY800249_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY247030_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY167095_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY123424_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY123041_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY040627_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011108_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011105_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011104_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB674504_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB241109_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195957_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195956_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195955_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195951_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195950_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195941_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195940_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195939_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB033557_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB031265_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN664919_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
X04615_HBe_P-C            SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
V00867_HBe_P-C            SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426858_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426857_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426856_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426855_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426854_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426853_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426852_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426851_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426850_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426849_HBe_P-C          SKLCLGWLWGMNIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426848_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426847_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426846_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426845_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426843_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426842_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426841_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426840_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426839_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELIS-FLPSDFFPSIRDLLDTASALYR
MT426838_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426836_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426835_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426834_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426833_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426832_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426831_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426830_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426829_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426828_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426826_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426825_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426824_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426823_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426822_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426821_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426820_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426819_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426818_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426817_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426816_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426815_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426814_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426812_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426811_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426810_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426809_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426806_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426805_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426804_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426802_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLHSDFFPSIRDLLDTASALYR
MT426801_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426800_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426799_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426798_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426797_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426796_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426795_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426794_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426793_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426791_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426790_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426789_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426787_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426786_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426785_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426784_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426783_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426782_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426781_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426778_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426777_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426776_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426775_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426774_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426773_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426770_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426769_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426768_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426767_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426766_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426765_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426764_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426763_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426762_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426761_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426760_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426759_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426758_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426757_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426756_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426755_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426754_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426753_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426752_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426749_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426748_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426747_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426745_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426744_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426743_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426742_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426741_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426739_HBe_P-C          SKLCLGWLWGMDIDPYKEFGAAVELLS-FLPSDFFPSIRDLLDTASALYR
MT426738_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426737_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426736_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426733_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426732_HBe_P-C          SKLCLGWLWGMDIDPYKEFAASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426731_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426730_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426728_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426727_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426726_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426725_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426724_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426723_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426722_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426721_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426720_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426719_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426718_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426716_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426715_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426714_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426713_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426712_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426711_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426710_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426709_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426708_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426707_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426706_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426705_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426704_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426703_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426702_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426701_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426699_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426698_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426697_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426696_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426695_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426694_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426693_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426692_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426690_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426689_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426688_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426687_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426686_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426684_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426683_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426682_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426681_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426680_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426679_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426678_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426676_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426675_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426674_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426673_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426672_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426671_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426670_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426669_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426668_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426666_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426665_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426664_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426663_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426662_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426661_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426660_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426659_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426658_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426657_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426656_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426655_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426654_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426653_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426652_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426651_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426650_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426649_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426648_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426647_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALNR
MT426646_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426645_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426644_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPLIRDLLDTASALYR
MT426643_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426642_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426641_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426640_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426638_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426637_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426636_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426635_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426634_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426633_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426632_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426630_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426629_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426628_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426627_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426626_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426625_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426624_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426623_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426622_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426621_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426620_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426619_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426618_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426617_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426616_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426615_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426613_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426612_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426611_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426610_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426609_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426608_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426607_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426606_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426605_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426604_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426603_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426602_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426601_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426600_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426599_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426598_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426597_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426596_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426595_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426594_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426593_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426592_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426591_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426590_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426588_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426587_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426586_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426585_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426584_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426583_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426582_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426581_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426580_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426578_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426548_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426516_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426454_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426453_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426452_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426451_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426450_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426448_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426445_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426444_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426443_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426442_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426441_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426440_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSICDLLDTASALYR
MT426439_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426438_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426437_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426435_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426434_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426433_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426432_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426431_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426430_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426429_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426427_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426425_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426424_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426423_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426422_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426421_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426420_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426419_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426417_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426416_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426415_HBe_P-C          SKLCLGWLWGMDIEPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426413_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426412_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426411_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426409_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426408_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426407_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426406_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426404_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426403_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426402_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426401_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426400_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426399_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426398_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426397_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426396_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426395_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426394_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426393_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426392_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426391_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426390_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426389_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426388_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426387_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426386_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426385_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426383_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426382_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426381_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426380_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426379_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426378_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426377_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426376_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426375_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426372_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426370_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426369_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSYFFPSIRDLLDTASALYR
MT426368_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426367_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426366_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426365_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426364_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426363_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426362_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426361_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426360_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426359_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426358_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426356_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426354_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426349_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426348_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426345_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426344_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426343_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426342_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426341_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426340_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426339_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426338_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426337_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426336_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426335_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426334_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426333_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426332_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426330_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426329_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426328_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426327_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426326_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426325_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426324_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426323_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426322_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426321_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426320_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426319_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426318_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426317_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426316_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426314_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426313_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426312_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426311_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426310_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426308_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426306_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426305_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426304_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426303_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426302_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426301_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426300_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426299_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426298_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426296_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426295_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426294_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426292_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426291_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426290_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426286_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426285_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426284_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426283_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426281_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426280_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426278_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426276_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426275_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426274_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426273_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426271_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426270_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426269_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426268_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426267_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426266_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426265_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426262_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426261_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426260_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426259_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426258_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426257_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426256_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426255_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426254_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426253_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426251_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426250_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426249_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426248_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT114171_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYR
MT111596_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN683729_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN683728_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN683727_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN683726_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK628732_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038395_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038394_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038393_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038392_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038391_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038387_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038382_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038381_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038380_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038376_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038373_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038372_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLNTASALYR
MH887433_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH220971_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
MH094411_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG893560_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG893557_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG826135_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG826134_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG826133_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG826131_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG826128_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG826127_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG826123_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDFLDTASALYR
MG725248_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571345_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925410_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925409_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925408_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925406_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925378_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925377_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925375_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925365_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF925359_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674502_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674501_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674494_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674486_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674484_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674472_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674468_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674467_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674458_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVHDLLDTASALYR
MF674454_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674444_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674442_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674435_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674429_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674425_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVHDLLDTASALYR
MF674418_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674412_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674408_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674403_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MF674402_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674399_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674398_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674388_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674386_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC592172_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC592171_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC373512_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC373511_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC318703_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC318702_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279276_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279275_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279274_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279262_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279260_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279259_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279258_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279257_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279256_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279255_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279254_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279251_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279250_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279249_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279248_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279247_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279246_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC279245_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC090200_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY882003_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY882002_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881997_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881991_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881989_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881988_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881987_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881984_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881980_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881974_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881973_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881892_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881891_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881890_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881888_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881883_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881882_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881880_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881879_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881877_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881876_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881875_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881873_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881872_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALNR
KY881870_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KY881818_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881803_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881802_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALCR
KY881777_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881776_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881775_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881774_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881773_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881772_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881771_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881770_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881769_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881768_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881767_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881766_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881765_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881764_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881763_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881762_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881758_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881755_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881754_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881751_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881750_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881749_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881748_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881744_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881743_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881742_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881739_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881738_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881737_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881736_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689525_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689435_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY670782_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY629631_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470988_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470987_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470986_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470985_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470984_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470982_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470981_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470980_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470936_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470933_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470929_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470911_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470908_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470905_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470904_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470903_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470902_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470901_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470899_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470897_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470895_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470894_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470892_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470891_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470890_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470889_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470888_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470887_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470886_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470885_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470884_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470883_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470882_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470881_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470879_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470878_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470876_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY363279_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY363278_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY363276_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY363274_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY022423_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX774506_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX774504_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765855_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765853_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765852_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765850_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765849_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765848_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765847_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765846_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765845_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765844_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765843_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765840_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765839_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765838_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765837_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765836_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765834_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765833_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765832_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765831_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765830_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765827_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765826_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765825_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765824_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765823_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765821_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765820_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765819_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765818_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964348_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964347_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964346_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964345_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964344_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964342_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964341_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964340_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964339_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964338_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964337_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964336_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964334_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964237_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964228_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964227_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964225_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964224_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964221_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964220_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964218_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964217_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964216_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964199_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964198_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964197_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964196_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964195_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964194_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964193_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964192_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964188_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964187_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964176_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964078_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964077_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964075_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964074_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964073_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964072_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964071_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964070_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964069_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964068_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964067_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964066_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964065_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964064_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964063_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964062_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964061_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964060_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964059_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964058_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964057_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964056_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964055_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964054_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964053_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964052_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964051_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964050_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964048_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964047_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964046_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964044_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964043_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964042_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964041_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964040_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964039_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964038_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964037_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964036_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964035_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964034_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964033_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964032_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964031_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964030_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964029_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964028_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964027_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964026_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964025_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964024_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964023_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
KU964022_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964021_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964020_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963914_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963913_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963912_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963911_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963910_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963909_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963908_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963907_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963906_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963905_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963904_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963903_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963902_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963901_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963900_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963899_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963897_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963896_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963895_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963894_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963893_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963892_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963891_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTTSALYR
KU963890_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963889_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963888_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963887_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963886_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU051427_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU051426_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU051425_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU051424_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU051423_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT987426_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT987425_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT987424_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT987423_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT366463_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT364752_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT364751_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT364721_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT364720_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT364719_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT364718_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT307718_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT284758_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT284756_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT284755_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT284754_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KT284753_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013996_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013984_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013961_HBe_P-C          SKLCLGWLWGMDIDPYKKFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013909_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013904_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFLPSIRDLLDTASALYR
KR013877_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013875_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013873_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013858_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013857_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLGTASALYR
KR013854_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013853_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013852_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013837_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDILDTASALYR
KR013834_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013831_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013830_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013829_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013828_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013825_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013823_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013822_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013815_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013814_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KR013813_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013812_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013811_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013810_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013809_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013808_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013803_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013799_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013798_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013797_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013796_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013794_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013791_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013790_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013788_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KR013787_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013786_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013785_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013783_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013782_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013780_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013779_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013776_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013774_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013773_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013772_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR013771_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFLPSIRDLLDTASALYR
KR013762_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP784761_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243288_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243268_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243231_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148574_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148573_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148572_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLGTASALYR
KP148571_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148570_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148568_HBe_P-C          SKLCLGWLWGMDIDPYKAFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148566_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148564_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148562_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148561_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148560_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148559_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148557_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148555_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148554_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148551_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148549_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148548_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148547_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148546_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148545_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148540_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148538_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148535_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148531_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148529_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148528_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148526_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148524_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148523_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148521_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148517_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148513_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148512_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148493_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148492_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148489_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148488_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148487_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148482_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148481_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148476_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148474_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148471_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148469_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148468_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148466_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148465_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148464_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148463_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148315_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP027477_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM359441_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KM229703_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM213037_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803818_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803815_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803814_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803813_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803811_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803799_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803793_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803792_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803790_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ803766_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803761_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803759_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ790199_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598753_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598749_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598740_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598725_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598716_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598710_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598701_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598699_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598698_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598697_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ598696_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598695_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598694_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598691_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598690_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598689_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598688_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598681_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598660_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598659_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598657_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598656_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598655_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598654_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598652_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598648_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598647_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598645_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598642_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598641_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598640_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598639_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598636_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ598635_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410519_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410513_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410501_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410498_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410496_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410495_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173446_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173444_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173443_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173442_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173441_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173440_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173439_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173438_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173437_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173436_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173435_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173434_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173433_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173431_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173430_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173429_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173428_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173427_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173426_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173396_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173395_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173394_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173393_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173392_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173391_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173336_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173335_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173333_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173332_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173331_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173328_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173327_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173324_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173321_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173317_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173315_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173314_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173313_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173312_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173311_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173310_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173309_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173308_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173307_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173306_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173305_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173304_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173303_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173302_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173301_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173296_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173294_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173293_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173292_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173291_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173289_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173288_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173287_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173286_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173285_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ173284_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173283_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173282_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173281_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF873526_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF779300_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF779242_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF495606_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF485389_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF214673_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF214672_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KF214671_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165470_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRELLDTASALYR
KF165343_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRELLDTASALYR
KC885556_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885415_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC875272_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC875270_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC875268_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC875267_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC875263_HBe_P-C          SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
KC875262_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC875261_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774360_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774359_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774357_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC774356_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774352_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774351_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774348_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774347_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774345_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774343_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774342_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774339_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774337_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774336_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774335_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774334_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774333_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774330_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774329_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774327_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774326_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774325_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774320_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774318_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774316_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774315_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774314_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774312_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774310_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774309_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774308_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774304_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774303_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774300_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774299_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774298_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774296_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
KC774295_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774293_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774292_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774290_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774289_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774287_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774286_HBe_P-C          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
KC774285_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774283_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774281_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774280_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774278_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC774277_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774276_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774274_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774272_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774271_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774270_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774268_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774267_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774261_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774260_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774255_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774254_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774252_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774251_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774250_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774244_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774242_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774241_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774239_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774238_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774237_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774236_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774235_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774233_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774216_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774215_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774214_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774213_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774206_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774196_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774187_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774185_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774184_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774181_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774180_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848100_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JX848026_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847989_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JX661496_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661495_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661493_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JX661492_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661491_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661490_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661489_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661488_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX560520_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX504546_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX504545_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX504544_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX504537_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429917_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429916_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429915_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429913_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429909_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429907_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429906_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429904_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX036339_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX036338_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX036337_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX036336_HBe_P-C          SKLRLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX036335_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX026885_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801522_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801520_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801519_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801513_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801511_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801505_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801504_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801501_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
JQ801497_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801496_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801495_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYR
JQ801490_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801488_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801486_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801482_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801475_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801470_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ688404_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ688403_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341517_HBe_P-C          SKLCLGWLWGMDIDPYKEFXASVELLS-FLPSDFFPNVRDLLDTASALYR
JQ040165_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLXSDFFPSIRDLLDTASALYR
JQ040163_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040162_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040154_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040145_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040133_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ038401_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ038400_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ038399_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ038398_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ038397_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ038381_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ038380_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ038379_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ038378_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ038377_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ027320_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827425_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827424_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827423_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827422_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827421_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827420_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827418_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827417_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827415_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN827414_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN400089_HBe_P-C          SKLCLVWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
JN400088_HBe_P-C          SKLCLVWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDRLDTASALYR
JN400087_HBe_P-C          SKLCLVWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
JN315779_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104454_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JN104440_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104433_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF899336_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF828920_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF828919_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF828918_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF828917_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF828916_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF828915_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JF828913_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HQ700517_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750140_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750139_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750138_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750137_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750136_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750132_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM750131_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM214755_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM214754_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM011497_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM011489_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM011486_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
HM011465_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU721029_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU563561_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GU434374_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924649_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924636_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924633_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924629_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924614_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924613_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924612_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
GQ924609_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ924604_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ872210_HBe_P-C          SKLCLGWLWGMDIDPYKKFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855548_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855544_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855541_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855534_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855533_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855525_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ855523_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475354_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GQ475347_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475346_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475345_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475342_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GQ475339_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475338_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GQ475334_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475333_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475332_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475331_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475330_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475329_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475328_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475327_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475326_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GQ475325_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475322_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475321_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475319_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475317_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475316_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475315_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475314_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475313_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475312_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475311_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475310_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475308_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475307_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475306_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ475305_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377642_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377640_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377637_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377636_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377631_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377624_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377619_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377618_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377617_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377616_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377615_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377605_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377601_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377600_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377598_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377591_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377585_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377584_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377583_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377580_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377579_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377578_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377577_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377576_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377574_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377572_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377571_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377570_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377563_HBe_P-C          SKLCLEWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377562_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377559_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377554_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377553_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377551_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377541_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377540_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377538_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377536_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377535_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377533_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377531_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377529_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377528_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377527_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377524_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377523_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377521_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377517_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377515_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ377514_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358158_HBe_C-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
GQ358154_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ899775_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ899763_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787481_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ787479_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787461_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787454_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787453_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787449_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787447_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ787441_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ751770_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ751764_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715421_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715418_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLQSDFFPSIRDLLDTASALYR
FJ715409_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715407_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715406_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELPS-FLPSDFFPSIRDLLDTASALYR
FJ715405_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715404_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELPS-FLPSDFFPSIRDLLDTASALYR
FJ715403_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715402_HBe_P-C          SKLCLGWPWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715400_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715398_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715397_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715395_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715391_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLQSDFFPSIRDLLDTASALYR
FJ715390_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLQSDFFPSIRDLLDTASALYR
FJ715389_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPFIRDLLDTASALYR
FJ715383_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715382_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715381_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715380_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715379_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715378_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715377_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715376_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTTSALYR
FJ715375_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715374_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715371_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715370_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715368_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLQSDFFPSIRDLLDTASALYR
FJ715366_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715365_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715364_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715359_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
FJ715358_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715357_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSGFFPSIRDLLDTASALYR
FJ715355_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715353_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715352_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715351_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLQSDFFPSIRDLLDTASALYR
FJ715344_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715342_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ715341_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562332_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
FJ562327_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562323_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562320_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562319_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
FJ562304_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562297_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562295_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562290_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562285_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562283_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562282_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562281_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562274_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562269_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562268_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562258_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562245_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562244_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ562243_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ562218_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ518813_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386678_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386667_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386664_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386653_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386652_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386647_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ386639_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386638_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDXLDTASALHR
FJ386637_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386627_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386626_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386620_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
FJ386619_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386618_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386607_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386603_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ386601_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386598_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALXR
FJ386595_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
FJ386591_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386588_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386587_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386577_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386576_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ386575_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ349225_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032361_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032356_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLGTASALYR
FJ032355_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032351_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032350_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032345_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032341_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032340_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032339_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032334_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032332_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ032331_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023658_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023657_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023656_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023655_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023654_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023653_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023650_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023649_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023648_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
FJ023647_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023646_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023644_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023643_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023642_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023641_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023640_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ023571_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939658_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
EU939652_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939641_HBe_P-C          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALHR
EU939619_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939604_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939600_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939582_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939578_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939573_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRELLDTASALYR
EU939571_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
EU939554_HBe_P-C          SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939552_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU939549_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU919168_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
EU916238_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916237_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916229_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916225_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916224_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916223_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916217_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916215_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916212_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU916210_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVVLLS-FLPSDFFPSIRDLLDTASALYR
EU881996_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU872010_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU871982_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU717212_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
EU670263_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU589345_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU589342_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
EU589341_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
EU579442_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU570074_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU570073_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU570068_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU570067_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU562218_HBe_P-C          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
EU562217_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU562215_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU560440_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU554542_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU554538_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU554537_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU554535_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU439015_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
EU410081_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU410080_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306729_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306725_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306722_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306721_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306720_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306719_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306714_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306713_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306694_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306691_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306690_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306689_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306688_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306687_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306685_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU306673_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU305542_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU305541_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EU305540_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF688062_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
EF384205_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPTIRDLLDTASALYR
DQ993693_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ993692_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
DQ993691_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
DQ993690_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ980550_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ975273_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ922650_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ922649_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ683578_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
DQ536414_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ536410_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ377161_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ315783_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ315781_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ246215_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144604_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144603_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ144553_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089793_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089789_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089783_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089781_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089780_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089779_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089778_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
DQ089770_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089769_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089765_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089764_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089763_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089762_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
DQ089760_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089758_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
D50519_HBe_P-C            SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
D28880_HBe_P-C            SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
D23680_HBe_P-C            SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
D12980_HBe_P-C            SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY641561_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY641560_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY641558_HBe_P-C          SKLCLVWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDRLDTASALYR
AY596108_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY596107_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY269099_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AY247032_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY247031_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY206384_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AY206382_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AY167099_HBe_P-C          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
AY057947_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011107_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011106_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011101_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011100_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011099_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011098_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AP011097_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AJ748098_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF473543_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF461363_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF461357_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF458664_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF384367_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF384366_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF384365_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF384364_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF363961_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF286594_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF241411_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF223960_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF223959_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF223958_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF223957_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF223956_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF223955_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF223954_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AF068756_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB697500_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB697490_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB675677_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB675675_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB675674_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670311_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670307_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670306_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670305_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670300_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AB670297_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
AB670294_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670292_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670291_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AB670287_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670283_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670282_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670267_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670265_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670253_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670247_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670243_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670240_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670239_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB670238_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB642100_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB642099_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB640730_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB485808_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB471853_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB471852_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB471851_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB471850_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB471849_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB471848_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB426467_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB367434_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB367418_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB367417_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB367411_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB367410_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB367409_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB367403_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB367402_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AB367401_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AB367399_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB367397_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB367396_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB367394_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB362932_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB300365_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB300363_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB300362_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB300359_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB299858_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB250109_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB247916_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB246346_HBe_P-C          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB246345_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB246344_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
AB241111_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB241110_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB222715_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB222714_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB205124_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB205123_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB202071_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB198083_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB198082_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB198081_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB198080_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB198079_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB198078_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB198077_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB198076_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195954_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195953_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB195952_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
AB195949_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB182589_HBe_P-C          SKLVLGWLGGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB113879_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB112472_HBe_P-C          SKLCLGWLWGMDIDPNKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB112471_HBe_P-C          SKLCLGWLWGMDIDPNKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB112066_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB111124_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
AB111120_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB111119_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB105173_HBe_P-C          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
AB050018_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB042283_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB033556_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB033553_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB033552_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB033551_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB033550_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB031262_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB026815_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB026814_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB026812_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB026811_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB014390_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB014377_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB014376_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
AB014374_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB014368_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AB014367_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB014362_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT448621_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427109_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-SLPSDFFPSIRDLLDTASALYR
MT427107_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427106_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427105_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427104_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-PLPSDFFPSIRDLLDTASALYR
MT427103_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427102_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427101_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427100_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-LLPSDFFPSIRDLLDTASALYR
MT427099_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427098_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-LLPSDFFPSIRDLLDTASALYR
MT427096_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427095_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427094_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427093_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427092_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427091_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427090_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427089_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427088_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427087_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427086_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427085_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427084_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427083_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427082_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427081_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427080_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427079_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-SLPSDFFPSIRDLLDTASALYR
MT427078_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427077_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427076_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427074_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427073_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427071_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427070_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427069_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427068_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427066_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427065_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427064_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427063_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427062_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427061_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427060_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427059_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427058_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427057_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427056_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427054_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427053_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427052_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427051_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427050_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427049_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427048_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427047_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427046_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427045_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427044_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427041_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427040_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427039_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427038_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427036_HBe_P-B          SKLCLGWLWGMDIDPHKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427035_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427034_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427033_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427032_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427031_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427030_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427029_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427028_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427027_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427026_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427025_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427024_HBe_P-B          SKLCLGWLCGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427023_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427022_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427021_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427020_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427019_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427018_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427017_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427016_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427015_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427014_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427013_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427012_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427011_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427010_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427009_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427008_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427007_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427006_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427005_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427004_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427002_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427001_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT427000_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426998_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426997_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426996_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426995_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426993_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426992_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426991_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426990_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426989_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426987_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426986_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426985_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426984_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
MT426983_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426982_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426981_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426979_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426978_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426977_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426975_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426974_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426973_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426972_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426971_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426969_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426968_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426967_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426966_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426965_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426963_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426962_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426961_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426960_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426958_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426957_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426956_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426955_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALNR
MT426954_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426953_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426951_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426950_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426949_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426948_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426947_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426946_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426945_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSNFFPSIRDLLDTASALYR
MT426944_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426943_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426942_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426941_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426940_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426938_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALCR
MT426937_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426936_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426935_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426934_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426933_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426932_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426931_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426930_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426928_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426927_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426926_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426925_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426924_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426923_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426922_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426921_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426920_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426919_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426918_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426917_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426916_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426915_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426914_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
MT426913_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426912_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426911_HBe_P-B          SKLCLGWLWGMDIDPYKEFGAAVELLS-FLPSDFFPSIRDLLDTASALYR
MT426910_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
MT426909_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426908_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426907_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426906_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426905_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426904_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426903_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426902_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426901_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426899_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426898_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426897_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426896_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426895_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426894_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426893_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426892_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426891_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426890_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426889_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426888_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426887_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426886_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426885_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426884_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426883_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426882_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426881_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426880_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426879_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426877_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426876_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426875_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426874_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426873_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426872_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426871_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426870_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426869_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426868_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426867_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426866_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426865_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426864_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426863_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426862_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426861_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426860_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT426859_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT111595_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN689123_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN689122_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN689121_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MN689120_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK075117_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052965_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052962_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040877_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040876_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040873_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040872_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040869_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040867_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040866_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040864_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040863_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040861_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLASDFFPSIRDLLDTASALYR
MK040860_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040857_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040856_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040855_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040854_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040852_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040849_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040848_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040847_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040846_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040845_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040844_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040790_HBe_P-B          SKLCLGWLEGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040778_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040777_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040776_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040770_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK040769_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038488_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038486_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038481_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038480_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038479_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038478_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038474_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038473_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK038470_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038468_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038465_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038463_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038460_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038458_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038457_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038456_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038453_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038451_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038450_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038447_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038446_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038445_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038440_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038439_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038437_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038433_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038432_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038429_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK038428_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK038360_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038359_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038355_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038354_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038350_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038348_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038334_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038332_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038330_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038328_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038327_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038325_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038322_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038320_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038317_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038315_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038312_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038311_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038309_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038302_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038301_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPPIRDLLDTASALYR
MK038300_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038296_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038295_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038294_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038292_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038286_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038280_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038279_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038278_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038277_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038272_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038269_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038267_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038266_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038265_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038264_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038256_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038255_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038250_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038248_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038247_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038246_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038245_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038244_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038242_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038241_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038240_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038239_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038238_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038237_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038234_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038233_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038232_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038231_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038230_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038229_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038227_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038226_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038225_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038224_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038223_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038222_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038221_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038220_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038219_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038218_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038217_HBe_P-B          SKLCLGWLWGMDIGPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038216_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038215_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038210_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038201_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038197_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038195_HBe_P-B          SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
MK038194_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038193_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038192_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038191_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038190_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038189_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038186_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038185_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038181_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038179_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038178_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038177_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038174_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038173_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038171_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038168_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038165_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038164_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038161_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038160_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038157_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038155_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038153_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038151_HBe_P-B          SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
MK038149_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038147_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038145_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038144_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038137_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038122_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038119_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038113_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038112_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038111_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPPIRDLLDTASALYR
MK038108_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038106_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038103_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK038102_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038099_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK038092_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038082_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038081_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038079_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038078_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038077_HBe_P-B          SKLCLGWLGGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038076_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038075_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038074_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038071_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038070_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038068_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038067_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038066_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038064_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038062_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038061_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038059_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038057_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038056_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038055_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038054_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038053_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038052_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038051_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038050_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038049_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038048_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038047_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038045_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038041_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038040_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038039_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038038_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038037_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDFLDTASALYR
MK038036_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038035_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038031_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038030_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038027_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038026_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK038012_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037997_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037991_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037972_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037963_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037957_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037952_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037951_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037950_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037948_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037945_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037940_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037936_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037930_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037925_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037914_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037909_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037902_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037880_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037877_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037867_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037835_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037834_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037831_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MK037830_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037828_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037827_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK037824_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MK037823_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037820_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037816_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037814_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037813_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037809_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037795_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037793_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037792_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037791_HBe_P-B          SKLCLGWLWSMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037790_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037787_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037786_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037785_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037784_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037782_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037703_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037650_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037649_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037648_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037647_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037643_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037640_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037638_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037637_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037627_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037626_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037624_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037621_HBe_P-B          SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
MK037618_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037617_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037615_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037614_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037612_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037611_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037596_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037591_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037569_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037563_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSVFFPSIRDLLDTASALYR
MK037558_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK037556_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037553_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037534_HBe_P-B          SKLRLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037533_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037532_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037531_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037530_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037529_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037527_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037526_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037521_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK037517_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH663473_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH061283_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG826153_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571371_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571369_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571368_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571366_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571365_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571364_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571362_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571356_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571355_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571349_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571348_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571347_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571346_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571344_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571342_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571341_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571340_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571328_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571323_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MG571322_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674515_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674513_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674512_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674510_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674509_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674500_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674497_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674495_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674493_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674490_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674488_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674485_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674483_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674482_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674481_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674480_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
MF674479_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674477_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674476_HBe_P-B          SKLCLGWLWAMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674460_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674456_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674455_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674453_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674452_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674451_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674449_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674443_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674438_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674437_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674432_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674431_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674427_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674426_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674424_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674421_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674416_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674413_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674410_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674409_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MF674405_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674404_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674400_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674397_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674395_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674394_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674393_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674387_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674384_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674383_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MF674382_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
M54923_HBe_P-B            SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC349878_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
LC349873_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881779_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881778_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881761_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881760_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881759_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881757_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881756_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881753_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881752_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881747_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881746_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881745_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881741_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881740_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881735_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881734_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881733_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881732_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881731_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881730_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881729_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881728_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881727_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881726_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881725_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881724_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881723_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881722_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY881721_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689563_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689553_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
KY689546_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689538_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689517_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689480_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689477_HBe_P-B          SKLCLGWLWXMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689472_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689443_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689426_HBe_P-B          SKLCLGWLWXMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689413_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY629636_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470962_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470956_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY470953_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX765856_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX276824_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX276774_HBe_P-B          SKLCLEWLWDMDIDPYKEFGASVELLS-FLPXDFFPSIRDLLDTASALYR
KU964165_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964164_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU964155_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
KU963989_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963988_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963987_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963986_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963985_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963984_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963983_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963982_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963981_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963980_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963979_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963978_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963977_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963976_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963975_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963974_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963973_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963972_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963971_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963970_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963969_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963968_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963967_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963966_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963965_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963964_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963963_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963962_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963961_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963960_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963959_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963958_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963957_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963956_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963955_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963954_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963953_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963952_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963951_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963950_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963949_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963948_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963947_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963946_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963945_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963855_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963854_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963853_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963852_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963851_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963850_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963849_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963848_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963847_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963846_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963845_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963844_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963843_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963842_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963841_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963840_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963839_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963838_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963837_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963836_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963835_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963834_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963833_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963832_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963831_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963830_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963829_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963828_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963827_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963826_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963825_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963824_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963823_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963822_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963821_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963820_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963819_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963818_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963817_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963816_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963815_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963814_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963813_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963812_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963811_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963810_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963809_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963808_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963807_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963806_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963805_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963804_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963803_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963802_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963801_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963800_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU963799_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668363_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668330_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668307_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668300_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668299_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668149_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668133_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668115_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668093_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSFRDLLDTASALYR
KU668076_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU668069_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668061_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668046_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668037_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU668009_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667996_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667879_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667840_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667784_HBe_P-B          SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
KU667700_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667612_HBe_P-B          SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
KU667569_HBe_P-B          SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667515_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU667508_HBe_P-B          SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667484_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELHS-FLPSDFFPSIRDLLDTASALYR
KU667469_HBe_P-B          SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667460_HBe_P-B          SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667457_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU667438_HBe_P-B          SKLCLGWLWGMDIDPYKEFEASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667422_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYR
KU667412_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELFS-FLPSDFFPNIRDLLDTASALYR
KU577089_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALCR
KU577081_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSGFFPSIRDLLDTASALYR
KU576940_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576873_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576872_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576871_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576870_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576869_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576868_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576867_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576866_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576806_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576804_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576794_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576793_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576788_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576785_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576784_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576783_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576782_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576781_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576780_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576778_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576777_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576328_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576327_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576326_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576325_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576324_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576321_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576320_HBe_P-B          SKLCLGWLWGMDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYR
KU576319_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576310_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576052_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSGFFPSIRDLLDTASALYR
KU576045_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576043_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576039_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576038_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576024_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU576022_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KU234318_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR232337_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KR152339_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP406292_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP406281_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243503_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243476_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243470_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243468_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243451_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243440_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243437_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243277_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP243205_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148583_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148580_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148461_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148457_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148456_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148455_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148453_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148451_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148440_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148439_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148438_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148435_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148430_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148429_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148427_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148425_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148424_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148423_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148421_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLGTASALYR
KP148420_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148419_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148418_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148414_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148411_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148409_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148406_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148405_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP148403_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148402_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148401_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148400_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148398_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148397_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148396_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYR
KP148395_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148394_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148390_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148389_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148388_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148387_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148386_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148385_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148384_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148383_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148380_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148379_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148378_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148377_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148376_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148375_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148374_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148373_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148372_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148371_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148370_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148369_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148368_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148365_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148363_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148362_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148361_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148360_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148359_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148357_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148356_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148349_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148348_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148347_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148346_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148344_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148343_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148342_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148341_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148340_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148339_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148338_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148336_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148334_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148333_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148331_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148330_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148328_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148327_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148326_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148325_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148324_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148323_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148322_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148321_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148320_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148319_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148318_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KP148317_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM392084_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM392083_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM392072_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KM359440_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803817_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803797_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALCR
KJ803787_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYR
KJ803784_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803783_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ803764_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ803763_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410517_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410516_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410507_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ410490_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173425_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173424_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173423_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173422_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173421_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173420_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173417_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173416_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173415_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173414_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173413_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173412_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173411_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173410_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173409_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173408_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173407_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173406_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173405_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173404_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173403_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173402_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173401_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173400_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173399_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173398_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173397_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173390_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173389_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173388_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173387_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173382_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173381_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173379_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRELLDTASALYR
KJ173376_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173375_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173374_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173370_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173369_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173367_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173366_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173365_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173364_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173363_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173361_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173360_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173359_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173357_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173356_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173355_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173354_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173353_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173352_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173351_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173347_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173345_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173343_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173342_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173341_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173340_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173339_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ173297_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019238_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019236_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019233_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019232_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KJ019231_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167174_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167158_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167092_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167079_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167051_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167028_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF167001_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF166796_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166786_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166758_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166390_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166363_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF166250_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165903_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165664_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165561_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165516_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165497_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165492_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165411_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF165341_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165328_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165299_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165136_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165108_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165107_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165079_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF165045_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF164905_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF164875_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF164853_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF164852_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885519_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885462_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885426_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885369_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885345_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885331_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885327_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885326_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885317_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885308_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885305_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885175_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885120_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC885110_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836874_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836865_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836864_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836863_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836861_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836857_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836853_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836843_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836841_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC836830_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774418_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774416_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774413_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774411_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774409_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774408_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
KC774404_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774403_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774401_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774399_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774398_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774394_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774393_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774392_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774390_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774388_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774387_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774386_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774384_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774382_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774381_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774380_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774378_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774376_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC774374_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774372_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774370_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774368_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774366_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC774363_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510660_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510659_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510658_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510657_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510656_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510655_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510654_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510653_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510652_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510651_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510650_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510649_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510648_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510647_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510646_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510643_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510642_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KC510641_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX978431_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX869999_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848311_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848310_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848244_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYR
JX848216_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848201_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848174_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848158_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848113_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848108_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848103_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848101_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLXDTASALYR
JX848093_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848092_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848049_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848030_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848020_HBe_P-B          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847997_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847994_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847965_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847962_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847959_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847958_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847956_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847952_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847943_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847938_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847910_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847896_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847895_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847894_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847893_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847890_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX847889_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661484_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661483_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661482_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661481_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661478_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661475_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661474_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661473_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661472_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661471_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX661470_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX507215_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX507210_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-LLPSDFFPSIRDLLDTASALYR
JX429908_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429902_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX429899_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX079938_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801514_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801512_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801507_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801479_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ801471_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ688405_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341530_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341510_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341496_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341486_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDSASALYR
JQ341485_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341484_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341481_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341477_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341470_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341465_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341464_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JN104451_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYR
FJ386610_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
MN650084_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASEELLS-FLPSDFFPSIRDLLDTASALYR
EU939565_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
DQ478886_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
S75184_HBe_P-C            SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MF925367_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MF674489_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
MF674463_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
KU964226_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
KU964222_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
KJ803779_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
JX026877_HBe_P-C          SKLCLGWLWDMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
FJ562265_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
JQ341489_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KX276844_HBe_P-C          SKLCLXWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341491_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYR
JX848179_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYR
KF873523_HBe_P-RF-CB      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF873522_HBe_P-RF-CB      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040148_HBe_P-RF-CB      SKLXLGWLWGMDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYR
KY629637_HBe_P-C          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JX848159_HBe_P-C          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ027318_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYR
FJ562298_HBe_P-C          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
DQ089767_HBe_P-C          SKLCLGWLWGMDIDPYKEFGAXVELLS-FLPSDFFPSXRDLLDTASALYR
AB111112_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASXELLS-FLPSDFFPSXRDLLDTASALYR
KY689485_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689414_HBe_P-B          SKLCLGWLXXMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY689408_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848075_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JX848038_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHR
JX847885_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341502_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341483_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ040151_HBe_P-C          SKLCLGWLXGMDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYR
FJ386641_HBe_P-C          SKLCLGWLXGMDIDPYKEFGASXELLS-FLPSDFFPSXRDLLDTASALYR
JQ341467_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALXR
FJ562296_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASXELLS-FLPSDFFPSXRDLLDTASALYR
JQ341541_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALXR
JQ040152_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYR
JX848263_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JQ341504_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
JQ341463_HBe_P-B          SKLCLGWLXGMDIDPYKEFGASVELLS-FLPSDFFPSXXDLLDTASALYR
HM011502_HBe_P-C          SKLCLGWLXGMDIDPYKEFGASXELLS-FLPSDFFPSXRDLLDTASALYR
AB048701_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTATALYR
MT603394_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSVRDLLDTASALFR
MH725199_HBe_P-D          SKLCLGWLWGMELDPYKEFGATVQLLS-FLPSDFFPSVRDLLDTATALYR
MF488699_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK052972_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPTVRDLLDTASALYR
JF754625_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSVRDLLDTAKALYR
MH725171_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTATALYR
JN688685_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX079943_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KY616076_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU456684_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTASALYR
EU726901_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSVRDLLDTASALYR
AY967468_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB119253_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPQDFFPAVRDLLDTASALYR
MT210034_HBe_P-A          SKLCLGWLWGMDXDPYKEFGATVELLS-FLPXDFXPSVRDLLDTASALYR
JN040821_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110879_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724970_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELIS-FLPSDFFPSVRDLLDTASALYR
DQ304547_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY236162_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ304548_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ304549_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ304550_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ304551_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849720_HBe_P-E          SKLCLGWLWGMVIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925360_HBe_P-RF-DB      SKLCLGWLWDMDIDPYKEFGATVELLS-FLPADFFPSVRALLDTASALYR
KT001364_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040771_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB110075_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB120308_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725096_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPGDFFPSVRDLLDTASALYR
MH725110_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPGDFFPSVRDLLDTASALYR
MH725118_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPGDFFPSVRDLLDTASALYR
KT001348_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857115_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDYFPSVRDLLDTARALYR
KJ470894_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYR
KC875329_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFLSVRDLLDTATALYR
KX196235_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFLSVRDLLDTATALYR
JN040795_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTATALFR
MH481862_HBe_P-RF-DE      SKLCLGWLWGMDSDPYKEFGATMELLS-FLPSDFFPSVRDLLDTAAALYR
KF779382_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYR
JN664926_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
JN664943_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTAAALYR
JN664929_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
MF618347_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KF192841_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KF192840_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KF192839_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KF192837_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
FJ692532_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
FJ692533_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
GQ205384_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
JN664932_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KC774460_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KJ470889_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KM524345_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KM524361_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KM606744_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KM606752_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KU668433_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KC885357_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KC885518_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KF798275_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB033559_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
DQ315779_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
GQ205377_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDFLDTAAALYR
GQ205378_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
GQ205379_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
GQ205387_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
GU563560_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700497_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700501_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700503_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700524_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700525_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
MK516280_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
MK516279_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
MH481861_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
MH481859_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
MH481858_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
MF618346_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KX357632_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATVQLLS-FLPSDFFPSVRDLLDTAAALFR
KT366505_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KJ470890_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KJ470888_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KJ470887_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KJ470886_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KJ470884_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KF192838_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KF192833_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KC774450_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
JN664940_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700584_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700583_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700582_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700581_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700541_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700538_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700535_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
HQ700537_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
MT731837_HBe_P-E          SKLCLGWLXXMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT623842_HBe_P-E          SKLCLGWLXDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257191_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX827302_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATLELLS-FLPSDFYPSVRDLLDTASALYR
MT427111_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDVLDTASALYR
GQ161797_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350215_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FWPSDFFPSVRDLLDTASALYR
X85273_HBe_P-D            SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTASALYR
MN310706_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPTDFFPAVRDLLDTASALYR
MN310707_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPAVRDLLDTASALYR
MH725144_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KT749827_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP857117_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP857110_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPPDFFPSVRDLLDTASALYR
KC875330_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTATALYR
KC875308_HBe_P-D          SKLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTATALYR
JQ707682_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707683_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707684_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707685_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707686_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707687_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707688_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707689_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707690_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707691_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707692_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707693_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707694_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707695_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707696_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707697_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707698_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707699_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707700_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707701_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707702_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707703_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707704_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707705_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JQ707706_HBe_P-D          SKLCLGWLWDMDIDSYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
JN040796_HBe_P-D          SKLCLGWLWGMDIDPYKELGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040792_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040791_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF754602_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPGDFFPSVRDLLDTASALYR
JF439700_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439701_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477456_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPTVRDLLDTASALYR
FJ904446_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
FJ349208_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALFR
EU185779_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX470760_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC012652_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EF103281_HBe_P-D          SQLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY509204_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110874_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLDTASALFR
AM110877_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLDTASALFR
AB090268_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTASALYR
JF439695_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTASALYR
JN664947_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTASALYR
MH725204_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTASALYR
AF289937_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110856_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALFR
X97848_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724234_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
MH724229_HBe_P-D          SKLCLGWLWGMDIDPYKEFGAXVELLS-FLPSDFFPSVRDLLDTASALYR
MG491187_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFTSVRDLLDTASALYR
KP857116_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTASALFR
KM524358_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
KF471654_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALFR
JN040797_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALFR
EU726958_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110826_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350123_HBe_P-E          FKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB205188_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725139_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MH724961_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDLFPSVRDLLDTASALYR
MH724967_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDLFPSVRDLLDTASALYR
EU155893_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB222710_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB205190_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN688713_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPXDFFPXVRDLLDTASALYR
MT603398_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPXDFFPSVRDLLDTASALYR
KU668440_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427156_HBe_P-E          SKLCLGWLWGMDIDPYKELGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427140_HBe_P-E          SKLCLGWLWGMDIDPYIDFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507841_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF772360_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001378_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLNTASALYR
KT001363_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849719_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVEFLS-FLPSDFFPSVRDLLDTASALYR
JQ000009_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726883_HBe_P-E          SKLCLGWLWGMDIDAYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494695_HBe_P-E          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AM494692_HBe_P-E          SKLCLGWLWGMDIDPYKEFGASVDLLS-FLPSDFFPSVRDLLDTALALYR
AM110821_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350180_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350168_HBe_P-E          SKLCLGWLWGMDIDSYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AF350154_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVESLS-FLPSDFFPSVRDLLDTASALYR
AF350146_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350117_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
AF350112_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVEILS-FLPSDFFPSVRDLLDTASALYR
AF350107_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350101_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB274972_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB201290_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X85298_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X85259_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT731920_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNVRDLLDTAQALFR
MH725197_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
MH725196_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
MH725169_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725108_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725103_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDSFPSVRDLLDTASALYR
MH725092_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPFDFFPSVRDLLDTASALYR
MH725091_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPFDFFPSVRDLLDTASALYR
MH725090_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725089_HBe_P-D          SKPCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725076_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725071_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725047_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATGELLS-FLPSDFFPSVRDLLDTASALYR
MH725033_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725031_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725028_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725022_HBe_P-D          SKLCLGWLWGMDIDSYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724999_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FVPSDFFPSVRDLLDTASALYR
MH724984_HBe_P-D          SKLCLGWLWGMDIDPYREFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724247_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724244_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464844_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464836_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491130_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFTSVRDLLDTASALYR
LK995390_HBe_P-D          SKLCLEWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KY629634_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFYPSVRDLLDTASALYR
KX196229_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KU668447_HBe_P-D          SKLCLGWLWGMDIDPYKEFGVTVELLS-FLPSDFFPSVRDLLDTASALYR
KU668442_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU668439_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPPDFFPSVRDLLDTASALYR
KP857109_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671698_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF584130_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF471656_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875342_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875326_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTATALYR
KC875315_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875314_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPPVRDLLDTASALYR
KC875289_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTATALYR
JX079942_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707514_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707513_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707512_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707486_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707483_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257205_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JN257186_HBe_P-D          SKLCLGWLWGMDLDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257166_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JN257165_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JN132132_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040822_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040820_HBe_P-D          SKLCLGWLWDMDIDPYKEFGAAVELLS-FLPSDFFPSVRDLLDTASALYR
JN040814_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTATALYR
JN040794_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040793_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040758_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTALALYR
JF754635_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPGDFFPSVRDLLDTASALFR
HQ257269_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU456636_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ205385_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ899792_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
EU787439_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726861_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594434_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
EU594422_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRALLDTASALYR
AB119256_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH481860_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
JF439998_HBe_P-RF-DE      SKPCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439996_HBe_P-RF-DE      SKPCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464856_HBe_P-E          SKLCLGWLWGMDIDPYKGFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001366_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001361_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001349_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001344_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001338_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001337_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849713_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885547_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363592_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363591_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363590_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363589_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363588_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363568_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363567_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110904_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110880_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110868_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110853_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X65258_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X65257_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507852_HBe_P-D          SNLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507837_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FFPSDFFPSVRDLLDTASALYR
MH725142_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYW
MH725136_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYW
MH725011_HBe_P-D          SQLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT347090_HBe_P-D          SRLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524347_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726860_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
EU234070_HBe_P-D          SKLCXGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110900_HBe_P-E          SKXXLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110892_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
MT427171_HBe_P-E          FKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736910_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001342_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110912_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110850_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350164_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350139_HBe_P-E          CKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350114_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ810895_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
KF896606_HBe_P-D          PKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X75657_HBe_P-E            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT731885_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427201_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427200_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427199_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427198_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427197_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427195_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427194_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427193_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427192_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427191_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427190_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427189_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427188_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427187_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427186_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427185_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427184_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427183_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427182_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427181_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427180_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427179_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427178_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427177_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427176_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427175_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427174_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427173_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427172_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427170_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427169_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427168_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427167_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427166_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427165_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427164_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427163_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427162_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427161_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427159_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427158_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427157_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427155_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427154_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427153_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427152_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427151_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427150_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427149_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427148_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427147_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427146_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427144_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427143_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427142_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427141_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427139_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427138_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427137_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427136_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427135_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427134_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427132_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427131_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427130_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427129_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427128_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427127_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427125_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427124_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427123_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSYFFPSVRDLLDTASALYR
MT427122_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427120_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427119_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427117_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427116_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427115_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427114_HBe_P-E          SKLCLGWIWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT427110_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN967529_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN967528_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN967527_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507848_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507846_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507845_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507843_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507842_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK720632_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK720631_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK321264_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH918655_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725114_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725042_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725021_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725020_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725010_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH592467_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580652_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580651_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580649_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580647_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580646_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580644_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580641_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580640_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580638_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580637_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580636_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580635_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580634_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580633_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580632_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580631_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580630_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580629_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580628_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580625_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580624_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580623_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580622_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580621_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580620_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580619_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580618_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580617_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580616_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580615_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580614_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF772362_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT623850_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT623846_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX186584_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736908_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736907_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736906_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736905_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736903_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736902_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736901_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736900_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736899_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736898_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736897_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736896_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736895_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLX-FLPSDFFPSVRDLLDTASALYR
KU736894_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736893_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736891_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT192626_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001375_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001373_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001371_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001370_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001360_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001359_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001358_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001357_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001356_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001355_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001354_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPAVRDLLDTASALYR
KT001350_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001346_HBe_P-E          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KT001345_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001343_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001341_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001340_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001336_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001333_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP288876_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVQLLS-FLPSDFFPSVRDLLDTASALYR
KP243569_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243525_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243481_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243478_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243472_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243459_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243446_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243421_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243360_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243347_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243340_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243325_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243321_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243307_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243240_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243216_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849727_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849723_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849722_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849721_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849717_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849715_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849714_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELXS-FLPSDFFPSVRDLLDTASALYR
KF798298_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798270_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798259_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF170742_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF170741_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885542_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885512_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885501_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885490_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885470_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885464_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885443_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885442_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885395_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885386_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885354_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885351_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885233_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885220_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885210_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ000008_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700552_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700550_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363593_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
HM363583_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363582_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363581_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363580_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363579_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363577_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363574_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363573_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363572_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363570_HBe_P-E          SKLSLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363569_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM164134_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ491114_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161833_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161832_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161829_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161828_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161827_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161819_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161817_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161816_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161815_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161808_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161804_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161800_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161798_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161793_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161791_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161789_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161787_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161784_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161781_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161780_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161779_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161777_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161776_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161772_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161771_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161770_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161769_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161765_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161764_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161763_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161761_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161760_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161759_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545841_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349239_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349238_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349237_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349226_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU620071_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU239226_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU239221_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU239219_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU239218_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ060830_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ060829_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ060828_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ060827_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ060826_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ060825_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ060824_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ060823_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ060822_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY967466_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY967464_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY739674_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY738147_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY738146_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY738145_HBe_C-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY738144_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY382492_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494790_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494789_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494788_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494717_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494715_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494713_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494712_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494711_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494710_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494709_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494708_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494707_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494706_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494705_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494704_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494702_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494701_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494700_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494699_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494698_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494697_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494696_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494694_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494693_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494690_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494689_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110913_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110899_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110893_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110890_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110889_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110888_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110887_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110886_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110885_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110884_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110883_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110882_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110875_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110869_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110867_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110866_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110865_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110864_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110863_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110858_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110857_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110852_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110848_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110824_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110823_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110822_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110819_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110817_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110809_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110808_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350220_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350219_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350218_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350217_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350216_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350214_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350213_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350212_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350210_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350206_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350205_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350203_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350201_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350200_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350199_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350198_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350197_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350196_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350195_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350194_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350193_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350192_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350190_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350189_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350188_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350186_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350185_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350183_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350182_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350181_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350179_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350178_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350174_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350173_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350172_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350171_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350170_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350169_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350167_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350166_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350165_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350163_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350162_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350161_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350160_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350159_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350158_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350157_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350156_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350155_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350153_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350152_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350151_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350150_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350149_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350148_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350147_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350143_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350142_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350141_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350140_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350138_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350136_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350135_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350134_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350133_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350132_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350131_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350130_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350128_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350127_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350126_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350125_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350124_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350122_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350121_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350120_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350119_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350118_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350116_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350109_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350108_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350106_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350103_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350102_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350100_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350099_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB915175_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB274971_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB274970_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB274969_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB205192_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB205191_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB205189_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB205129_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB201289_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB201288_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB201287_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB194947_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB106564_HBe_C-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB091256_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB091255_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
Z35716_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
Y07587_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X85308_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X85297_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X85294_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X72702_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
V01460_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MW082640_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT603403_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT603402_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT603401_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT603400_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT603385_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT579903_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT579902_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT579900_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT579898_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN585095_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507853_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507851_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507839_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507838_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN310714_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN310713_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN310708_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK693109_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK693108_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK693107_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618443_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618437_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618433_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK618432_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618431_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618430_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618429_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618428_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK618427_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK618426_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618422_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618421_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618420_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618419_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618418_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598675_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598672_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598671_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598670_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598669_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598668_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598667_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598666_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598665_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598664_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK598663_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598662_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598659_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598658_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK598657_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598655_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598651_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598650_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598649_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598648_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598647_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK598646_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK598645_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598644_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598643_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598642_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598641_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598640_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598639_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598638_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598637_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598636_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK516278_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK507914_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK507913_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK507912_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK507911_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK507910_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK355500_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725211_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725208_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725207_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725206_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725205_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725198_HBe_P-D          SKLCLGWFWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725195_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725193_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725191_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725190_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725188_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725187_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725185_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725184_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725182_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725181_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725180_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725179_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725178_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725176_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725175_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725174_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASPLYR
MH725173_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725170_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725168_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725166_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725165_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725164_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725163_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725162_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725161_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725160_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725159_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725158_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725157_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725156_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725155_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725154_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725149_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725146_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725145_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725143_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725140_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MH725138_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725137_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725133_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725132_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725131_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725129_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725128_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725127_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725124_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725122_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725121_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725120_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725117_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725116_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725107_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725106_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725105_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725104_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725093_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725087_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MH725085_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725084_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725083_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725082_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725078_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725077_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MH725075_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725074_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725073_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725072_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725070_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725063_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725062_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725061_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MH725060_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725059_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725058_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725057_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725056_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725055_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725053_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725052_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725051_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725049_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725048_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725046_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725044_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725041_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725040_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725039_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725037_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725036_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725035_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725034_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725032_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725030_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725029_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725027_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725026_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725025_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725023_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725018_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725017_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725016_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725015_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725014_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MH725013_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725009_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725007_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725006_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725004_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725003_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725002_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724998_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724997_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724996_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724991_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724990_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724989_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724987_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724986_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724985_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724983_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724982_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724981_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724977_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724975_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724974_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724972_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724966_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724965_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724963_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724958_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724956_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724955_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724954_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724250_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724249_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724231_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724223_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724221_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724219_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724218_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724217_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724214_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH592475_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464854_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464834_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491192_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491190_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491181_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491175_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MG491165_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491161_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491157_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491151_HBe_P-D          SKLCLGWLWGMNIDPYKEFGATVQLLS-FLPSDFFPSVRDLLDTASALYR
MG491136_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925393_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925391_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925364_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925358_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF618348_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF618343_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF618342_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF618341_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF618339_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT992454_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT992439_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT992438_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC365689_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KY382414_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX827301_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX827300_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX827292_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX827290_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSGFFPSVRDLLDTASALYR
KX196236_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KX196234_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196233_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196231_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196227_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196226_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196225_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196224_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196222_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196221_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196219_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196217_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196216_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196215_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196214_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736925_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736924_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU668449_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU668446_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU668441_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU668438_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU668436_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU668435_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366511_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366510_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366509_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366508_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366507_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366506_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366502_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366500_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366499_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366498_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366497_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366496_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366495_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366494_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366491_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT151620_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KR905424_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KR905423_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857107_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857106_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857105_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857104_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857100_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857099_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857097_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671699_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671697_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671696_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671695_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671694_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671693_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671691_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671690_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671689_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671688_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671687_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671686_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671685_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671684_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP322601_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP322600_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP322599_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243592_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243572_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243557_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243510_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243497_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243495_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243494_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243484_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243469_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243467_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243465_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243430_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243428_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243417_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243403_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243394_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243379_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243279_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP090181_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP090180_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP090179_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP090178_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP090177_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524355_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524354_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524353_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524352_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524351_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524350_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524349_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524348_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524346_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524341_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524339_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM519455_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922432_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798306_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798283_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798282_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798273_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798260_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779377_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779376_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779341_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779340_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779318_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779303_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779302_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779301_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779296_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779292_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779289_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779288_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779285_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779230_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF779228_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779224_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779222_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779220_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779218_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779217_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779216_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779214_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779212_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779209_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF679997_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF679996_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF679995_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF679994_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF679993_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF679992_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF679989_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF584162_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF584129_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF584076_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF471652_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF471651_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF471650_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF471647_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF061170_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF061168_HBe_P-D          SKLCLGWLWXMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF018194_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF018191_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF018190_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF018187_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF018184_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF018180_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999421_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885527_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885523_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885517_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885511_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885500_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885498_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885486_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885472_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885465_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885457_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885441_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885429_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885424_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885413_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885404_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885401_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885387_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885380_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885279_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885267_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885254_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885250_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885191_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885149_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885148_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885108_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885102_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885101_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885098_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885096_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875336_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875334_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875332_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875331_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875325_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875324_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875323_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875322_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875321_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875320_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875319_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875318_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875317_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875316_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875313_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875311_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875310_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875309_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875307_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875306_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875300_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875297_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875295_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875294_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875293_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875285_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875282_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875280_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875279_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875278_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875277_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875276_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875275_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC774477_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC774462_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC774445_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC774444_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX898697_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX898694_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX898692_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX898691_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX898689_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX310734_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX310733_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX096958_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX096957_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX096956_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX096954_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707504_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707501_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707495_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707492_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707477_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ403606_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ038414_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ038409_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ038407_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ038394_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ038389_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ038387_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN792910_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN792909_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN792907_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN697591_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664938_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664937_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664931_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
JN664930_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664927_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664917_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664914_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664913_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664912_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664911_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN642166_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN642138_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN642131_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN642129_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JN558564_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN558563_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN558562_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN558561_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257203_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257199_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257196_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257194_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257193_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257185_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257182_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257181_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257171_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257155_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257151_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257150_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN132131_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN132130_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN132128_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN132127_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN132126_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040826_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040824_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040808_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040807_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040806_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040805_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040790_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040788_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040786_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040785_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040759_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040756_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040752_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF754628_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF754624_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF754618_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF754601_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF754591_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439712_HBe_P-D          SKLCLGWLWGMDIDPYKEFGAIVELLS-FLPSDFFPSVRDLLDTASALYR
JF439705_HBe_P-D          SKLCLGWLWGMDIDPYKEFGAIVELLS-FLPSDFFPSVRDLLDTASALYR
JF439704_HBe_P-D          SKLCLGWLWGMDIDPYKEFGAIVELLS-FLPSDFFPSVRDLLDTASALYR
HQ833471_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ833470_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ833467_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ833465_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700514_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700513_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700512_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700511_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700488_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700487_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700484_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700482_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700480_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700479_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700474_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700473_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700471_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700469_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700466_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700464_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700459_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700454_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700453_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700451_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700450_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700449_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700447_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700446_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700445_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700443_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700442_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700441_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700440_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ641710_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ236014_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM750156_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM750155_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM750154_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM750153_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM750152_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM750151_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU357846_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU256252_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ922002_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477459_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ377589_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ205389_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ205388_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ205382_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ205380_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183484_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183483_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183482_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183481_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183480_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183479_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183478_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183477_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183476_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183475_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183474_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183473_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ183471_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ904443_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692507_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692506_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ386590_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349234_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349232_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349229_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349228_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349218_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349217_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349205_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ040872_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU919197_HBe_P-D          SKLCLGWLWGMDIDPCKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU787447_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU787446_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU787445_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU787442_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU787441_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU787440_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU787437_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU787436_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726976_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726972_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726971_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726967_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726964_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726962_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726959_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726940_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726935_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726931_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726930_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726924_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726923_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726919_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726918_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726914_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726909_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726907_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726902_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726900_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726899_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726898_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726895_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726894_HBe_P-D          SKLLLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726888_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726887_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726878_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726874_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726869_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726865_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726862_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726854_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726845_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726844_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594433_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594432_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594431_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594430_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594428_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594427_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594425_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594424_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594423_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594421_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594416_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594415_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594412_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594411_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594410_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594409_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594408_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594407_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594405_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594403_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594402_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594401_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594400_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594399_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594397_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594396_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594382_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414140_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414138_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414136_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414135_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414061_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414060_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414058_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414057_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414056_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASXLYR
EU414141_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASXLYR
EU414143_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707515_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707516_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707517_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707518_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707519_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707520_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707521_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707522_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707523_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707524_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707525_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707526_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707527_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707528_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707529_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707530_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618434_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618435_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618436_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725068_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATAELLL-FLPYDFFPSVRDFIDTASALYR
MH724230_HBe_P-D          FQLCLGWVWGMDLYPYKEIGASGEFLL-FFPSDFFPSVRDLLDTASALYR
MH725172_HBe_P-D          FQLCLGWLWGMDLDPYKEFGGIVELLF-FLPSDFFPSVRDLLDTASALYR
HM214736_HBe_P-E          SKLCLGGLWGMDIDPFKKFGATGELLS-FLPFDFFPSVRDFLDTPSALYR
FN594767_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGASVELLS-FLPHDFFPSVKDLLDTASALYR
KF471640_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVNLLS-FLPADYFPSVRDLLDTASALYR
KP671700_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALFR
HM214749_HBe_P-E          SKLCLGWLWGMDIDPYKKFGATGELLS-FLPFDFFPSVRDFLDTPSALYR
KC885171_HBe_P-E          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AM110902_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
MH724978_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPQDFFPAVRDLLDTASALYR
MH724225_HBe_P-D          SKLCLGWLWGMDIDPYKEFGAXGELLS-FLPSDFFPSVRDLLDTASALYR
FN594771_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161796_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY382496_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580626_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB915178_HBe_P-E          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MN507836_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX847948_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ904402_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
FJ868011_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPYDFFPSVRDLLDTASALYR
FJ867970_HBe_P-D          SKLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867979_HBe_P-D          SKLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867983_HBe_P-D          SKLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ868009_HBe_P-D          SKLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EF395261_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM042269_HBe_P-C          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB674405_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY373431_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726876_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867964_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867966_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867973_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867974_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867975_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867981_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867984_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867996_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867998_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867999_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ868004_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU456649_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ904440_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MF772357_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALFR
GQ161835_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161756_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161755_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYG
AM110901_HBe_P-E          SKLCLEWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
MH725123_HBe_P-D          SKLCLGWLWGKGIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491143_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196212_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTATALYR
KX196209_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTATALYR
KC875305_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTATALYR
KC875290_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTATALYR
AB674426_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
Z68143_HBe_P-E            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
Z68140_HBe_P-E            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MW082636_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736892_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161801_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU239223_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF584078_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLGTASALYR
MK598653_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598652_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736916_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN967526_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725192_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736911_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVZLLS-FLPSDFFPSVRDLLDTASALYR
KT001352_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001334_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161826_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLYTASALYR
GQ161795_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494714_HBe_P-E          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AM110897_HBe_P-E          SKLCLEWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
AB274973_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLDTASALYR
X85295_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598674_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
MK598673_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725194_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725186_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725151_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725150_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725147_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725130_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725113_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725111_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725101_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724992_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491129_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196232_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196230_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KX196220_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196218_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KX196213_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KX196211_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX196210_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KX196208_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366501_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606745_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524356_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVQLLS-FLPSDFFPSVRDLLDTASALYR
KF779223_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF471657_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885522_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875340_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875337_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875335_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875333_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875312_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875303_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875302_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875299_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875292_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875291_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875288_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875287_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875286_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875284_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875283_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875281_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JX096955_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN642155_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545823_HBe_P-E          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVXDLLDTASALFR
KU736909_HBe_P-E          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736912_HBe_P-E          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257152_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257209_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ904435_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPFDFFPSVRDFLDSALALYR
MF488702_HBe_P-RF-DE      SKLCLRWIWGMDIDTYKEFGATVEILS-FLSPDFFPSLRDLLDTASALYR
MH724962_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVQLLS-FLPSDFFPSARDLLDTASALYR
MK598676_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTASALFR
AF043594_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVQLLS-FLPHDFFPSVRDLLDTASALFR
MK598678_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVQLLS-FLPHDFFPSVRDLLDTASALYR
MK598677_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVQLLS-FLPHDFFPSVRDLLDTASALFR
MH724960_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSIRDLLDTASALFR
MH724969_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSIRDLLDTASALFR
AB119255_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH724224_HBe_P-D          SKLCLGWLWGMDIYPYKEFGATGELLS-FLPSDFFPSVRDLLDTASALYR
JN688678_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
AM110872_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALFR
DQ486021_HBe_P-D          SKLCLGWLRDMDIDPYKEFGASVELLS-FLPSDFYPSVRDLLDTASALFR
HM363595_HBe_P-E          SKMSLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLIDTASALYR
MH725054_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPHDFFPSARDLLDTASALYR
AB716760_HBe_P-D          SKLCLGWLWGLVMGHHKEFGATVELLS-FLPSDFFPSVRXLLDTASAIYR
HE805987_HBe_P-D          SKLCLGWLWGLVMGHHKEFGATVELLS-FLPSDFFPSVRXLLDTASAIYR
MH725125_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725095_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLHFDFFPSVRHLLDTASALYR
DQ178011_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVQDLLDTASALYR
AY603445_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FSPSDFFPSVRDLLDTASALYR
MH725001_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FSPSDFFPSVRDLLDTASALYR
AY161157_HBe_P-D          SKLCLGWLWGMDTDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB205128_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724973_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB078031_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSLRDLLDTASALYR
AB078032_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSLRDLLDTASALYR
AB078033_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSLRDLLDTASALYR
AB267090_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSLRDLLDTASALYR
AY161141_HBe_P-RF-AD      SKLCLGWLWGMDIDPHKEIGATVELLS-FLPSDFFPSARDLLDTASALYR
HM363575_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTGSSLYG
MH724228_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDSASALYR
KM606655_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AY721611_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350086_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC774179_HBe_P-C          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC774297_HBe_P-C          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB090269_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB090270_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB104709_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB104711_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB104712_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB109475_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116266_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB126581_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB188244_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB205126_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB205127_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB210821_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB210822_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB222711_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB222712_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB222713_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB246347_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB246348_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB270543_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB330369_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB330370_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB355452_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB471856_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB471857_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB493846_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB583680_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB674407_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF043593_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
AF121240_HBe_C-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF121241_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF280817_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF419526_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AJ131956_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AJ627220_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AJ627223_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY090453_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVQLLS-FLPSDFFPSVRDLLDTASALYR
AY230112_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY230114_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233291_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725102_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
KU668434_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
AM422939_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRGLLDTASALYR
AY233292_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRGLLDTASALYR
AY233294_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRGLLDTASALYR
AY233296_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRGLLDTASALYR
MN507847_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFHSVRDLLDTASALYR
MN507844_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFHSVRDLLDTASALYR
GQ161820_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFHSVRDLLDTASALYR
GQ161836_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFHSVRDLLDTASALYR
DQ315780_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KP857114_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
JN040813_HBe_P-D          SKLCLGGFWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ315776_HBe_P-D          SKLCLGWLWGIDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY796031_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDNASALYR
MT427196_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFSSVRDLLDTASALYR
X85318_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X02496_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDNASALYR
MH725005_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFSSVRDLLDTASALYR
MH724252_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MG491182_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFTSVRDLLDTASALYR
MG491169_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFTSVRDLLDTASALYR
MG491168_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFTSVRDLLDTASALYR
MG491138_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFTSVRDLLDTASALYR
MG491137_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFTSVRDLLDTASALCR
MG491134_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFTSVRDLLDTASALYR
MG491127_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFTSVRDLLDTASALYR
KF779225_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFHSVRDLLDTASALYR
JQ707510_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
JN792903_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414054_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EF103280_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EF103279_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EF103277_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EF103276_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EF103275_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ464170_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ464169_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ464168_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ399006_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ336688_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFLPSVRDLLDTASALYR
DQ178020_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVQDLLDTASALYR
DQ178019_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVQDLLDTASALYR
DQ178018_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVQDLLDTASALYR
DQ178016_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVQDLLDTASALYR
DQ178015_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVQDLLDTASALYR
AY945307_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY741797_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY721612_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY721610_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY721609_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY721606_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY721605_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY661793_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY661792_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603443_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603440_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603437_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603428_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603427_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY509205_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY509203_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY382510_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY371922_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY371921_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY371920_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY371914_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY371912_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY371907_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY371905_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY371902_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY371901_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY350614_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161837_HBe_P-RF-AE      SKLCLGWLWGMDIDPYKEFGATVELLS-VLPFGFFPSVRDXLDTASXLYR
AY161140_HBe_P-RF-AD      SKLCLGWLWGMDIDPHKEFGATVELLS-FLPSDFFPSARDLLDTASALYR
MH725141_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MH725024_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
HM363604_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALFR
GQ161794_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EF395269_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110911_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRNLLDTASALYR
AM110854_HBe_P-E          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X85302_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725203_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MH725183_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MH725148_HBe_P-D          SKLCLGWLWGVDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725134_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MH725119_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MH725100_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725099_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725098_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725067_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSLRNLLDTASALYR
MH725066_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSLRNLLDTASALYR
MH725019_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MH725008_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASTLYR
MH724995_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH724980_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH724979_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MH724976_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLHTASALYR
MH724971_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MH724968_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724964_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
MH724226_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU668437_HBe_P-D          SKLCLGWLWGRDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP671692_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707511_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRHLLDTASALYR
KX827299_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRHLLDTASALYR
FN594770_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
KT001347_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ810862_HBe_P-E          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849716_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110818_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRNLLDTASALYR
MN310709_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFYPSVRQLLDTASALYR
MK598661_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK598660_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725209_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRHLLDTASALYR
MH725069_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRHLLDTASALYR
MH724216_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRHLLDTASALYR
KU668445_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664928_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRALLDTASALYR
JN664918_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRALLDTASALYR
EU414059_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414139_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY274423_HBe_P-D          SKLCLGWLXGMAIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY274437_HBe_P-D          SKLCLGWLXGMAIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX357634_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRALLDTASALYR
AM494832_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRGLLDTASALYR
AM110871_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSXRDLLDTASALYR
HQ700455_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRXLLDTASALYR
JN257188_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257187_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736921_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736904_HBe_P-E          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110914_HBe_P-E          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT603396_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN310715_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRXLLDTASALYR
KP857094_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF584166_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF584164_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF584161_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVXBLLBTASALYR
JN257149_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRXLLDTASALYR
KF584163_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVXBLLBTASALYR
KF584165_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVXBLLBTASALYR
MN310705_HBe_P-D          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVXBLLBTASALYR
KU736926_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161838_HBe_P-RF-AE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDXLDTASXLYR
AF289974_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATTELLS-FLPSDFFPSVRDLLDTASALYR
MH725126_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALFR
MN507840_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTASALYR
MH725135_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSVRDLLDTASALYR
JN687947_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MG491186_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
X85301_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF849725_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725094_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725086_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448619_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MN310711_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AY935700_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618441_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725115_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464840_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494703_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF289945_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVQDLLDTASALYR
AB674403_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB188242_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363576_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTGSSLCG
AM494691_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPNDFFPSVRDLLDTASALYR
MH725202_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALFR
HQ236016_HBe_P-D          SRLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350105_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATEELLS-FLPSDFFPSVRDLLDTASALYR
AF350115_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATEELLS-FLPSDFFPSVRDLLDTASALYR
AF350137_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATEELLS-FLPSDFFPSVRDLLDTASALYR
GQ161803_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATEELLS-FLPSDFFPSVRDLLDTASALYR
MH580650_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATEELLS-FLPSDFFPSVRDLLDTASALYR
DQ336692_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFLPSVRDLLDTASALYR
AB674430_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB270548_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB555497_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF151735_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY721607_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY721608_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414055_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414142_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU726960_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU939681_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349216_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477457_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ922001_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM214720_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700444_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT623848_HBe_P-E          SKLCLGWLWXMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT001332_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606738_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885475_HBe_P-E          SKLCLGWLWXMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700551_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM363584_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM214721_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161810_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161792_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161790_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161782_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161778_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161774_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLDTASALYR
GQ161766_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLDTASALYR
GQ161758_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLDTASALYR
EU239217_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY739675_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLDTASALYR
AF350202_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350191_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350111_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X85304_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X85303_HBe_P-D            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK618425_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTTSALYR
MK618424_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTTSALYR
MK618423_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTTSALYR
MH932714_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725167_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725152_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725112_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725081_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725080_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725079_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725065_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725064_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724994_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724993_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724988_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH724959_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MG491124_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KY629630_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX827291_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857111_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF471649_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF192834_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF192832_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF192831_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF192830_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF061169_HBe_P-D          SKLCLGWLWXMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF061167_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707509_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707508_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707507_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707506_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707505_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707503_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707500_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707499_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707498_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707497_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDRLDTTSALYR
JQ707496_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707494_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707493_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707491_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707490_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707489_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707488_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707487_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707485_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707484_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707482_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707481_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707480_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707479_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707478_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707476_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ687530_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN664909_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257179_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN257148_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040817_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040816_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN040815_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF754608_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439718_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439703_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439699_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439696_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439692_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700489_HBe_P-D          SKLCLGWLWXMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700483_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700470_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700468_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700467_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
JF440013_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTASALYR
JF440012_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTASALYR
MT427126_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPPDFFPSVRDLLDTASALYR
MT427121_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPPDFFPSVRDLLDTASALYR
MF772354_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM524338_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700448_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HQ700477_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT623849_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPXDFFPSVRDLLDTASALYR
HM214730_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATGELLS-FLPFDFFPSVKDFLDPASALYR
KP857074_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPNDFYPSVKDLLDTASALYR
KP857060_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPPDFFPSARDLLDTAAALFR
JF439821_HBe_P-A          SKLCLGGLWGRDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYQ
FJ692586_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSARDLLDTASALYR
HM214731_HBe_P-A          SKLCLGGLWGMDIDPYKKFGATGELLS-FLPFDFFPSVRDFLDTASALYR
HM214727_HBe_P-A          SKLCLGGLWGMDIDPYKEFGGTGELLS-FLPFDFFPSVRDFLDTASALYR
MT731909_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPHDFFPSARDLLDTASALYR
FJ692595_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPNDFFPSVRDLLDTATALYR
EU414052_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSARDLLDTASALYR
EU414133_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSARDLLDTASALYR
DQ315778_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSFRDLLDTASALYR
DQ178012_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVQDLLDTASALYR
FN545829_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSARDLLDTASALYR
EU234071_HBe_P-A          SKLCLGWLWXMDIDPYKEFGATTELLS-FLPSDFFPSARDLLDTASALYR
AY373429_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU668448_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857076_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSARDLLDTASALYR
JQ707388_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439953_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPPDFFPSVRDLLDTASALYR
JF439908_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477464_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPLDFFPSVRDLLDTASALYR
FJ692611_HBe_P-A          SKLCLGWLWGMDIDTYKEFGASVELLS-FLPADFFPSVRDLLDTASALYR
FJ692576_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTASALYR
FJ692562_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
FJ692558_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPYDFFPSVRDLLDTASALYR
FJ349296_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATGELLS-FLPSDFFPSVRDLLNTASALYR
AB116089_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVQLLS-FLPSDFFPSVRDLLDTASALYR
AB014370_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB222707_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AY382514_HBe_P-B          SKLCLGWLWGMAIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MT731879_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
KP857092_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALFR
KP857077_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPIDFYPSVRDLIETASALYR
KF985190_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
JQ707593_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLA-FLPSDFFPSVRDLLDTASALYR
JQ707578_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLL-FLPSDFFPSVRDLLDTASALYR
JF439774_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545834_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSARDLLETASALYR
GU456671_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439859_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLPDTASALYR
FJ692596_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPXDFFPSVRDLLDTASALYR
AB116085_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB205118_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB480035_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB480036_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB480040_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF536524_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASTLYR
AY603432_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVLDLLDTASALYR
AY603441_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934772_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EF208113_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414048_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
EU859939_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477495_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
JQ707615_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707633_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707635_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707636_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707638_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707639_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707640_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707641_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707642_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707643_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707644_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707645_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707646_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707647_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707648_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707649_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707650_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707651_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707652_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707653_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707654_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707656_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885496_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779254_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPFVRDLLDTASALYR
KF779315_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779316_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779317_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779322_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779332_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843184_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606665_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606666_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857058_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX357646_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KY886219_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF772350_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725088_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KF471655_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
D00329_HBe_P-B            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTVSALYR
MF772344_HBe_P-A          SKLCLGWLWGMDIDPYKEYGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX686607_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749843_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASAMYR
KP857064_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
KP718101_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718094_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243433_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243274_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606742_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPFDFFPSVRDFLDTASALYR
KC885302_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX079945_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707655_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRELLDTASALYR
JQ707634_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707580_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707579_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707576_HBe_P-A          SKLCLGWLWGMNIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707575_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707574_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707396_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707382_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439981_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLGTASALYR
JF439972_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLP-FLPSDFFPSVRDLLDTASALYR
JF439969_HBe_P-A          SKLCLGWLWGMDIGPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439962_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439958_HBe_P-A          SRLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439855_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HE576988_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ868008_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
FJ867995_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692613_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
FJ692607_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
EU859919_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVEFLS-FLPSDFFPSVRDLLDTASALYR
EU594384_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
AY862868_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY862867_HBe_P-A          SKLCPGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857069_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSARDLLDTASALYR
KF985202_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985201_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985200_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779298_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779295_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779272_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLVDTASALHR
JF439984_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439980_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439949_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU563545_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLCDTASALYR
GQ477490_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSARDLLDTASALYR
FJ692565_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSARDLLDTASALYR
FJ692564_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSARDLLDTASALYR
EU859934_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594387_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414049_HBe_P-A          SXLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
EU185774_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLBTASALYR
MK512455_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALNR
KX648547_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATXELLS-FLPSDFFPSVRDLLDTASALYR
KP718092_HBe_P-A          XKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718090_HBe_P-A          XKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF214658_HBe_P-A          SQLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707605_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707600_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707596_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707595_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707577_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707341_HBe_P-A          FKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182329_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439992_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDLFPSVRDLLDTASALYR
JF439837_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439835_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439834_HBe_P-A          SRLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439751_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439744_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439729_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439724_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606723_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY161147_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSDRDLLDTASALYR
MF925407_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925400_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925385_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925361_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MF772353_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF772351_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
M74501_HBe_P-A            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
M57663_HBe_P-A            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT992448_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT992441_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT992440_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC592170_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC592169_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC592168_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC517161_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC462120_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLBTASALYR
LC458431_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC458430_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC430617_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC311243_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC311241_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC074724_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC051141_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
L13994_HBe_P-A            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KY003230_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX827296_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVGDLLDTASALYR
KX827295_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX827294_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX827293_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX648549_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX648548_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX357647_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX357645_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX357643_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX357642_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736920_HBe_P-A          SKLCLGWLWGMDIDPYKXFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736919_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU736918_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605539_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605538_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605537_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605536_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605535_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605534_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605533_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605532_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605522_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605521_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605520_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605519_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605518_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605517_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KU605516_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749850_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749849_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749847_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749846_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749844_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749842_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749840_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749839_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749838_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749837_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749836_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749835_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749834_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749831_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749830_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749829_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749826_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749825_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT749824_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366471_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366470_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366469_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366468_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366466_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
KT347088_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT347087_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT151618_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT151616_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT151614_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT151613_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT151611_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KR905431_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KR905430_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KR905425_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
KP718100_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDXLDTASALYR
KP718099_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718098_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718097_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718096_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718095_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718093_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718091_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718089_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718088_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718087_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718086_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP718085_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP274928_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP274927_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP274925_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243598_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243596_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243594_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243593_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243591_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243590_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243588_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243587_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243584_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243582_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243581_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243578_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243576_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243575_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243574_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243573_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243571_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243570_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243568_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243566_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243565_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243564_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243563_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243562_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243561_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243559_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243558_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243555_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243554_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243553_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243552_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243550_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243549_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243547_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243546_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243545_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243544_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243542_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243540_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243539_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243538_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243537_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243535_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243534_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243533_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243532_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243531_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243529_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243528_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243527_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243526_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243524_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243523_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243521_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243520_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243519_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243518_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243517_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243516_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243515_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243513_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243512_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243511_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243509_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243507_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243506_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243505_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243504_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243501_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243500_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243499_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243498_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243496_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243492_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243491_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243490_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243489_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243487_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243483_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243482_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243479_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243477_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243475_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243474_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243473_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243471_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243466_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243464_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243463_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243462_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243461_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243460_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243457_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243456_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243455_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243454_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243453_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243452_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243450_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243449_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243448_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243447_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243444_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243443_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243442_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243439_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243438_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243435_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243434_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243432_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243431_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243429_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243427_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243426_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243425_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243424_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243423_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243422_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243420_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243419_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243418_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243415_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243414_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243413_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243412_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243411_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243408_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243407_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243406_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243404_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243402_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243401_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243400_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243398_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243397_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243396_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243393_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243389_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243388_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243387_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243386_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243384_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243383_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243382_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243381_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243380_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243378_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243377_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243376_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243375_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243374_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243373_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243372_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243371_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243370_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243369_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243368_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243367_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243366_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243365_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243364_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243363_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243361_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243359_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243357_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243356_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243355_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243354_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243353_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243352_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243351_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243350_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243349_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243348_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243346_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243345_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243344_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243343_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243342_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243339_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243338_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243335_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243334_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243333_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243332_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243331_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243329_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243328_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243327_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243323_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243322_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243318_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243314_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243313_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243312_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243311_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243310_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243308_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243306_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243303_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243302_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243301_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243300_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243299_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243298_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243297_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243296_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243295_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243294_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243292_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243290_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243289_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243286_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243285_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243284_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243283_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243282_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243281_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243280_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243276_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243275_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243273_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243272_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243270_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243267_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243266_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243265_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243264_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243262_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243261_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243259_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243256_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243255_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243254_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243253_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243251_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243250_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243249_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243248_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243246_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243245_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243244_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243243_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243241_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243238_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243237_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243236_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243235_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243233_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243232_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243230_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243229_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243227_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243226_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243225_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243224_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243223_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243222_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243221_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243220_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243219_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243218_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243217_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243215_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243214_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243213_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243212_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243211_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243210_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243209_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243208_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243207_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243206_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243204_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243202_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243201_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP168435_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP168434_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP168433_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP168432_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP168430_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP168427_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP168424_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP168423_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606749_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606746_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606700_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606694_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606691_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606687_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606685_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606684_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606683_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606680_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606678_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606677_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606676_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606674_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606672_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606669_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606663_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606660_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606656_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606652_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606648_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM519454_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM519453_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM519452_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM243029_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854710_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854709_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854708_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854707_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854706_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854705_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854704_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854702_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854699_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854698_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854697_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854696_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854694_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854693_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854692_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854690_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTSSALYR
KJ854689_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854688_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843218_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843217_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843216_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843215_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843214_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843192_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843188_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843186_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843183_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843182_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843173_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843166_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ810858_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ810857_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ810856_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ010778_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ010777_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ010776_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985203_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985199_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985198_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985196_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985195_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985194_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985193_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985192_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985191_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922428_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922427_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922426_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922425_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922424_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922409_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922408_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922407_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922406_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798314_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798311_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798310_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798309_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798308_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798302_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798292_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798290_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798289_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798286_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798285_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798279_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798278_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798265_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
KF779386_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779385_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779384_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779383_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779379_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779378_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779375_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779374_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779373_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779372_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779371_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779370_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779369_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779368_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779367_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779366_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779364_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779363_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779362_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779361_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779360_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779359_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779358_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779356_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779355_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779354_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779352_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779350_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779349_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779348_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779347_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779346_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779345_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779344_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779342_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779339_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779338_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779337_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779336_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779335_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779334_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779333_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779331_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779330_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779329_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779328_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779326_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779325_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779324_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779323_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779321_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779320_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779319_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779314_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779313_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779312_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779311_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779310_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779309_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779308_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779307_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779306_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779305_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779304_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779299_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779297_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779294_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779293_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779291_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779290_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779286_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779284_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779283_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779282_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779281_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779279_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779277_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779276_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779275_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779274_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779273_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779271_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779270_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779269_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779268_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779266_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779265_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779264_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779263_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779262_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779261_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779260_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779259_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779258_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779257_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779256_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779255_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779253_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779251_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779248_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779247_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779246_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779245_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779244_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779243_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779240_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779239_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779238_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779234_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779232_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779231_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779227_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779215_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779213_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF214665_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF214663_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF214659_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999460_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999459_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999454_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999451_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999448_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999447_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999445_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999442_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999438_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999437_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999434_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999433_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999430_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999428_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999425_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999424_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999422_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC999420_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885557_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885555_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885554_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885553_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885552_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885551_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885549_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885548_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885546_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885544_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885541_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885539_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885538_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885536_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885535_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885534_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885533_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885531_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885530_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885528_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885526_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885525_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885524_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885520_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885516_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885515_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885514_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885513_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885509_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885507_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885506_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885505_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885504_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885502_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885497_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885495_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885494_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885491_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885489_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885488_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885487_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885484_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885483_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885482_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885481_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885480_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885479_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885478_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885476_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885474_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885473_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885467_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885466_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885461_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885456_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885455_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885454_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885453_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885451_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885449_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885447_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885445_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885440_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885439_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885438_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885437_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885436_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885435_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885434_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885432_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885431_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885430_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885428_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885427_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885425_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885423_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885422_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885420_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885419_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885417_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885416_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885411_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885409_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885408_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885407_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885406_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885405_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885402_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885399_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885398_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885397_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885396_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885394_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885393_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885391_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885390_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885389_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885388_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885384_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885383_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885382_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885381_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885379_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885378_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885377_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885376_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885375_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885373_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885371_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885365_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885360_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885359_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885356_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885355_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885353_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885350_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885349_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885348_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885347_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885346_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885344_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885343_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885342_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885340_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885339_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885338_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885337_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885335_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885332_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885330_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885329_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885328_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885325_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885324_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885323_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885322_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885320_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885319_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885318_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885316_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885315_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885314_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885313_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885312_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885311_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885310_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885307_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885306_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885303_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885301_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885300_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885299_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885298_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885297_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885296_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885295_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885293_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885292_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885290_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885289_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885288_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885287_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885284_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885283_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885282_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885280_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885276_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885275_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885274_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885273_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885271_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885270_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885269_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885266_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885264_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885263_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885262_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885261_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885259_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885258_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885257_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885256_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885255_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885253_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885252_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885249_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885248_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885247_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885246_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885245_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885244_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885243_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885242_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885241_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885240_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885239_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885238_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885237_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885236_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885232_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885230_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885229_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885228_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885227_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885226_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885225_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885224_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885223_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885222_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885221_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885219_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885218_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885217_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885216_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885215_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885213_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885209_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885208_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885205_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885204_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885203_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885202_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885201_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885199_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885198_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885197_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885196_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885195_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885194_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885192_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885190_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885189_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885188_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885187_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885186_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885184_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885182_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885181_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885180_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885179_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885178_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885177_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885176_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885174_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885173_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885172_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885170_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885169_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885168_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885166_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885165_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885164_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885163_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885162_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885159_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885158_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885157_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885155_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885154_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885152_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885151_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885146_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885145_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885144_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885143_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885142_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885140_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885139_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885138_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885137_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885136_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885135_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885133_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885132_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885131_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885130_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885129_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885127_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885126_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885125_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885123_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885122_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885121_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885119_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885118_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885117_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885116_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885115_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885113_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885112_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885109_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885107_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885106_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885105_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885103_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885100_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885099_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885097_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885095_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885094_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885093_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885092_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885091_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885090_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885089_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885088_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885087_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875258_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875252_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC836858_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC836854_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC836849_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC836846_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC836834_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYR
KC836832_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC836831_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX310725_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX310723_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX310722_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX310721_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX096953_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELPS-FLPSDFFPSVRDLLDTASALYR
JX096952_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX079944_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707637_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707632_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707631_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707630_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707629_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707628_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707627_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707626_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707625_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707624_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707623_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707622_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707621_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707620_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707619_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707618_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707617_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707616_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707614_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707613_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707612_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707611_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707610_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707609_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707607_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707601_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707594_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707573_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707572_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707571_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707570_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707569_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707568_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707567_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707566_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707565_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707564_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707563_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707562_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707561_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707560_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707559_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707558_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707557_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707556_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707555_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707554_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707553_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707552_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707551_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707550_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707549_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707548_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707547_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707546_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707545_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707544_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707543_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707542_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707541_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707540_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707539_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707538_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707537_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707536_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707535_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707534_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707533_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707532_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707531_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707420_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707419_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707418_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707417_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707416_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707415_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707414_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASTLYR
JQ707413_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707412_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707411_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707410_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707409_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707408_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707407_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707406_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707405_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707404_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707403_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707402_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707401_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707400_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707399_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707398_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707397_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707395_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707394_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707393_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707392_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707391_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707390_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707389_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707387_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707386_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707385_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707384_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707383_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707381_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707380_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707379_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707378_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707377_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707376_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707375_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707374_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707373_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707372_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707371_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707344_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707343_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707342_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707340_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707338_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707336_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALHR
JQ707335_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707334_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707333_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707332_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707331_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707330_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707329_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707327_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707326_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707324_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707323_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707320_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707317_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707316_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707315_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSGFFPSVRDLLDTASALYR
JQ707313_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707311_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707310_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707309_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707308_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707307_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707306_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707305_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707304_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707303_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707302_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707301_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ687533_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ687529_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ038410_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ038390_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182333_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182331_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182330_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182328_HBe_P-A          SKLCPGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182327_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182326_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182324_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182323_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182322_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182321_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182320_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182319_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182318_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF440016_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439993_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439991_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439990_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439989_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439988_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439987_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439985_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELPS-FLPSDFFPSVRDLLDTASALYR
JF439983_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439982_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439979_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439977_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439976_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439975_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439974_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439971_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439970_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439968_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439966_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439965_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439964_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439961_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439960_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439959_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439957_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439956_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439955_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439954_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439952_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439951_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439950_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439948_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439947_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439946_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439945_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439943_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439868_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439867_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439866_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439865_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439864_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439861_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439860_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439858_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439857_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439856_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439854_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439853_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439852_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439850_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439849_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439848_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439847_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439846_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439845_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439844_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439843_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439842_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439841_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439840_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439839_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439838_HBe_P-A          SKLYLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439836_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439833_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439832_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439831_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439828_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439827_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439826_HBe_P-A          SKLCLGWLWGMDIDPYKEFGAAVELLS-FLPSDFFPSVRDLLDTASALYR
JF439825_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439824_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439823_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439822_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439820_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439819_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439778_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439777_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439775_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439773_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439772_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439771_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439770_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439769_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439768_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439766_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439765_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439764_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439763_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439762_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439761_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439760_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439759_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439758_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439757_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439756_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439755_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439754_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439753_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439752_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439734_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM535205_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM535200_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM214743_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM214726_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM214718_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU563562_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU563558_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU563557_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU563555_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU563554_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU563553_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU563548_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU563546_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477503_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477467_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477461_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ414522_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ331047_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ161813_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545836_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545831_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FM199980_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FM199979_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FM199978_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867994_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867985_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867961_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867960_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867947_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692601_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692591_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692590_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692588_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692585_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692584_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692583_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692582_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692581_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692580_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692579_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692578_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692574_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692571_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692563_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692557_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692554_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349224_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ349222_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859956_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859955_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859954_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859953_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859952_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859951_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859950_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859949_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859948_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859947_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859946_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859945_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859943_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859942_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859941_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859940_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859937_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859936_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859935_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859933_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859932_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859931_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859930_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859929_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859928_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859927_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859926_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859925_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859924_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859923_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859922_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859921_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859920_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859918_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859917_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859916_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859915_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859914_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859913_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859912_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859911_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859910_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859909_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859908_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859907_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859906_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859905_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859904_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859903_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859902_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859901_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859900_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859899_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859898_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594395_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594394_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594393_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594392_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594391_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594390_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594389_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594388_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594386_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594385_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU594383_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU410082_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU234069_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU185778_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512456_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSARDLLETASALFR
EU185776_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLXTASALYR
MH464814_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSXRDLLDTASALYR
EU185777_HBe_P-A          SKLCXGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSXRDLLXTASALYR
KP243536_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707581_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707582_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707583_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707584_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707585_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707586_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707587_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707588_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707589_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707590_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707591_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707592_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707597_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707598_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707599_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707602_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707603_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707604_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707606_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
JQ707608_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
KM606653_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVKDLLDTASALYR
AJ627226_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPPDFFPSARDLLDTASALFR
KM606647_HBe_P-A          SKLCLGWLWGMDIDHYKEFGATVELLS-FLPLDFFPSARDLLETASALYR
AY034878_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477476_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPTDFFPSVRDLLDTASALFR
AB937797_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSVKDLLDTASALYR
KF166160_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYR
KF166273_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYR
GQ184322_HBe_P-D          SKLCLGWLKDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALFR
KC999441_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTAQALFR
AF419536_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPHDFFPSVRDLLDTVSALYR
AB480034_HBe_P-A          SKLCLGWPWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116092_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTVAALFR
KP995108_HBe_P-A          SKLCLGWLWGMDIDTYKEFGATVELLS-FLPSDFYPSVRDLVDTASALYR
KT749833_HBe_P-A          SKLCLGWLWGMDIDTYKEFGATVELLS-FLPSDFFPSVRDLVDTASALHR
AB116088_HBe_P-A          SKLCLGWLWGMDIDLYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
JX154579_HBe_P-A          SKLCLGWLWGMDIDLYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX154580_HBe_P-A          SKLCLGWLWGMDIDLYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX154581_HBe_P-A          SKLCLGWLWGMDIDLYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX154582_HBe_P-A          SKLCLGWLWGMDIDLYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606650_HBe_P-A          SKLCLGWLWGMDIDLYKEFGATVELLS-FLPSDFFPAVRDLLDTASALYR
JF754629_HBe_P-D          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MT731823_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSIRDLLDTASALYR
KX276769_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALFR
KM606696_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATTELVS-FLPSDFFPNTRDLLDTASALYR
FJ692559_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY382513_HBe_P-A          CNLVPGCLWGMAIDPYKEFGATVELLS-FLPSDFLPSVRDLLDTASALYR
KF985206_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTASALYR
AM110831_HBe_P-A          SKLSLGWLWGMDIDPYKEFGATGELLS-FLPSDFFPSVRDLLDTASALFR
AB362931_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB246336_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATGELLS-FLPSDFFPSVRDLLDTASALYR
GU563550_HBe_P-A          SKLCLGWVWGMDIDPYKEFGATGELLS-FLPSDFFPSVRDLLDTASALYR
AY603429_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KX827298_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464825_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPPVRDLLGTAAALYR
AY090459_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB365446_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPNVRDLLDTASALYR
MN585097_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512465_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KR905429_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798271_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885485_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875251_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182325_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477463_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545840_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545830_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
FJ692592_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFYPSVRDLLDTASALYR
JQ023661_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ023660_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439829_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LC311242_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606695_HBe_P-A          YKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707339_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692567_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854687_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545835_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ810853_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ810852_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FM199975_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875256_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116078_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYQ
AF297623_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AJ309369_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU859944_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY509208_HBe_P-A          SKLCLGWLWGMDIDTYKEYGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AF297625_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB453989_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233285_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASAQYR
AB064314_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB076678_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116077_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116079_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116080_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116081_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116083_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116090_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116094_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB126580_HBe_P-A          SKLCLGWLWGMDIDPHKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB241114_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB241115_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB246335_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB246337_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB246338_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB300366_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB300367_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB453979_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB453980_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB453981_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB453984_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB480037_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB480038_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB480039_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB480041_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB480042_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB549213_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697488_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697489_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697491_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697492_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697493_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697495_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697496_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697497_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697499_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697501_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697503_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697504_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697505_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697506_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697507_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697508_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697509_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697512_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB775198_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB775199_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB775200_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB775201_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB937791_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB937792_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB937793_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB937794_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB937795_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB937796_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB937798_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF043560_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF043580_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF090839_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF090840_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF090841_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF090842_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF297624_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350080_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350081_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVPDLLDTASALYR
AF350082_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350083_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350084_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350085_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350087_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALNR
AF350088_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350089_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350090_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350091_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350092_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350093_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350094_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350095_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350096_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350097_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF350098_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AJ012207_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AJ309370_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AJ309371_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110796_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110799_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110802_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110836_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110837_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110840_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110841_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110842_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110843_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110844_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110845_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110846_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM184125_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM184126_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM282986_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM295795_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM295796_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM295797_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM410963_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM494718_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY128092_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY161138_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY161139_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233274_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233276_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233278_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233280_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233281_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233282_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233283_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233284_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233286_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233288_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233289_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY373428_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY373432_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY382505_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603430_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603431_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603435_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603436_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603438_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY603446_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY707087_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY902775_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY903452_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934763_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934764_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934765_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934766_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934767_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934768_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934769_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934770_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934771_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934773_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY934774_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ020002_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ020003_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ315786_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU054331_HBe_C-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU086721_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU185746_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU185748_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU185750_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF289978_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF289980_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110839_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692566_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
MK512471_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAGALYR
KP168426_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTALALYR
LC279273_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279272_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279271_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279270_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279269_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
LC279268_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KP659247_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KP659237_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KP659235_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB287315_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB287314_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB246342_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB246341_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB205121_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB073848_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB073846_HBe_P-B          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KC885114_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAXALYR
AB010289_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KX357649_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPRDFYPSVRDLIDTASALFR
AJ627228_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTASALYR
KP857061_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTASALYR
AM110800_HBe_P-A          SKLCLGWLWDMDIDPYKEFGAXVELLS-FLPHDFFPSVRDLLDTASALYR
AM110801_HBe_P-A          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPHDFFPSVRDLLDTASALYR
FJ692555_HBe_P-A          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPHDFFPSVRDLLDTASXLYR
AF419535_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTVSALYR
FJ692575_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477496_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116091_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTATALYR
GQ331046_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALFR
KT749832_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELIS-FLPADFFPSVRDLLDTASALFR
AB194952_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTSAALYR
HM363612_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTSAALYR
HM363613_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTSAALYR
EF103278_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439869_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439870_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439871_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439872_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439873_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439874_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439875_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439876_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439877_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439878_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439879_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439880_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439881_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439882_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439883_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116084_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF772348_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
AB222708_HBe_P-RF-AD      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU185765_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTASALYR
GQ477472_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPGVRDLLDTASALYR
FM199977_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALQR
AJ344115_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU185775_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU185787_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU185789_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF214656_HBe_P-RF-AC      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ331048_HBe_P-RF-AE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857063_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF214657_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692597_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSVRDLLDTASALFX
EU304331_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPXDFFPSVRDLLDTASALYR
MG877723_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPXDFXPSVRDLLDTASALYR
MG877724_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPXDFXPSVRDLLDTASALYR
MG877725_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPXDFXPSVRDLLDTASALYR
MN544634_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JX847951_HBe_P-B          SKLCLGWLWDMDIDPYKEFGATTPLLS-FLPADFFPSVRDLLDTANALYG
KC885147_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASSSLLS-FLPSDFFPSIRDLLDTAAALFQ
JQ272888_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC999444_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELIS-FLPHDFFPSVRDLLDTASALYR
AB116550_HBe_P-F          SKLCLGWLWGMDIDPFKEFGASEELLS-FLPLDFFPNVRDLLDTASALYR
KJ647344_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSVRDLLDTISALYR
JF439767_HBe_P-A          SKLRLGWLWGMDIDPYKEFGATVELLS-VLPCDFFPSVPDLLHAASTWYQ
GQ477493_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSARDLLDTASALYR
KP857091_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSIRDLLDTASALYR
KC999449_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPHDFFPSAKDLLDTASALYR
MH725153_HBe_P-D          SKLGLGWLWGMDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYR
KF164957_HBe_P-B          SKLCLEWLWDMDIDPYKEFGASVELLS-FLPSDFFPSARDLLDTASALYR
GQ477473_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPLDFFPSARDLLDTASALYR
MT114173_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPAVRDLLDTASALFR
MN310710_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB042285_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPAVRDLLDTASALYL
MT731888_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELVS-FLPHDFYPSVRDLLDTASALYR
MT731829_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTASSLYR
GQ477480_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASTELLS-FLPSDFFPNVRDLLDTASALYR
AB076679_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AF419539_HBe_P-D          SKLCLGWLWVMDVDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU563547_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATTDLLS-FLPSDFFPSVRDLRDTTSALYR
AB246317_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
DQ486023_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857072_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSARDLLDTASALFR
KP857068_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP857066_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVKDLYDTALALHR
GQ477474_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELIS-FLPSDFFPSVRDLLDTASALYR
GQ477469_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPLDFFPSVRDLLDTASALYR
AB116086_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATADLLS-FLPSDFFPSVQDLLDTASALYR
KP995114_HBe_P-F          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPTDFFPSVRDLLDTASALHR
KP995097_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSARDLFDTASALYR
KC494399_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFYPSVRDLIDTASALYR
AM494791_HBe_P-E          SKLCLGWLWGMDIDPHKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM011474_HBe_P-B          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP857075_HBe_P-A          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP857073_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFYPSVRDLLDTATALYR
GQ477500_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVKDLLDTASALYR
AY161142_HBe_P-A          SKLCLGWLWGMDIDPYKEYGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY161143_HBe_P-A          SKLCLGWLWGMDIDPYKEYGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY161144_HBe_P-A          SKLCLGWLWGMDIDPYKEYGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB059659_HBe_P-H          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFYPSVRDLLDTASALHR
MT731902_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVDLIS-FLPADFFPSVRDLLDTASALYR
KF922414_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922415_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922416_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922418_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922419_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922420_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF922421_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477502_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPNVRDLLDTASALYR
FJ692587_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPNDFFPSVRDLLDTAAALYR
AF289938_HBe_P-E          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB246343_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KM606649_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KF985212_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPHDFFPSVRDLLDTASALYR
KC999457_HBe_P-A          SKLCLGWLWDMDIDLYKEFGATVELLS-FLPSDFFPSARDLLDTASALYR
GQ477487_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFYPSVRDLLDTASALYR
GQ477486_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTAAALFR
KC494396_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JN792918_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
EU185743_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB014394_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MT731877_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK512474_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857078_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSTKDLLDTASALYR
KF985210_HBe_P-A          SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFFPSVRDLLDTALALYR
KF922430_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTALALYR
JF439830_HBe_P-A          SKLCLGWLWGMDVDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439720_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439721_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELPS-FLPSDFFPSVRDLLDTASALYR
JF439722_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439723_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439725_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439726_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439727_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439728_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439730_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439731_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439732_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439733_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439735_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439736_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439737_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439741_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439742_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439743_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439746_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439747_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439896_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439897_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439898_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439899_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439900_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439901_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439902_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439903_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439904_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439905_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439906_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439907_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439909_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439910_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477488_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
GQ477475_HBe_P-A          SKLCLRWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALFR
GQ477462_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPHDFYPSVRDLLDTASALYR
FM199974_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692604_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
FJ692602_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALHR
FJ692599_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692570_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
EU414050_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
EU185786_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPNDFFPSVRDLLDTASALYR
AY233290_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110838_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF419534_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTVSALYR
AB453986_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB194951_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116076_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVQLLS-FLPSDFFPSVRDLLDTASALYQ
KF922429_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTALALYR
KF922431_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTALALYR
KF985211_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTALALYR
AM110814_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
AM110829_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
AB116093_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB453987_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB697511_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF297622_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF537371_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110798_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110832_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110833_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY152726_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233275_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY382506_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY738139_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY738140_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY738141_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY738142_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY738143_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ788725_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545832_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALFR
FN545839_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPXDFFPSVRDLLDTASALYR
AB674429_HBe_P-D          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ023677_HBe_P-C          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB900112_HBe_P-B          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPQDFYPSVRDLLDTASALYR
Z68141_HBe_P-A            SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464817_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATXELLS-FLPPDFFPSVRDLLDTASALYR
MF925362_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPNVRDLLDTASALFR
KM606679_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATTELLS-FLPSDFFPSVRDLLDTASALYR
KJ854685_HBe_P-A          SKLCLGWLWGMAIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439748_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439740_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ921978_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477501_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTASALYR
GQ477479_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADYYPSVRDLLDTASALYR
GQ477478_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDYYPSVRDLLDTASALYR
GQ477466_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545838_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
FN545826_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELIS-FLPSDFFPSVRDLLDTASALYR
FJ692603_HBe_P-A          SKLCLGWLWGMDIDHYKEFGAXVELLS-FLPSDFYPSVRDLLDTATALYR
FJ692593_HBe_P-A          SKLCLGWLWGMDIDLYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
AY233287_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY233279_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM110834_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVDLLS-FLPXDFFPSVRDLLETARALYR
AB116082_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB453988_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
DQ315784_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM627320_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MT114169_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYR
MH725189_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYR
MF488704_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
JN664922_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MW567976_HBe_P-A          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MT731914_HBe_P-A          SKLCLGWLWGMDIDHYKEFGASVELIS-FLPLDFFPSVRDLLDTASALYR
MT114170_HBe_P-A          SKLCLGWLWGMDIDHYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
MK512475_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
MK512464_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF772346_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATTELLS-FLPSDFFPSVRDLLDTASALYR
KX357644_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATTELLS-FLPSDFFPSVRDLLDTASALYR
KT151612_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATSELLS-FLPSDFFPSVRDLLDTASALYR
KT151617_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATSELLS-FLPSDFFPSVRDLLDTASALYR
KP857070_HBe_P-A          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP857067_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLDTASALYR
KM606737_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
KM606688_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATAELLS-FLPSDFFPSVRDLLDTASALYR
KJ854701_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPTARDLLDTASALYR
KJ586809_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVKDLLNTASALYR
KF214660_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLQDTASALYR
KC885161_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTASALYR
KC875255_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439973_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDSFPSVRDLLDTASALYR
JF439738_HBe_P-A          SKLCLGWLWGMDIDPYREFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477491_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVDLLS-FLPSDFFPSVRDLLDTASALYR
GQ477482_HBe_P-A          SKLCLGWLWGMDIDHYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477465_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ184324_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATLELLS-FLPSDFFPSVRDLLDTASALYR
AM110797_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AY254498_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB073851_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFYPSVRDLLDTAAALYR
MT731908_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512476_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KR905427_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857065_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFYPSVRDLLDTASALYR
KP243589_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243324_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP168428_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP168425_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854703_HBe_P-A          SKLCLGWLWGMDFDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875260_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ222208_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692600_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDYYPSVRDLLDTASALYR
EU366129_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALFR
AF537372_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB453982_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB194950_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB116087_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AB194949_HBe_P-RF-AE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512462_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857080_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FM199976_HBe_P-A          SKLCLGWLXGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545825_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692561_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPXDFFPSVRDLLDTASALYR
FJ692573_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPADFFPSVRDLLDTASALYR
AY382484_HBe_P-E          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725210_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH725201_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
Z35717_HBe_P-A            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X02763_HBe_C-A            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT731919_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPAVRDLLDTASALYR
MT731833_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPTDFFPSVRDLLDTASALHR
MK512458_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925368_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KX357640_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KT151615_HBe_P-A          SKLCLGWLWGMDIDHYKEFGATVELLS-FLPXDFFPSVRDLLDTASALYR
KP857071_HBe_P-A          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KM606668_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELIS-FLPSDFFPSVRDLLDTASALYR
KF214661_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875259_HBe_P-A          SKLCLGWLWGMDIDPYQEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC875257_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC875253_HBe_P-A          SKLCLGWLWGMDVDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707359_HBe_P-A          FKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182334_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JN182332_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439986_HBe_P-A          SKLCLGWLWGMDIDPYIEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439944_HBe_P-A          SKLCLGWLWGMDMDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477497_HBe_P-A          SKLCLRWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ904434_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPRDFFPSVRDLLDTASALYR
LT992442_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
KP659234_HBe_P-B          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
AB073850_HBe_P-B          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTAAALYR
MT731898_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925373_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MF925372_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LK995385_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KY382410_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KT366467_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KR905426_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857062_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
KP857059_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243595_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243580_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243530_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELIS-FLPSDFFPSVRDLLDTASALYR
KP243336_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP243258_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP168429_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLXSDFFPSVRDLLDTXSALYR
KM606673_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606661_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KM606658_HBe_P-A          SKLCLGWLWGMDIDHYKEFGASVELLS-FLPSDFYPSVRDLLDTASALYR
KJ854691_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854686_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ843172_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985208_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985205_HBe_P-A          SKLCLGWLWGMDIDLYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985204_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF985197_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798291_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798267_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF798266_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779381_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779365_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779351_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779252_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF779249_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF214666_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KF214662_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885521_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885452_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885418_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885412_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885364_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885361_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885206_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885141_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KC885128_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707681_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707676_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707675_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707674_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707672_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707670_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707669_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707667_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707665_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707664_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707663_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707662_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707661_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707659_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707658_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707370_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707369_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707368_HBe_P-A          SKLCLGWLWGMDIDPSKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707367_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707366_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707365_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707364_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707363_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707362_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707361_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707360_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707358_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707357_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707356_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707355_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707354_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707353_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707352_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707351_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707350_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707349_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707348_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707347_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707346_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707345_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELVS-FLPSDFFPSVRDLLDTASALYR
JQ707337_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707325_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707322_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707321_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707319_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707318_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707314_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707312_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707300_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JQ707299_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
JF439750_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HE576989_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477504_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
GQ477498_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
GQ477484_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
GQ184323_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FN545833_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
FJ868002_HBe_P-A          SKLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867986_HBe_P-A          SKLCLGWLWDMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867958_HBe_P-A          SKLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867949_HBe_P-A          SKLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867948_HBe_P-A          SKLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ867946_HBe_P-A          SKLCLGWLWGMDIDRYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AM180624_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALFR
KJ810893_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692605_HBe_P-A          SKLCLGWLWGMDIDXYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692612_HBe_P-A          SKLCLGWLWGMDIDXYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM146131_HBe_P-RF-AD      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
X70185_HBe_P-A            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT731865_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATXELLS-FLPSDFFPSVRDLLDTASALYR
MK512463_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512461_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KP857079_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
GQ477468_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692577_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
KJ854700_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
AF297620_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
LT992444_HBe_P-D          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
Z72478_HBe_P-A            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X51970_HBe_P-A            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
X07911_HBe_P-A            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
V00866_HBe_P-A            SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MW567975_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT731929_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT731899_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT731868_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT731863_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT731813_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT622525_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448637_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448636_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448635_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448634_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448633_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448632_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448629_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448627_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448626_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448625_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448624_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448623_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448622_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT448620_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MT210032_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN585096_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN507849_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN476102_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN476101_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MN053840_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512473_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512472_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK512470_HBe_P-A          SKLCLGWLWDMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512469_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512468_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512467_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512466_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512460_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512459_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MK512457_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH932713_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580643_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580642_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580639_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH580627_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH555885_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH555884_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464830_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464828_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464818_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464815_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464813_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464810_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
MH464808_HBe_P-A          SKLCLGWLWGMDIDPYKKFGAXVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692598_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
GU827640_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MF536836_HBe_P-A          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPTDFFPSVRDLLHTASALYR
KU668280_HBe_P-C          SKLCLGWLWGMDIDPYKELGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK052963_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052966_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052971_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052974_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052969_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
FJ904425_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGATVQLLS-FLPSDFYPSVRDLLDTASALYR
AB453985_HBe_P-RF-AC      SKLCLGWLWGMDIDPYKEFGASVELIS-FLPPDFFPSIRDLLDTASALYR
FJ904409_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLS-FLPHDFFPSVRDLLDTATALFR
MG098574_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KP995113_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPPDFFPSVRDLIDTASALYR
KX357628_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVQLLS-FLPADFFPSVRDLLDTASALYR
KP995115_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ586805_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ586803_HBe_P-RF-AF      SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KJ647351_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVELLS-FLPTDFYPSVRDLLDTASALYR
JN792919_HBe_P-F          SKLCLGWLWDMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MG098583_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
MK052973_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
MK052975_HBe_P-D          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYR
KY762270_HBe_P-H          SKLCLGWLWGMDIDPYKELGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762267_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762276_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSARDLLDTATALYR
KY762279_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSARDLLDTATALYR
KY762268_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762269_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762271_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762272_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762274_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762281_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762284_HBe_P-H          SKLCLGWLWNMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762285_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762280_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPVDFFPSVRDLLDTATALYR
KY762275_HBe_P-H          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPADFFPSVRDLLDTASALYR
JN792916_HBe_P-F          SKLCLGWLWDMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
EU185742_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
DQ823087_HBe_P-F          SKLCLGCLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692606_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
FJ692608_HBe_P-A          SKLCLGWLWGMDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYR
HM585194_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
HM622135_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
JN792914_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYR
KJ638660_HBe_P-F          SKLCLGWLXGMDIDPYKEFGASLELLS-FLPXDFFPSXRDLIDTASALYR
KJ586808_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC494400_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
KC494394_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
JX899376_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASAELLS-FLPPDFFPSVRDLLDTASALYR
AB036905_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB036906_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB036907_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB036908_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB036909_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB036910_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB036911_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB036912_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB036913_HBe_P-F          SKLCLGWLWGMDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYR
AB0369