HBVdb

Dataset for protein HBe of genotype RF

[Download (right click)] [Alignment] [Repertoires]

1007 sequence(s)

>gnl|hbvpro|AB014375_HBe_P-RF-CB Product feature CHAIN AB014375_HBe_P-RF-CB of FT:mat_peptide AB014375_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 16T01HCC). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
WVGSNLEDPASREAVVSYVNVNMGLKLRQILWFHVSCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|AB031265_HBe_P-RF-CB Product feature CHAIN AB031265_HBe_P-RF-CB of FT:mat_peptide AB031265_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV VietF-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB033557_HBe_P-RF-CB Product feature CHAIN AB033557_HBe_P-RF-CB of FT:mat_peptide AB033557_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate IWK146). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB033559_HBe_P-RF-DE Product feature CHAIN AB033559_HBe_P-RF-DE of FT:mat_peptide AB033559_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate PYW310). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB048702_HBe_P-RF-DE Product feature CHAIN AB048702_HBe_P-RF-DE of FT:mat_peptide AB048702_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB105172_HBe_P-RF-CB Product feature CHAIN AB105172_HBe_P-RF-CB of FT:mat_peptide AB105172_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hawaii 2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB194949_HBe_P-RF-AE Product feature CHAIN AB194949_HBe_P-RF-AE of FT:mat_peptide AB194949_HBe_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate CMR151). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQATLCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB195939_HBe_P-RF-CB Product feature CHAIN AB195939_HBe_P-RF-CB of FT:mat_peptide AB195939_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB195940_HBe_P-RF-CB Product feature CHAIN AB195940_HBe_P-RF-CB of FT:mat_peptide AB195940_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB195941_HBe_P-RF-CB Product feature CHAIN AB195941_HBe_P-RF-CB of FT:mat_peptide AB195941_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB195950_HBe_P-RF-CB Product feature CHAIN AB195950_HBe_P-RF-CB of FT:mat_peptide AB195950_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB195951_HBe_P-RF-CB Product feature CHAIN AB195951_HBe_P-RF-CB of FT:mat_peptide AB195951_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB195955_HBe_P-RF-CB Product feature CHAIN AB195955_HBe_P-RF-CB of FT:mat_peptide AB195955_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB195956_HBe_P-RF-CB Product feature CHAIN AB195956_HBe_P-RF-CB of FT:mat_peptide AB195956_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB195957_HBe_P-RF-CB Product feature CHAIN AB195957_HBe_P-RF-CB of FT:mat_peptide AB195957_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB198084_HBe_P-RF-CB Product feature CHAIN AB198084_HBe_P-RF-CB of FT:mat_peptide AB198084_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFMPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB222708_HBe_P-RF-AD Product feature CHAIN AB222708_HBe_P-RF-AD of FT:mat_peptide AB222708_HBe_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate UZBV74). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHTSCITFGRDTVLEYLVSFGVW
>gnl|hbvpro|AB241109_HBe_P-RF-CB Product feature CHAIN AB241109_HBe_P-RF-CB of FT:mat_peptide AB241109_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate PhCH24). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB330368_HBe_P-RF-DA Product feature CHAIN AB330368_HBe_P-RF-DA of FT:mat_peptide AB330368_HBe_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate TAJ54HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB367393_HBe_P-RF-CB Product feature CHAIN AB367393_HBe_P-RF-CB of FT:mat_peptide AB367393_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate LAMr Pt. 2/Adefovir-treated Pt. 2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDQASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB367400_HBe_P-RF-CB Product feature CHAIN AB367400_HBe_P-RF-CB of FT:mat_peptide AB367400_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate LAMr Pt. 9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB367419_HBe_P-RF-CB Product feature CHAIN AB367419_HBe_P-RF-CB of FT:mat_peptide AB367419_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate LAMr Pt. 28). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCTPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHLSCLMFGRETVLEYLVSFGVW
>gnl|hbvpro|AB367800_HBe_P-RF-CB Product feature CHAIN AB367800_HBe_P-RF-CB of FT:mat_peptide AB367800_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ADVT Pt. 24). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
WVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB453985_HBe_P-RF-AC Product feature CHAIN AB453985_HBe_P-RF-AC of FT:mat_peptide AB453985_HBe_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate JPN_CH7). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELISFLPPDFFPSIRDLLDTASALYREALESSEHCSAHHTALRQAILCWGELMTLAN
WVGNNLQDPASRDLVVNYVNTNMGLKLRQILWFHVSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB493837_HBe_P-RF-CB Product feature CHAIN AB493837_HBe_P-RF-CB of FT:mat_peptide AB493837_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 03UC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB493838_HBe_P-RF-CB Product feature CHAIN AB493838_HBe_P-RF-CB of FT:mat_peptide AB493838_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 06UC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLGFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB493840_HBe_P-RF-CB Product feature CHAIN AB493840_HBe_P-RF-CB of FT:mat_peptide AB493840_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 16UC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB493842_HBe_P-RF-CB Product feature CHAIN AB493842_HBe_P-RF-CB of FT:mat_peptide AB493842_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 31UC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB493847_HBe_P-RF-CB Product feature CHAIN AB493847_HBe_P-RF-CB of FT:mat_peptide AB493847_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 05UC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB583679_HBe_P-RF-DE Product feature CHAIN AB583679_HBe_P-RF-DE of FT:mat_peptide AB583679_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Pkst8134). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AB670303_HBe_P-RF-CB Product feature CHAIN AB670303_HBe_P-RF-CB of FT:mat_peptide AB670303_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Non-HCC pt No.30). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVXYXNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB674434_HBe_P-RF-DE Product feature CHAIN AB674434_HBe_P-RF-DE of FT:mat_peptide AB674434_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GaziantepHCCC4). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTHMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AB674504_HBe_P-RF-DC Product feature CHAIN AB674504_HBe_P-RF-DC of FT:mat_peptide AB674504_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 11B18). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF297619_HBe_P-RF-DA Product feature CHAIN AF297619_HBe_P-RF-DA of FT:mat_peptide AF297619_HBe_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate 41). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF297620_HBe_P-RF-DA Product feature CHAIN AF297620_HBe_P-RF-DA of FT:mat_peptide AF297620_HBe_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate 57). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AF461361_HBe_P-RF-CB Product feature CHAIN AF461361_HBe_P-RF-CB of FT:mat_peptide AF461361_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate FH3Q). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRHAILCWGELMNLAT
WVGSNLEDQASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AJ344117_HBe_P-RF-DE Product feature CHAIN AJ344117_HBe_P-RF-DE of FT:mat_peptide AJ344117_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AM494716_HBe_P-RF-DE Product feature CHAIN AM494716_HBe_P-RF-DE of FT:mat_peptide AM494716_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate CAR175). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AP011102_HBe_P-RF-CB Product feature CHAIN AP011102_HBe_P-RF-CB of FT:mat_peptide AP011102_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AP011103_HBe_P-RF-CB Product feature CHAIN AP011103_HBe_P-RF-CB of FT:mat_peptide AP011103_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AP011104_HBe_P-RF-CB Product feature CHAIN AP011104_HBe_P-RF-CB of FT:mat_peptide AP011104_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AP011105_HBe_P-RF-CB Product feature CHAIN AP011105_HBe_P-RF-CB of FT:mat_peptide AP011105_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AP011108_HBe_P-RF-CB Product feature CHAIN AP011108_HBe_P-RF-CB of FT:mat_peptide AP011108_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY040627_HBe_P-RF-CB Product feature CHAIN AY040627_HBe_P-RF-CB of FT:mat_peptide AY040627_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY057948_HBe_P-RF-DC Product feature CHAIN AY057948_HBe_P-RF-DC of FT:mat_peptide AY057948_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet127). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVEVLSFLPSDFFPSNRDLLDTASALDREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY123424_HBe_P-RF-CB Product feature CHAIN AY123424_HBe_P-RF-CB of FT:mat_peptide AY123424_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNPAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY161140_HBe_P-RF-AD Product feature CHAIN AY161140_HBe_P-RF-AD of FT:mat_peptide AY161140_HBe_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPHKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY161141_HBe_P-RF-AD Product feature CHAIN AY161141_HBe_P-RF-AD of FT:mat_peptide AY161141_HBe_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPHKEIGATVELLSFLPSDFFPSARDLLDTASALYREGLESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY161145_HBe_P-RF-AD Product feature CHAIN AY161145_HBe_P-RF-AD of FT:mat_peptide AY161145_HBe_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY161146_HBe_P-RF-AD Product feature CHAIN AY161146_HBe_P-RF-AD of FT:mat_peptide AY161146_HBe_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY161147_HBe_P-RF-DA Product feature CHAIN AY161147_HBe_P-RF-DA of FT:mat_peptide AY161147_HBe_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA. Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSDRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY167095_HBe_P-RF-CB Product feature CHAIN AY167095_HBe_P-RF-CB of FT:mat_peptide AY167095_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate IIc). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY206374_HBe_P-RF-CB Product feature CHAIN AY206374_HBe_P-RF-CB of FT:mat_peptide AY206374_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRDTVIEYLVSFGVW
>gnl|hbvpro|AY233277_HBe_P-RF-AC Product feature CHAIN AY233277_HBe_P-RF-AC of FT:mat_peptide AY233277_HBe_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate 1848). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY233293_HBe_P-RF-DE Product feature CHAIN AY233293_HBe_P-RF-DE of FT:mat_peptide AY233293_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY233295_HBe_P-RF-DE Product feature CHAIN AY233295_HBe_P-RF-DE of FT:mat_peptide AY233295_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRRAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY236161_HBe_P-RF-DA Product feature CHAIN AY236161_HBe_P-RF-DA of FT:mat_peptide AY236161_HBe_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate 12A). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY247030_HBe_P-RF-CB Product feature CHAIN AY247030_HBe_P-RF-CB of FT:mat_peptide AY247030_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate KUHB81). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY373430_HBe_P-RF-DE Product feature CHAIN AY373430_HBe_P-RF-DE of FT:mat_peptide AY373430_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|AY800249_HBe_P-RF-DC Product feature CHAIN AY800249_HBe_P-RF-DC of FT:mat_peptide AY800249_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY817510_HBe_P-RF-DC Product feature CHAIN AY817510_HBe_P-RF-DC of FT:mat_peptide AY817510_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L45). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY817511_HBe_P-RF-DC Product feature CHAIN AY817511_HBe_P-RF-DC of FT:mat_peptide AY817511_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L49). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY817512_HBe_P-RF-DC Product feature CHAIN AY817512_HBe_P-RF-DC of FT:mat_peptide AY817512_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L53). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY817513_HBe_P-RF-DC Product feature CHAIN AY817513_HBe_P-RF-DC of FT:mat_peptide AY817513_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L66). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY817515_HBe_P-RF-DC Product feature CHAIN AY817515_HBe_P-RF-DC of FT:mat_peptide AY817515_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-L80). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY862864_HBe_P-RF-DC Product feature CHAIN AY862864_HBe_P-RF-DC of FT:mat_peptide AY862864_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate H3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRKTVLEYLVSFGVW
>gnl|hbvpro|AY862865_HBe_P-RF-DC Product feature CHAIN AY862865_HBe_P-RF-DC of FT:mat_peptide AY862865_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate H3-2nd). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|AY862866_HBe_P-RF-DC Product feature CHAIN AY862866_HBe_P-RF-DC of FT:mat_peptide AY862866_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate H3-2nd). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ111987_HBe_P-RF-DE Product feature CHAIN DQ111987_HBe_P-RF-DE of FT:mat_peptide DQ111987_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MMU36). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ144601_HBe_P-RF-BC Product feature CHAIN DQ144601_HBe_P-RF-BC of FT:mat_peptide DQ144601_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate Cq5-11). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ315777_HBe_P-RF-DE Product feature CHAIN DQ315777_HBe_P-RF-DE of FT:mat_peptide DQ315777_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EI03194). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ315779_HBe_P-RF-DE Product feature CHAIN DQ315779_HBe_P-RF-DE of FT:mat_peptide DQ315779_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EI0399). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ315780_HBe_P-RF-DE Product feature CHAIN DQ315780_HBe_P-RF-DE of FT:mat_peptide DQ315780_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EI02456). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESSEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ464167_HBe_P-RF-DE Product feature CHAIN DQ464167_HBe_P-RF-DE of FT:mat_peptide DQ464167_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate LT7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDQASRDLIVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|DQ478886_HBe_P-RF-DC Product feature CHAIN DQ478886_HBe_P-RF-DC of FT:mat_peptide DQ478886_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ478887_HBe_P-RF-DC Product feature CHAIN DQ478887_HBe_P-RF-DC of FT:mat_peptide DQ478887_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ478889_HBe_P-RF-DC Product feature CHAIN DQ478889_HBe_P-RF-DC of FT:mat_peptide DQ478889_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ478890_HBe_P-RF-DC Product feature CHAIN DQ478890_HBe_P-RF-DC of FT:mat_peptide DQ478890_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH18). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ478892_HBe_P-RF-DC Product feature CHAIN DQ478892_HBe_P-RF-DC of FT:mat_peptide DQ478892_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH28). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ478897_HBe_P-RF-DC Product feature CHAIN DQ478897_HBe_P-RF-DC of FT:mat_peptide DQ478897_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH37). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|DQ478898_HBe_P-RF-DC Product feature CHAIN DQ478898_HBe_P-RF-DC of FT:mat_peptide DQ478898_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate CHN-QH38). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EF103282_HBe_P-RF-AD Product feature CHAIN EF103282_HBe_P-RF-AD of FT:mat_peptide EF103282_HBe_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate Ran103). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EF103285_HBe_P-RF-DE Product feature CHAIN EF103285_HBe_P-RF-DE of FT:mat_peptide EF103285_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ran128). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EF494376_HBe_P-RF-CA Product feature CHAIN EF494376_HBe_P-RF-CA of FT:mat_peptide EF494376_HBe_P-RF-CA of [Viruses] Hepatitis B Virus recombinant form CA (isolate TW706). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHRSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVR
>gnl|hbvpro|EF494378_HBe_P-RF-CA Product feature CHAIN EF494378_HBe_P-RF-CA of FT:mat_peptide EF494378_HBe_P-RF-CA of [Viruses] Hepatitis B Virus recombinant form CA (isolate TW1244). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVQLLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQTILCWGELVNLAT
WVGSNLDDPASRELVVGYVNGNMGLKIRHLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU185780_HBe_P-RF-AD Product feature CHAIN EU185780_HBe_P-RF-AD of FT:mat_peptide EU185780_HBe_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate H-IDU7 (Rec.Arg-1)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU522070_HBe_P-RF-CB Product feature CHAIN EU522070_HBe_P-RF-CB of FT:mat_peptide EU522070_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient 7N). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU589339_HBe_P-RF-CB Product feature CHAIN EU589339_HBe_P-RF-CB of FT:mat_peptide EU589339_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S1556-11). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDINTYKEFGASVELLSFLPSDFFPSIRDLLDTATALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASGELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU594406_HBe_P-RF-DE Product feature CHAIN EU594406_HBe_P-RF-DE of FT:mat_peptide EU594406_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU594435_HBe_P-RF-DE Product feature CHAIN EU594435_HBe_P-RF-DE of FT:mat_peptide EU594435_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU594436_HBe_P-RF-DE Product feature CHAIN EU594436_HBe_P-RF-DE of FT:mat_peptide EU594436_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|EU787434_HBe_P-RF-DC Product feature CHAIN EU787434_HBe_P-RF-DC of FT:mat_peptide EU787434_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 92). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU787435_HBe_P-RF-DC Product feature CHAIN EU787435_HBe_P-RF-DC of FT:mat_peptide EU787435_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 114). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHVSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU833891_HBe_P-RF-GC Product feature CHAIN EU833891_HBe_P-RF-GC of FT:mat_peptide EU833891_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H4536/07). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFSPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLDDPGSRDLVVTYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU835240_HBe_P-RF-GC Product feature CHAIN EU835240_HBe_P-RF-GC of FT:mat_peptide EU835240_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate IND-DIB112). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871981_HBe_P-RF-CB Product feature CHAIN EU871981_HBe_P-RF-CB of FT:mat_peptide EU871981_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 318-95-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871983_HBe_P-RF-CB Product feature CHAIN EU871983_HBe_P-RF-CB of FT:mat_peptide EU871983_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 318-97-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871984_HBe_P-RF-CB Product feature CHAIN EU871984_HBe_P-RF-CB of FT:mat_peptide EU871984_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-00-1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871985_HBe_P-RF-CB Product feature CHAIN EU871985_HBe_P-RF-CB of FT:mat_peptide EU871985_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-00-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALCREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871986_HBe_P-RF-CB Product feature CHAIN EU871986_HBe_P-RF-CB of FT:mat_peptide EU871986_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871987_HBe_P-RF-CB Product feature CHAIN EU871987_HBe_P-RF-CB of FT:mat_peptide EU871987_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-01-1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871988_HBe_P-RF-CB Product feature CHAIN EU871988_HBe_P-RF-CB of FT:mat_peptide EU871988_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-01-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871989_HBe_P-RF-CB Product feature CHAIN EU871989_HBe_P-RF-CB of FT:mat_peptide EU871989_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-03-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871990_HBe_P-RF-CB Product feature CHAIN EU871990_HBe_P-RF-CB of FT:mat_peptide EU871990_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-04-1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871992_HBe_P-RF-CB Product feature CHAIN EU871992_HBe_P-RF-CB of FT:mat_peptide EU871992_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-99-1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871993_HBe_P-RF-CB Product feature CHAIN EU871993_HBe_P-RF-CB of FT:mat_peptide EU871993_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-99-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871995_HBe_P-RF-CB Product feature CHAIN EU871995_HBe_P-RF-CB of FT:mat_peptide EU871995_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490A-4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871996_HBe_P-RF-CB Product feature CHAIN EU871996_HBe_P-RF-CB of FT:mat_peptide EU871996_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490A-6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871997_HBe_P-RF-CB Product feature CHAIN EU871997_HBe_P-RF-CB of FT:mat_peptide EU871997_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 530-00-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVASNLEGPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU871999_HBe_P-RF-CB Product feature CHAIN EU871999_HBe_P-RF-CB of FT:mat_peptide EU871999_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 530-00-7). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU872014_HBe_P-RF-CB Product feature CHAIN EU872014_HBe_P-RF-CB of FT:mat_peptide EU872014_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-96-3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU872015_HBe_P-RF-CB Product feature CHAIN EU872015_HBe_P-RF-CB of FT:mat_peptide EU872015_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 490-96-1). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU881995_HBe_P-RF-CB Product feature CHAIN EU881995_HBe_P-RF-CB of FT:mat_peptide EU881995_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient17). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU882006_HBe_P-RF-CB Product feature CHAIN EU882006_HBe_P-RF-CB of FT:mat_peptide EU882006_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient22). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU916228_HBe_P-RF-CB Product feature CHAIN EU916228_HBe_P-RF-CB of FT:mat_peptide EU916228_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S7.3). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFFASDLFPSVRDLLDTATALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU916232_HBe_P-RF-CB Product feature CHAIN EU916232_HBe_P-RF-CB of FT:mat_peptide EU916232_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S8.3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGAW
>gnl|hbvpro|EU916239_HBe_P-RF-CB Product feature CHAIN EU916239_HBe_P-RF-CB of FT:mat_peptide EU916239_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SWT3.1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVDVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU916240_HBe_P-RF-CB Product feature CHAIN EU916240_HBe_P-RF-CB of FT:mat_peptide EU916240_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SWT3.2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFERETVLEYLVSFGVW
>gnl|hbvpro|EU916241_HBe_P-RF-CB Product feature CHAIN EU916241_HBe_P-RF-CB of FT:mat_peptide EU916241_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SWT3.3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVDVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU939565_HBe_P-RF-CB Product feature CHAIN EU939565_HBe_P-RF-CB of FT:mat_peptide EU939565_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C86). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIXCWGEXMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU939577_HBe_P-RF-CB Product feature CHAIN EU939577_HBe_P-RF-CB of FT:mat_peptide EU939577_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C116). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGKETVLEYLVSFGVW
>gnl|hbvpro|EU939581_HBe_P-RF-CB Product feature CHAIN EU939581_HBe_P-RF-CB of FT:mat_peptide EU939581_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate B16). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVNYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU939589_HBe_P-RF-CB Product feature CHAIN EU939589_HBe_P-RF-CB of FT:mat_peptide EU939589_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C175). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDVYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU939606_HBe_P-RF-CB Product feature CHAIN EU939606_HBe_P-RF-CB of FT:mat_peptide EU939606_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C206). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRKTVLEYLVSFGVW
>gnl|hbvpro|EU939623_HBe_P-RF-CB Product feature CHAIN EU939623_HBe_P-RF-CB of FT:mat_peptide EU939623_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C126). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTAIRQAIVCWGELMNLAT
WVGGNLDDPASRELIVNYVNVNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU939627_HBe_P-RF-BC Product feature CHAIN EU939627_HBe_P-RF-BC of FT:mat_peptide EU939627_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate C15). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|EU939629_HBe_P-RF-BC Product feature CHAIN EU939629_HBe_P-RF-BC of FT:mat_peptide EU939629_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate C95). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGTNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ023659_HBe_P-RF-BC Product feature CHAIN FJ023659_HBe_P-RF-BC of FT:mat_peptide FJ023659_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate I1_M04-0469). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAFLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ023664_HBe_P-RF-GC Product feature CHAIN FJ023664_HBe_P-RF-GC of FT:mat_peptide FJ023664_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-0026). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ023667_HBe_P-RF-GC Product feature CHAIN FJ023667_HBe_P-RF-GC of FT:mat_peptide FJ023667_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-2742). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ023670_HBe_P-RF-GC Product feature CHAIN FJ023670_HBe_P-RF-GC of FT:mat_peptide FJ023670_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-3724). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ023673_HBe_P-RF-GC Product feature CHAIN FJ023673_HBe_P-RF-GC of FT:mat_peptide FJ023673_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate I2_M04-4997). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ349241_HBe_P-RF-DC Product feature CHAIN FJ349241_HBe_P-RF-DC of FT:mat_peptide FJ349241_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate C115). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ386578_HBe_P-RF-CB Product feature CHAIN FJ386578_HBe_P-RF-CB of FT:mat_peptide FJ386578_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1748). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ386581_HBe_P-RF-CB Product feature CHAIN FJ386581_HBe_P-RF-CB of FT:mat_peptide FJ386581_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1764). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ386585_HBe_P-RF-CB Product feature CHAIN FJ386585_HBe_P-RF-CB of FT:mat_peptide FJ386585_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1800). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ386633_HBe_P-RF-CB Product feature CHAIN FJ386633_HBe_P-RF-CB of FT:mat_peptide FJ386633_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2372). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ386643_HBe_P-RF-CB Product feature CHAIN FJ386643_HBe_P-RF-CB of FT:mat_peptide FJ386643_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2493). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ386649_HBe_P-RF-CB Product feature CHAIN FJ386649_HBe_P-RF-CB of FT:mat_peptide FJ386649_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 2422). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ562229_HBe_P-RF-CB Product feature CHAIN FJ562229_HBe_P-RF-CB of FT:mat_peptide FJ562229_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I36). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ562263_HBe_P-RF-DC Product feature CHAIN FJ562263_HBe_P-RF-DC of FT:mat_peptide FJ562263_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I113). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRGTVLEYLVSFGVW
>gnl|hbvpro|FJ562278_HBe_P-RF-DC Product feature CHAIN FJ562278_HBe_P-RF-DC of FT:mat_peptide FJ562278_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ562287_HBe_P-RF-CB Product feature CHAIN FJ562287_HBe_P-RF-CB of FT:mat_peptide FJ562287_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I151). Complete genome. [Hepadnaviridae] (length=135 residues).
FKVCLGGLWGMGLDPYKEFGAFGELLFFLPFDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ562302_HBe_P-RF-CB Product feature CHAIN FJ562302_HBe_P-RF-CB of FT:mat_peptide FJ562302_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I186). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ562305_HBe_P-RF-CB Product feature CHAIN FJ562305_HBe_P-RF-CB of FT:mat_peptide FJ562305_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I191). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ562314_HBe_P-RF-CB Product feature CHAIN FJ562314_HBe_P-RF-CB of FT:mat_peptide FJ562314_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I206). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ562336_HBe_P-RF-CB Product feature CHAIN FJ562336_HBe_P-RF-CB of FT:mat_peptide FJ562336_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I115). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLVDTATALYREALESPEHCSPHHTALRQAIVCWGELTNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ692536_HBe_P-RF-DE Product feature CHAIN FJ692536_HBe_P-RF-DE of FT:mat_peptide FJ692536_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D4_50077). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ715345_HBe_P-RF-CB Product feature CHAIN FJ715345_HBe_P-RF-CB of FT:mat_peptide FJ715345_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVC21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAVRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ715346_HBe_P-RF-CB Product feature CHAIN FJ715346_HBe_P-RF-CB of FT:mat_peptide FJ715346_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVC22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAVRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ715347_HBe_P-RF-CB Product feature CHAIN FJ715347_HBe_P-RF-CB of FT:mat_peptide FJ715347_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVC23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAVRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ715384_HBe_P-RF-CB Product feature CHAIN FJ715384_HBe_P-RF-CB of FT:mat_peptide FJ715384_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVM51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ715385_HBe_P-RF-CB Product feature CHAIN FJ715385_HBe_P-RF-CB of FT:mat_peptide FJ715385_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVM52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ715387_HBe_P-RF-CB Product feature CHAIN FJ715387_HBe_P-RF-CB of FT:mat_peptide FJ715387_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVM54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWLHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ715411_HBe_P-RF-CB Product feature CHAIN FJ715411_HBe_P-RF-CB of FT:mat_peptide FJ715411_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVN51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ715412_HBe_P-RF-CB Product feature CHAIN FJ715412_HBe_P-RF-CB of FT:mat_peptide FJ715412_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVN52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ715413_HBe_P-RF-CB Product feature CHAIN FJ715413_HBe_P-RF-CB of FT:mat_peptide FJ715413_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVN53). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ715414_HBe_P-RF-CB Product feature CHAIN FJ715414_HBe_P-RF-CB of FT:mat_peptide FJ715414_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBVN54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ787446_HBe_P-RF-CB Product feature CHAIN FJ787446_HBe_P-RF-CB of FT:mat_peptide FJ787446_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S425-20). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ787480_HBe_P-RF-CB Product feature CHAIN FJ787480_HBe_P-RF-CB of FT:mat_peptide FJ787480_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S425-16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ882610_HBe_P-RF-GC Product feature CHAIN FJ882610_HBe_P-RF-GC of FT:mat_peptide FJ882610_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H2252/01). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ882611_HBe_P-RF-GC Product feature CHAIN FJ882611_HBe_P-RF-GC of FT:mat_peptide FJ882611_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H2072/03). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ882612_HBe_P-RF-GC Product feature CHAIN FJ882612_HBe_P-RF-GC of FT:mat_peptide FJ882612_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H1886/07). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLXDPGSRDLVVTYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ882613_HBe_P-RF-GC Product feature CHAIN FJ882613_HBe_P-RF-GC of FT:mat_peptide FJ882613_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H1357/05). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPSSRDLVVTYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ882614_HBe_P-RF-GC Product feature CHAIN FJ882614_HBe_P-RF-GC of FT:mat_peptide FJ882614_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H1099/02). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ882617_HBe_P-RF-GC Product feature CHAIN FJ882617_HBe_P-RF-GC of FT:mat_peptide FJ882617_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H0645/08). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPGSRDLVVTYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ882618_HBe_P-RF-GC Product feature CHAIN FJ882618_HBe_P-RF-GC of FT:mat_peptide FJ882618_HBe_P-RF-GC of [Viruses] Hepatitis B Virus recombinant form GC (isolate H0035/08). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPGSRDLVVTYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FJ904409_HBe_P-RF-DE Product feature CHAIN FJ904409_HBe_P-RF-DE of FT:mat_peptide FJ904409_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate A54a). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTATALFRDALESPEHCSPHHTALRQAILCWGDVMNIAT
WVGVNLQDQASRDQVVNYVNSNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FJ904425_HBe_P-RF-DE Product feature CHAIN FJ904425_HBe_P-RF-DE of FT:mat_peptide FJ904425_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=134 residues).
SKLCLGWLXGMDIDPYKEFGATVQLLSFLPSDFYPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGSNLDPVSRDLVVSYVNDNMGLKFRQILWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FJ904440_HBe_P-RF-DE Product feature CHAIN FJ904440_HBe_P-RF-DE of FT:mat_peptide FJ904440_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate B35). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLMFGRETVVEYLVSFGVW
>gnl|hbvpro|FN594767_HBe_P-RF-DE Product feature CHAIN FN594767_HBe_P-RF-DE of FT:mat_peptide FN594767_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate bne127). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGASVELLSFLPHDFFPSVKDLLDTASALYRDALESPEHCSPHHTALRQAIVCWGNIMTLAT
WVGVNLEDQASRDLLVSYVNTXMGLKFRQLLWFHISCLTFGRQIVIEYLVSFGVW
>gnl|hbvpro|FN594770_HBe_P-RF-DE Product feature CHAIN FN594770_HBe_P-RF-DE of FT:mat_peptide FN594770_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate bne367). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTAFRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FN594771_HBe_P-RF-DE Product feature CHAIN FN594771_HBe_P-RF-DE of FT:mat_peptide FN594771_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate bne442). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGEFTSHST
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|FR714490_HBe_P-RF-GB Product feature CHAIN FR714490_HBe_P-RF-GB of FT:mat_peptide FR714490_HBe_P-RF-GB of [Viruses] Hepatitis B Virus recombinant form GB (isolate DL706). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|FR714496_HBe_P-RF-CB Product feature CHAIN FR714496_HBe_P-RF-CB of FT:mat_peptide FR714496_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate QL523). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSILPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVRYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ161753_HBe_P-RF-AE Product feature CHAIN GQ161753_HBe_P-RF-AE of FT:mat_peptide GQ161753_HBe_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GH2537). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161754_HBe_P-RF-DE Product feature CHAIN GQ161754_HBe_P-RF-DE of FT:mat_peptide GQ161754_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate GH16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ161806_HBe_P-RF-EA Product feature CHAIN GQ161806_HBe_P-RF-EA of FT:mat_peptide GQ161806_HBe_P-RF-EA of [Viruses] Hepatitis B Virus recombinant form EA (isolate GU763). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ161837_HBe_P-RF-AE Product feature CHAIN GQ161837_HBe_P-RF-AE of FT:mat_peptide GQ161837_HBe_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GU1125). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSVLPFGFFPSVRDXLDTASXLYRDALESXEHCSPHHTALRQAILCWGELMTLAT
WVGINLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRXTVIEYLVSFGVW
>gnl|hbvpro|GQ161838_HBe_P-RF-AE Product feature CHAIN GQ161838_HBe_P-RF-AE of FT:mat_peptide GQ161838_HBe_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate GU1127). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDXLDTASXLYRDXLESXXHXSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ183486_HBe_P-RF-DE Product feature CHAIN GQ183486_HBe_P-RF-DE of FT:mat_peptide GQ183486_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MOD_4568). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ205377_HBe_P-RF-DE Product feature CHAIN GQ205377_HBe_P-RF-DE of FT:mat_peptide GQ205377_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate T1178). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDFLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ205378_HBe_P-RF-DE Product feature CHAIN GQ205378_HBe_P-RF-DE of FT:mat_peptide GQ205378_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate T1181). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTFAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ205379_HBe_P-RF-DE Product feature CHAIN GQ205379_HBe_P-RF-DE of FT:mat_peptide GQ205379_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate T1234). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ205387_HBe_P-RF-DE Product feature CHAIN GQ205387_HBe_P-RF-DE of FT:mat_peptide GQ205387_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate T1545). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ331048_HBe_P-RF-AE Product feature CHAIN GQ331048_HBe_P-RF-AE of FT:mat_peptide GQ331048_HBe_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate BV-201). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|GQ358155_HBe_P-RF-CB Product feature CHAIN GQ358155_HBe_P-RF-CB of FT:mat_peptide GQ358155_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J022). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ358156_HBe_P-RF-CB Product feature CHAIN GQ358156_HBe_P-RF-CB of FT:mat_peptide GQ358156_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate STN013). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377516_HBe_P-RF-CB Product feature CHAIN GQ377516_HBe_P-RF-CB of FT:mat_peptide GQ377516_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377520_HBe_P-RF-CB Product feature CHAIN GQ377520_HBe_P-RF-CB of FT:mat_peptide GQ377520_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J18). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377534_HBe_P-RF-CB Product feature CHAIN GQ377534_HBe_P-RF-CB of FT:mat_peptide GQ377534_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J41). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377539_HBe_P-RF-CB Product feature CHAIN GQ377539_HBe_P-RF-CB of FT:mat_peptide GQ377539_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J53). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377544_HBe_P-RF-CB Product feature CHAIN GQ377544_HBe_P-RF-CB of FT:mat_peptide GQ377544_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J69). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377548_HBe_P-RF-CB Product feature CHAIN GQ377548_HBe_P-RF-CB of FT:mat_peptide GQ377548_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J79). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377549_HBe_P-RF-CB Product feature CHAIN GQ377549_HBe_P-RF-CB of FT:mat_peptide GQ377549_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J80). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377560_HBe_P-RF-CB Product feature CHAIN GQ377560_HBe_P-RF-CB of FT:mat_peptide GQ377560_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J93). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377564_HBe_P-RF-CB Product feature CHAIN GQ377564_HBe_P-RF-CB of FT:mat_peptide GQ377564_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J99). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377565_HBe_P-RF-CB Product feature CHAIN GQ377565_HBe_P-RF-CB of FT:mat_peptide GQ377565_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J100). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377573_HBe_P-RF-CB Product feature CHAIN GQ377573_HBe_P-RF-CB of FT:mat_peptide GQ377573_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J114). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377581_HBe_P-RF-CB Product feature CHAIN GQ377581_HBe_P-RF-CB of FT:mat_peptide GQ377581_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J129). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377590_HBe_P-RF-CB Product feature CHAIN GQ377590_HBe_P-RF-CB of FT:mat_peptide GQ377590_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J147). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377594_HBe_P-RF-CB Product feature CHAIN GQ377594_HBe_P-RF-CB of FT:mat_peptide GQ377594_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J152). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377595_HBe_P-RF-BC Product feature CHAIN GQ377595_HBe_P-RF-BC of FT:mat_peptide GQ377595_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J155). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377596_HBe_P-RF-CB Product feature CHAIN GQ377596_HBe_P-RF-CB of FT:mat_peptide GQ377596_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J156). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377602_HBe_P-RF-CB Product feature CHAIN GQ377602_HBe_P-RF-CB of FT:mat_peptide GQ377602_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J165). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377611_HBe_P-RF-CB Product feature CHAIN GQ377611_HBe_P-RF-CB of FT:mat_peptide GQ377611_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J179). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377613_HBe_P-RF-CB Product feature CHAIN GQ377613_HBe_P-RF-CB of FT:mat_peptide GQ377613_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J181). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377614_HBe_P-RF-CB Product feature CHAIN GQ377614_HBe_P-RF-CB of FT:mat_peptide GQ377614_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J185). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377626_HBe_P-RF-CB Product feature CHAIN GQ377626_HBe_P-RF-CB of FT:mat_peptide GQ377626_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J225). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377627_HBe_P-RF-CD Product feature CHAIN GQ377627_HBe_P-RF-CD of FT:mat_peptide GQ377627_HBe_P-RF-CD of [Viruses] Hepatitis B Virus recombinant form CD (isolate J231). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GQ377630_HBe_P-RF-BC Product feature CHAIN GQ377630_HBe_P-RF-BC of FT:mat_peptide GQ377630_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J236). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377633_HBe_P-RF-CB Product feature CHAIN GQ377633_HBe_P-RF-CB of FT:mat_peptide GQ377633_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J241). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377634_HBe_P-RF-CB Product feature CHAIN GQ377634_HBe_P-RF-CB of FT:mat_peptide GQ377634_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate J242). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ377635_HBe_P-RF-BC Product feature CHAIN GQ377635_HBe_P-RF-BC of FT:mat_peptide GQ377635_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J245). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GQ924618_HBe_P-RF-CB Product feature CHAIN GQ924618_HBe_P-RF-CB of FT:mat_peptide GQ924618_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate M35). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU177079_HBe_P-RF-DE Product feature CHAIN GU177079_HBe_P-RF-DE of FT:mat_peptide GU177079_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate DN171). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|GU357843_HBe_P-RF-CB Product feature CHAIN GU357843_HBe_P-RF-CB of FT:mat_peptide GU357843_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Y580). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGNNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|GU563560_HBe_P-RF-DE Product feature CHAIN GU563560_HBe_P-RF-DE of FT:mat_peptide GU563560_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BV-146). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HE981179_HBe_P-RF-FG Product feature CHAIN HE981179_HBe_P-RF-FG of FT:mat_peptide HE981179_HBe_P-RF-FG of [Viruses] Hepatitis B Virus recombinant form FG. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLAS
WVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HE981180_HBe_P-RF-GF Product feature CHAIN HE981180_HBe_P-RF-GF of FT:mat_peptide HE981180_HBe_P-RF-GF of [Viruses] Hepatitis B Virus recombinant form GF. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPSHTALRQAILCWGELMTLAS
WVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HF571060_HBe_P-RF-AE Product feature CHAIN HF571060_HBe_P-RF-AE of FT:mat_peptide HF571060_HBe_P-RF-AE of [Viruses] Hepatitis B Virus recombinant form AE (isolate 56325). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|HM146131_HBe_P-RF-AD Product feature CHAIN HM146131_HBe_P-RF-AD of FT:mat_peptide HM146131_HBe_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate TCGA5889). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELTTLGT
WVGNNLQDPASRDQVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM750133_HBe_P-RF-CB Product feature CHAIN HM750133_HBe_P-RF-CB of FT:mat_peptide HM750133_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate GSD-54). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM750142_HBe_P-RF-DC Product feature CHAIN HM750142_HBe_P-RF-DC of FT:mat_peptide HM750142_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QHN-52). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM750143_HBe_P-RF-DC Product feature CHAIN HM750143_HBe_P-RF-DC of FT:mat_peptide HM750143_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate tibet-116). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM750144_HBe_P-RF-DC Product feature CHAIN HM750144_HBe_P-RF-DC of FT:mat_peptide HM750144_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QHX-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKQCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM750145_HBe_P-RF-DC Product feature CHAIN HM750145_HBe_P-RF-DC of FT:mat_peptide HM750145_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-18). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM750146_HBe_P-RF-DC Product feature CHAIN HM750146_HBe_P-RF-DC of FT:mat_peptide HM750146_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-26). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM750147_HBe_P-RF-DC Product feature CHAIN HM750147_HBe_P-RF-DC of FT:mat_peptide HM750147_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-29). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM750148_HBe_P-RF-DC Product feature CHAIN HM750148_HBe_P-RF-DC of FT:mat_peptide HM750148_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-37). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM750149_HBe_P-RF-DC Product feature CHAIN HM750149_HBe_P-RF-DC of FT:mat_peptide HM750149_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-60). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HM750150_HBe_P-RF-DC Product feature CHAIN HM750150_HBe_P-RF-DC of FT:mat_peptide HM750150_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-70). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700485_HBe_P-RF-CB Product feature CHAIN HQ700485_HBe_P-RF-CB of FT:mat_peptide HQ700485_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NZL_TE55_1984). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700497_HBe_P-RF-DE Product feature CHAIN HQ700497_HBe_P-RF-DE of FT:mat_peptide HQ700497_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_F109C_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700498_HBe_P-RF-CB Product feature CHAIN HQ700498_HBe_P-RF-CB of FT:mat_peptide HQ700498_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_F528PF_2005). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700499_HBe_P-RF-CB Product feature CHAIN HQ700499_HBe_P-RF-CB of FT:mat_peptide HQ700499_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_F528C_2005). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700501_HBe_P-RF-DE Product feature CHAIN HQ700501_HBe_P-RF-DE of FT:mat_peptide HQ700501_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Samoa_Fa_1991). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700503_HBe_P-RF-DE Product feature CHAIN HQ700503_HBe_P-RF-DE of FT:mat_peptide HQ700503_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_Ng_1992). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700505_HBe_P-RF-CB Product feature CHAIN HQ700505_HBe_P-RF-CB of FT:mat_peptide HQ700505_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_KI178P_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700507_HBe_P-RF-CB Product feature CHAIN HQ700507_HBe_P-RF-CB of FT:mat_peptide HQ700507_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NC_179928_2001). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700508_HBe_P-RF-CB Product feature CHAIN HQ700508_HBe_P-RF-CB of FT:mat_peptide HQ700508_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NC_43577_2003). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700509_HBe_P-RF-CB Product feature CHAIN HQ700509_HBe_P-RF-CB of FT:mat_peptide HQ700509_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NC_3001_2003). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700515_HBe_P-RF-CB Product feature CHAIN HQ700515_HBe_P-RF-CB of FT:mat_peptide HQ700515_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_NC_TA1_2003). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=132 residues).
CLGWLWGMDIYPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLATWVG
SNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700518_HBe_P-RF-CB Product feature CHAIN HQ700518_HBe_P-RF-CB of FT:mat_peptide HQ700518_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_D071A_2005). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700519_HBe_P-RF-CB Product feature CHAIN HQ700519_HBe_P-RF-CB of FT:mat_peptide HQ700519_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_G028A_2003). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700520_HBe_P-RF-CB Product feature CHAIN HQ700520_HBe_P-RF-CB of FT:mat_peptide HQ700520_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_GM009A_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHLSCLMFGRETVLEFLVSFGVW
>gnl|hbvpro|HQ700521_HBe_P-RF-CB Product feature CHAIN HQ700521_HBe_P-RF-CB of FT:mat_peptide HQ700521_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_H058_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700523_HBe_P-RF-CB Product feature CHAIN HQ700523_HBe_P-RF-CB of FT:mat_peptide HQ700523_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_P032C_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELXVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700524_HBe_P-RF-DE Product feature CHAIN HQ700524_HBe_P-RF-DE of FT:mat_peptide HQ700524_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_PNG_P043PF_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700525_HBe_P-RF-DE Product feature CHAIN HQ700525_HBe_P-RF-DE of FT:mat_peptide HQ700525_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_PNG_P054PF_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700526_HBe_P-RF-CB Product feature CHAIN HQ700526_HBe_P-RF-CB of FT:mat_peptide HQ700526_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_143PF_2005). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700527_HBe_P-RF-CB Product feature CHAIN HQ700527_HBe_P-RF-CB of FT:mat_peptide HQ700527_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_W035A_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700528_HBe_P-RF-CB Product feature CHAIN HQ700528_HBe_P-RF-CB of FT:mat_peptide HQ700528_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_W034A_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700530_HBe_P-RF-CB Product feature CHAIN HQ700530_HBe_P-RF-CB of FT:mat_peptide HQ700530_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_T127_1994). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700531_HBe_P-RF-CB Product feature CHAIN HQ700531_HBe_P-RF-CB of FT:mat_peptide HQ700531_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_T107_1994). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700532_HBe_P-RF-CB Product feature CHAIN HQ700532_HBe_P-RF-CB of FT:mat_peptide HQ700532_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_T114_1994). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700535_HBe_P-RF-DE Product feature CHAIN HQ700535_HBe_P-RF-DE of FT:mat_peptide HQ700535_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI152P_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGXLMTLAT
WVGTNLEDPASRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700537_HBe_P-RF-DE Product feature CHAIN HQ700537_HBe_P-RF-DE of FT:mat_peptide HQ700537_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI191P_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGXLMTLAT
WVGTNLEDPASRDLVVSYVNTNXGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700538_HBe_P-RF-DE Product feature CHAIN HQ700538_HBe_P-RF-DE of FT:mat_peptide HQ700538_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI215p_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTXVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700541_HBe_P-RF-DE Product feature CHAIN HQ700541_HBe_P-RF-DE of FT:mat_peptide HQ700541_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_KI387C_2005). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700542_HBe_P-RF-CB Product feature CHAIN HQ700542_HBe_P-RF-CB of FT:mat_peptide HQ700542_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_PNG_Y020_2003). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700547_HBe_P-RF-CB Product feature CHAIN HQ700547_HBe_P-RF-CB of FT:mat_peptide HQ700547_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate I_WA1034A). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700557_HBe_P-RF-CB Product feature CHAIN HQ700557_HBe_P-RF-CB of FT:mat_peptide HQ700557_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_Tonga_BB6189_2002). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700560_HBe_P-RF-CB Product feature CHAIN HQ700560_HBe_P-RF-CB of FT:mat_peptide HQ700560_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate C_Tonga_BE4253_2001). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700581_HBe_P-RF-DE Product feature CHAIN HQ700581_HBe_P-RF-DE of FT:mat_peptide HQ700581_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_BB6995_2000). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700582_HBe_P-RF-DE Product feature CHAIN HQ700582_HBe_P-RF-DE of FT:mat_peptide HQ700582_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_BH0071_2002). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700583_HBe_P-RF-DE Product feature CHAIN HQ700583_HBe_P-RF-DE of FT:mat_peptide HQ700583_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_BQ3450_2001). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|HQ700584_HBe_P-RF-DE Product feature CHAIN HQ700584_HBe_P-RF-DE of FT:mat_peptide HQ700584_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_Tonga_JF5498_2004). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF436919_HBe_P-RF-CB Product feature CHAIN JF436919_HBe_P-RF-CB of FT:mat_peptide JF436919_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SZ5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF436923_HBe_P-RF-CB Product feature CHAIN JF436923_HBe_P-RF-CB of FT:mat_peptide JF436923_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SZ19). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELVNLAT
WVGSNLEDPASRELVVSYVNVNMGLKTRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439776_HBe_P-RF-AG Product feature CHAIN JF439776_HBe_P-RF-AG of FT:mat_peptide JF439776_HBe_P-RF-AG of [Viruses] Hepatitis B Virus recombinant form AG (isolate MAU05C10). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF439995_HBe_P-RF-DE Product feature CHAIN JF439995_HBe_P-RF-DE of FT:mat_peptide JF439995_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN17). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF439996_HBe_P-RF-DE Product feature CHAIN JF439996_HBe_P-RF-DE of FT:mat_peptide JF439996_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN31). Complete genome. [Hepadnaviridae] (length=135 residues).
SKPCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF439998_HBe_P-RF-DE Product feature CHAIN JF439998_HBe_P-RF-DE of FT:mat_peptide JF439998_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN35). Complete genome. [Hepadnaviridae] (length=135 residues).
SKPCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF439999_HBe_P-RF-DE Product feature CHAIN JF439999_HBe_P-RF-DE of FT:mat_peptide JF439999_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN36). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKSRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440000_HBe_P-RF-DE Product feature CHAIN JF440000_HBe_P-RF-DE of FT:mat_peptide JF440000_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN37). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440001_HBe_P-RF-DE Product feature CHAIN JF440001_HBe_P-RF-DE of FT:mat_peptide JF440001_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN42). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440002_HBe_P-RF-DE Product feature CHAIN JF440002_HBe_P-RF-DE of FT:mat_peptide JF440002_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN43). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440003_HBe_P-RF-DE Product feature CHAIN JF440003_HBe_P-RF-DE of FT:mat_peptide JF440003_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN44). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440004_HBe_P-RF-DE Product feature CHAIN JF440004_HBe_P-RF-DE of FT:mat_peptide JF440004_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN52). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440005_HBe_P-RF-DE Product feature CHAIN JF440005_HBe_P-RF-DE of FT:mat_peptide JF440005_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN53). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440006_HBe_P-RF-DE Product feature CHAIN JF440006_HBe_P-RF-DE of FT:mat_peptide JF440006_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN60). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440007_HBe_P-RF-DE Product feature CHAIN JF440007_HBe_P-RF-DE of FT:mat_peptide JF440007_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN64). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPVSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440008_HBe_P-RF-DE Product feature CHAIN JF440008_HBe_P-RF-DE of FT:mat_peptide JF440008_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN70). Partial genome (Contains: HBe, HBc, HBx, SHBs). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440009_HBe_P-RF-DE Product feature CHAIN JF440009_HBe_P-RF-DE of FT:mat_peptide JF440009_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN72). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440010_HBe_P-RF-DE Product feature CHAIN JF440010_HBe_P-RF-DE of FT:mat_peptide JF440010_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN77). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440011_HBe_P-RF-DE Product feature CHAIN JF440011_HBe_P-RF-DE of FT:mat_peptide JF440011_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN78). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLMSFGVW
>gnl|hbvpro|JF440012_HBe_P-RF-DE Product feature CHAIN JF440012_HBe_P-RF-DE of FT:mat_peptide JF440012_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN82). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALEPPEHWSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440013_HBe_P-RF-DE Product feature CHAIN JF440013_HBe_P-RF-DE of FT:mat_peptide JF440013_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN84). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440014_HBe_P-RF-DE Product feature CHAIN JF440014_HBe_P-RF-DE of FT:mat_peptide JF440014_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN86). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440015_HBe_P-RF-DE Product feature CHAIN JF440015_HBe_P-RF-DE of FT:mat_peptide JF440015_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FEN94). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JF440017_HBe_P-RF-DA Product feature CHAIN JF440017_HBe_P-RF-DA of FT:mat_peptide JF440017_HBe_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate FOL496). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSPHHTALRQDILCWGELMTLAT
WVGTNLEDPASRDLVVNYVNTNMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF491448_HBe_P-RF-DC Product feature CHAIN JF491448_HBe_P-RF-DC of FT:mat_peptide JF491448_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH-29). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF491449_HBe_P-RF-DC Product feature CHAIN JF491449_HBe_P-RF-DC of FT:mat_peptide JF491449_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH-32). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF491451_HBe_P-RF-DC Product feature CHAIN JF491451_HBe_P-RF-DC of FT:mat_peptide JF491451_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH-35). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF491455_HBe_P-RF-DC Product feature CHAIN JF491455_HBe_P-RF-DC of FT:mat_peptide JF491455_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-31). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF491456_HBe_P-RF-DC Product feature CHAIN JF491456_HBe_P-RF-DC of FT:mat_peptide JF491456_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-53). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF828933_HBe_P-RF-CB Product feature CHAIN JF828933_HBe_P-RF-CB of FT:mat_peptide JF828933_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF828934_HBe_P-RF-CB Product feature CHAIN JF828934_HBe_P-RF-CB of FT:mat_peptide JF828934_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF828935_HBe_P-RF-CB Product feature CHAIN JF828935_HBe_P-RF-CB of FT:mat_peptide JF828935_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF828936_HBe_P-RF-CB Product feature CHAIN JF828936_HBe_P-RF-CB of FT:mat_peptide JF828936_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JF828938_HBe_P-RF-CB Product feature CHAIN JF828938_HBe_P-RF-CB of FT:mat_peptide JF828938_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate ES72-17). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN104438_HBe_P-RF-CB Product feature CHAIN JN104438_HBe_P-RF-CB of FT:mat_peptide JN104438_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN104442_HBe_P-RF-CB Product feature CHAIN JN104442_HBe_P-RF-CB of FT:mat_peptide JN104442_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN257174_HBe_P-RF-DE Product feature CHAIN JN257174_HBe_P-RF-DE of FT:mat_peptide JN257174_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHOTH1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIQCWGXLMTLAT
WVGGNLEDPISRDLVVSXVNXNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JN257191_HBe_P-RF-DE Product feature CHAIN JN257191_HBe_P-RF-DE of FT:mat_peptide JN257191_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHWHD1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPXSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JN257216_HBe_P-RF-DE Product feature CHAIN JN257216_HBe_P-RF-DE of FT:mat_peptide JN257216_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate WHMQR1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPISRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN400086_HBe_P-RF-CB Product feature CHAIN JN400086_HBe_P-RF-CB of FT:mat_peptide JN400086_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV-75-Baby). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN664915_HBe_P-RF-DE Product feature CHAIN JN664915_HBe_P-RF-DE of FT:mat_peptide JN664915_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EN56_IC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTFAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN664925_HBe_P-RF-DE Product feature CHAIN JN664925_HBe_P-RF-DE of FT:mat_peptide JN664925_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EN57_CHB). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTFAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN664929_HBe_P-RF-DE Product feature CHAIN JN664929_HBe_P-RF-DE of FT:mat_peptide JN664929_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HE33_CHB). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLITLST
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN664933_HBe_P-RF-DA Product feature CHAIN JN664933_HBe_P-RF-DA of FT:mat_peptide JN664933_HBe_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate EN58_CHB). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAVLCWVELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN664935_HBe_P-RF-DC Product feature CHAIN JN664935_HBe_P-RF-DC of FT:mat_peptide JN664935_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate HE28_CHB). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN664940_HBe_P-RF-DE Product feature CHAIN JN664940_HBe_P-RF-DE of FT:mat_peptide JN664940_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate THB20_LC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JN664943_HBe_P-RF-DE Product feature CHAIN JN664943_HBe_P-RF-DE of FT:mat_peptide JN664943_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EN76_LC). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JQ040130_HBe_P-RF-CB Product feature CHAIN JQ040130_HBe_P-RF-CB of FT:mat_peptide JQ040130_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 95). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNXNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ040146_HBe_P-RF-CB Product feature CHAIN JQ040146_HBe_P-RF-CB of FT:mat_peptide JQ040146_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 278). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ040148_HBe_P-RF-CB Product feature CHAIN JQ040148_HBe_P-RF-CB of FT:mat_peptide JQ040148_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate G67). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLXLGWLWGMDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ040174_HBe_P-RF-CB Product feature CHAIN JQ040174_HBe_P-RF-CB of FT:mat_peptide JQ040174_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate G246). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ040175_HBe_P-RF-CB Product feature CHAIN JQ040175_HBe_P-RF-CB of FT:mat_peptide JQ040175_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate G250). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ687532_HBe_P-RF-DE Product feature CHAIN JQ687532_HBe_P-RF-DE of FT:mat_peptide JQ687532_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Srb 207). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JQ707714_HBe_P-RF-CB Product feature CHAIN JQ707714_HBe_P-RF-CB of FT:mat_peptide JQ707714_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate S20_21). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ732168_HBe_P-RF-CB Product feature CHAIN JQ732168_HBe_P-RF-CB of FT:mat_peptide JQ732168_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate DT2007). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ801476_HBe_P-RF-CG Product feature CHAIN JQ801476_HBe_P-RF-CG of FT:mat_peptide JQ801476_HBe_P-RF-CG of [Viruses] Hepatitis B Virus recombinant form CG (isolate AIDS18). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JQ801477_HBe_P-RF-BC Product feature CHAIN JQ801477_HBe_P-RF-BC of FT:mat_peptide JQ801477_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate AIDS19). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX026887_HBe_P-RF-CB Product feature CHAIN JX026887_HBe_P-RF-CB of FT:mat_peptide JX026887_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate WY-NJ-79). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALHREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX429896_HBe_P-RF-CB Product feature CHAIN JX429896_HBe_P-RF-CB of FT:mat_peptide JX429896_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate WY-HZ-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETALEYLVSFGVW
>gnl|hbvpro|JX429898_HBe_P-RF-DC Product feature CHAIN JX429898_HBe_P-RF-DC of FT:mat_peptide JX429898_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate WY-HZ-13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX661485_HBe_P-RF-CB Product feature CHAIN JX661485_HBe_P-RF-CB of FT:mat_peptide JX661485_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1201-C1). Complete genome. [Hepadnaviridae] (length=135 residues).
LQLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX661486_HBe_P-RF-CB Product feature CHAIN JX661486_HBe_P-RF-CB of FT:mat_peptide JX661486_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1225-C12). Complete genome. [Hepadnaviridae] (length=135 residues).
RELCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX661487_HBe_P-RF-CB Product feature CHAIN JX661487_HBe_P-RF-CB of FT:mat_peptide JX661487_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1207-C3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX661494_HBe_P-RF-CB Product feature CHAIN JX661494_HBe_P-RF-CB of FT:mat_peptide JX661494_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1203-C2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX661498_HBe_P-RF-CB Product feature CHAIN JX661498_HBe_P-RF-CB of FT:mat_peptide JX661498_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH1213-C6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|JX898686_HBe_P-RF-DE Product feature CHAIN JX898686_HBe_P-RF-DE of FT:mat_peptide JX898686_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JX898687_HBe_P-RF-DE Product feature CHAIN JX898687_HBe_P-RF-DE of FT:mat_peptide JX898687_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JX898688_HBe_P-RF-DE Product feature CHAIN JX898688_HBe_P-RF-DE of FT:mat_peptide JX898688_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JX898690_HBe_P-RF-DE Product feature CHAIN JX898690_HBe_P-RF-DE of FT:mat_peptide JX898690_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P16). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JX898693_HBe_P-RF-DE Product feature CHAIN JX898693_HBe_P-RF-DE of FT:mat_peptide JX898693_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P20). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JX898695_HBe_P-RF-DE Product feature CHAIN JX898695_HBe_P-RF-DE of FT:mat_peptide JX898695_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P23). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JX898696_HBe_P-RF-DE Product feature CHAIN JX898696_HBe_P-RF-DE of FT:mat_peptide JX898696_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P31). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JX898698_HBe_P-RF-DE Product feature CHAIN JX898698_HBe_P-RF-DE of FT:mat_peptide JX898698_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P28). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|JX898699_HBe_P-RF-DE Product feature CHAIN JX898699_HBe_P-RF-DE of FT:mat_peptide JX898699_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate P27). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC012653_HBe_P-RF-AD Product feature CHAIN KC012653_HBe_P-RF-AD of FT:mat_peptide KC012653_HBe_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPASRDLVVGYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC172106_HBe_P-RF-GB Product feature CHAIN KC172106_HBe_P-RF-GB of FT:mat_peptide KC172106_HBe_P-RF-GB of [Viruses] Hepatitis B Virus recombinant form GB (isolate BTO3048). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC315400_HBe_P-RF-CB Product feature CHAIN KC315400_HBe_P-RF-CB of FT:mat_peptide KC315400_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate M0914). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774178_HBe_P-RF-BC Product feature CHAIN KC774178_HBe_P-RF-BC of FT:mat_peptide KC774178_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate GS12lz2088). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774183_HBe_P-RF-CB Product feature CHAIN KC774183_HBe_P-RF-CB of FT:mat_peptide KC774183_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz1020). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774186_HBe_P-RF-CB Product feature CHAIN KC774186_HBe_P-RF-CB of FT:mat_peptide KC774186_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz1026). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774198_HBe_P-RF-CB Product feature CHAIN KC774198_HBe_P-RF-CB of FT:mat_peptide KC774198_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2039). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774201_HBe_P-RF-CB Product feature CHAIN KC774201_HBe_P-RF-CB of FT:mat_peptide KC774201_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2047). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774212_HBe_P-RF-CB Product feature CHAIN KC774212_HBe_P-RF-CB of FT:mat_peptide KC774212_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate clz2115). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774234_HBe_P-RF-CB Product feature CHAIN KC774234_HBe_P-RF-CB of FT:mat_peptide KC774234_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cur1038). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774258_HBe_P-RF-CB Product feature CHAIN KC774258_HBe_P-RF-CB of FT:mat_peptide KC774258_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cww1060). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774294_HBe_P-RF-CB Product feature CHAIN KC774294_HBe_P-RF-CB of FT:mat_peptide KC774294_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa1205). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774305_HBe_P-RF-CB Product feature CHAIN KC774305_HBe_P-RF-CB of FT:mat_peptide KC774305_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa1672). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774317_HBe_P-RF-CB Product feature CHAIN KC774317_HBe_P-RF-CB of FT:mat_peptide KC774317_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2042). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774322_HBe_P-RF-CB Product feature CHAIN KC774322_HBe_P-RF-CB of FT:mat_peptide KC774322_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2053). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774324_HBe_P-RF-CB Product feature CHAIN KC774324_HBe_P-RF-CB of FT:mat_peptide KC774324_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2060). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774328_HBe_P-RF-CB Product feature CHAIN KC774328_HBe_P-RF-CB of FT:mat_peptide KC774328_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxa2073). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774332_HBe_P-RF-CB Product feature CHAIN KC774332_HBe_P-RF-CB of FT:mat_peptide KC774332_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1005). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774341_HBe_P-RF-CB Product feature CHAIN KC774341_HBe_P-RF-CB of FT:mat_peptide KC774341_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1040). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774344_HBe_P-RF-CB Product feature CHAIN KC774344_HBe_P-RF-CB of FT:mat_peptide KC774344_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1049). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774349_HBe_P-RF-CB Product feature CHAIN KC774349_HBe_P-RF-CB of FT:mat_peptide KC774349_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate cxn1095). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774364_HBe_P-RF-BC Product feature CHAIN KC774364_HBe_P-RF-BC of FT:mat_peptide KC774364_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate blz2088). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774414_HBe_P-RF-BC Product feature CHAIN KC774414_HBe_P-RF-BC of FT:mat_peptide KC774414_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate bxa2061). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774423_HBe_P-RF-DC Product feature CHAIN KC774423_HBe_P-RF-DC of FT:mat_peptide KC774423_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2018). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774424_HBe_P-RF-DC Product feature CHAIN KC774424_HBe_P-RF-DC of FT:mat_peptide KC774424_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2021). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774425_HBe_P-RF-DC Product feature CHAIN KC774425_HBe_P-RF-DC of FT:mat_peptide KC774425_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2068). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774426_HBe_P-RF-DC Product feature CHAIN KC774426_HBe_P-RF-DC of FT:mat_peptide KC774426_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dlz2091). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774442_HBe_P-RF-DC Product feature CHAIN KC774442_HBe_P-RF-DC of FT:mat_peptide KC774442_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1035). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774447_HBe_P-RF-DC Product feature CHAIN KC774447_HBe_P-RF-DC of FT:mat_peptide KC774447_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1057). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774448_HBe_P-RF-DC Product feature CHAIN KC774448_HBe_P-RF-DC of FT:mat_peptide KC774448_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1058). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774449_HBe_P-RF-DC Product feature CHAIN KC774449_HBe_P-RF-DC of FT:mat_peptide KC774449_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1071). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRNAIVCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774450_HBe_P-RF-DE Product feature CHAIN KC774450_HBe_P-RF-DE of FT:mat_peptide KC774450_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate dww1073). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KC774452_HBe_P-RF-DC Product feature CHAIN KC774452_HBe_P-RF-DC of FT:mat_peptide KC774452_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1080). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774453_HBe_P-RF-DC Product feature CHAIN KC774453_HBe_P-RF-DC of FT:mat_peptide KC774453_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1083). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774454_HBe_P-RF-DC Product feature CHAIN KC774454_HBe_P-RF-DC of FT:mat_peptide KC774454_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1087). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774455_HBe_P-RF-DC Product feature CHAIN KC774455_HBe_P-RF-DC of FT:mat_peptide KC774455_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1100). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774456_HBe_P-RF-DC Product feature CHAIN KC774456_HBe_P-RF-DC of FT:mat_peptide KC774456_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1102). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774457_HBe_P-RF-DC Product feature CHAIN KC774457_HBe_P-RF-DC of FT:mat_peptide KC774457_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1105). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774458_HBe_P-RF-DC Product feature CHAIN KC774458_HBe_P-RF-DC of FT:mat_peptide KC774458_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dww1108). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774461_HBe_P-RF-DC Product feature CHAIN KC774461_HBe_P-RF-DC of FT:mat_peptide KC774461_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxa1577). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774463_HBe_P-RF-DC Product feature CHAIN KC774463_HBe_P-RF-DC of FT:mat_peptide KC774463_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxa2066). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774470_HBe_P-RF-DC Product feature CHAIN KC774470_HBe_P-RF-DC of FT:mat_peptide KC774470_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1017). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774471_HBe_P-RF-DC Product feature CHAIN KC774471_HBe_P-RF-DC of FT:mat_peptide KC774471_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1018). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774479_HBe_P-RF-DC Product feature CHAIN KC774479_HBe_P-RF-DC of FT:mat_peptide KC774479_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1036). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774480_HBe_P-RF-DC Product feature CHAIN KC774480_HBe_P-RF-DC of FT:mat_peptide KC774480_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1038). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774482_HBe_P-RF-DC Product feature CHAIN KC774482_HBe_P-RF-DC of FT:mat_peptide KC774482_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1043). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774484_HBe_P-RF-DC Product feature CHAIN KC774484_HBe_P-RF-DC of FT:mat_peptide KC774484_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1051). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774485_HBe_P-RF-DC Product feature CHAIN KC774485_HBe_P-RF-DC of FT:mat_peptide KC774485_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1058). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774487_HBe_P-RF-DC Product feature CHAIN KC774487_HBe_P-RF-DC of FT:mat_peptide KC774487_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1066). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774489_HBe_P-RF-DC Product feature CHAIN KC774489_HBe_P-RF-DC of FT:mat_peptide KC774489_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1079). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774490_HBe_P-RF-DC Product feature CHAIN KC774490_HBe_P-RF-DC of FT:mat_peptide KC774490_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1082). Complete genome. [Hepadnaviridae] (length=135 residues).
PKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774492_HBe_P-RF-DC Product feature CHAIN KC774492_HBe_P-RF-DC of FT:mat_peptide KC774492_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1087). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774494_HBe_P-RF-DC Product feature CHAIN KC774494_HBe_P-RF-DC of FT:mat_peptide KC774494_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1090). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774495_HBe_P-RF-DC Product feature CHAIN KC774495_HBe_P-RF-DC of FT:mat_peptide KC774495_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1091). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774497_HBe_P-RF-DC Product feature CHAIN KC774497_HBe_P-RF-DC of FT:mat_peptide KC774497_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dxn1097). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC774499_HBe_P-RF-DC Product feature CHAIN KC774499_HBe_P-RF-DC of FT:mat_peptide KC774499_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate dyc1018). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KC875338_HBe_P-RF-DE Product feature CHAIN KC875338_HBe_P-RF-DE of FT:mat_peptide KC875338_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVMEYLVSFGVW
>gnl|hbvpro|KC875339_HBe_P-RF-DE Product feature CHAIN KC875339_HBe_P-RF-DE of FT:mat_peptide KC875339_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV35). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVMEYLVSFGVW
>gnl|hbvpro|KF170740_HBe_P-RF-DE Product feature CHAIN KF170740_HBe_P-RF-DE of FT:mat_peptide KF170740_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate SDAC_031). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KF192833_HBe_P-RF-DE Product feature CHAIN KF192833_HBe_P-RF-DE of FT:mat_peptide KF192833_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP68). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF192835_HBe_P-RF-DE Product feature CHAIN KF192835_HBe_P-RF-DE of FT:mat_peptide KF192835_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP65). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNANVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF192837_HBe_P-RF-DE Product feature CHAIN KF192837_HBe_P-RF-DE of FT:mat_peptide KF192837_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP55). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF192838_HBe_P-RF-DE Product feature CHAIN KF192838_HBe_P-RF-DE of FT:mat_peptide KF192838_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP43). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF192839_HBe_P-RF-DE Product feature CHAIN KF192839_HBe_P-RF-DE of FT:mat_peptide KF192839_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP42). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF192840_HBe_P-RF-DE Product feature CHAIN KF192840_HBe_P-RF-DE of FT:mat_peptide KF192840_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP56). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGANLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF192841_HBe_P-RF-DE Product feature CHAIN KF192841_HBe_P-RF-DE of FT:mat_peptide KF192841_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate TP49). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF214656_HBe_P-RF-AC Product feature CHAIN KF214656_HBe_P-RF-AC of FT:mat_peptide KF214656_HBe_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate IND-2009-5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KF779353_HBe_P-RF-DA Product feature CHAIN KF779353_HBe_P-RF-DA of FT:mat_peptide KF779353_HBe_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate PNF5063). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873511_HBe_P-RF-CB Product feature CHAIN KF873511_HBe_P-RF-CB of FT:mat_peptide KF873511_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 010_EA_Ram). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873513_HBe_P-RF-CB Product feature CHAIN KF873513_HBe_P-RF-CB of FT:mat_peptide KF873513_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 024_K_Kal). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVXYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873515_HBe_P-RF-CB Product feature CHAIN KF873515_HBe_P-RF-CB of FT:mat_peptide KF873515_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 022_EA_Gap). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873517_HBe_P-RF-BC Product feature CHAIN KF873517_HBe_P-RF-BC of FT:mat_peptide KF873517_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 005_EA_Gal). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873518_HBe_P-RF-CB Product feature CHAIN KF873518_HBe_P-RF-CB of FT:mat_peptide KF873518_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 016_EA_Gap). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873519_HBe_P-RF-CB Product feature CHAIN KF873519_HBe_P-RF-CB of FT:mat_peptide KF873519_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 017_EA_Gun). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873521_HBe_P-RF-BC Product feature CHAIN KF873521_HBe_P-RF-BC of FT:mat_peptide KF873521_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 063_K_Ngk). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873522_HBe_P-RF-CB Product feature CHAIN KF873522_HBe_P-RF-CB of FT:mat_peptide KF873522_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 015_WA_Gou). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873523_HBe_P-RF-CB Product feature CHAIN KF873523_HBe_P-RF-CB of FT:mat_peptide KF873523_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 055_WA_Oen). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQXILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873524_HBe_P-RF-CB Product feature CHAIN KF873524_HBe_P-RF-CB of FT:mat_peptide KF873524_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 039_WA_Oen). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873527_HBe_P-RF-CB Product feature CHAIN KF873527_HBe_P-RF-CB of FT:mat_peptide KF873527_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 052_K_Vic). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873530_HBe_P-RF-CB Product feature CHAIN KF873530_HBe_P-RF-CB of FT:mat_peptide KF873530_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 018_WAust_Wyn). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESAEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873531_HBe_P-RF-CB Product feature CHAIN KF873531_HBe_P-RF-CB of FT:mat_peptide KF873531_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 021_TI_Ngu). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873532_HBe_P-RF-CB Product feature CHAIN KF873532_HBe_P-RF-CB of FT:mat_peptide KF873532_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 031_TI_Ngu). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873533_HBe_P-RF-CB Product feature CHAIN KF873533_HBe_P-RF-CB of FT:mat_peptide KF873533_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 028_TI_Ngu). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALEXPEHCSPHHTALRQAILXWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873534_HBe_P-RF-CB Product feature CHAIN KF873534_HBe_P-RF-CB of FT:mat_peptide KF873534_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 019_TI_Ngu). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873538_HBe_P-RF-CB Product feature CHAIN KF873538_HBe_P-RF-CB of FT:mat_peptide KF873538_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 059_DR_Wad). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873540_HBe_P-RF-CB Product feature CHAIN KF873540_HBe_P-RF-CB of FT:mat_peptide KF873540_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 003_DR_Dal). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAXLCWGELMNLAT
WVGSNLEDPASRELVXSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873542_HBe_P-RF-CB Product feature CHAIN KF873542_HBe_P-RF-CB of FT:mat_peptide KF873542_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 038_DR_Wad). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF873543_HBe_P-RF-CB Product feature CHAIN KF873543_HBe_P-RF-CB of FT:mat_peptide KF873543_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 050_DR_Wad). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KF917451_HBe_P-RF-DC Product feature CHAIN KF917451_HBe_P-RF-DC of FT:mat_peptide KF917451_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate YN.071). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173279_HBe_P-RF-CB Product feature CHAIN KJ173279_HBe_P-RF-CB of FT:mat_peptide KJ173279_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX004C(e207)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173280_HBe_P-RF-CB Product feature CHAIN KJ173280_HBe_P-RF-CB of FT:mat_peptide KJ173280_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX004M(e208)). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173299_HBe_P-RF-CB Product feature CHAIN KJ173299_HBe_P-RF-CB of FT:mat_peptide KJ173299_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HS005C(e22)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173300_HBe_P-RF-CB Product feature CHAIN KJ173300_HBe_P-RF-CB of FT:mat_peptide KJ173300_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HS005M(e23)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173320_HBe_P-RF-CB Product feature CHAIN KJ173320_HBe_P-RF-CB of FT:mat_peptide KJ173320_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate NH29M(e41)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173322_HBe_P-RF-CB Product feature CHAIN KJ173322_HBe_P-RF-CB of FT:mat_peptide KJ173322_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate NH30M(e41)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173325_HBe_P-RF-CB Product feature CHAIN KJ173325_HBe_P-RF-CB of FT:mat_peptide KJ173325_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P004-C(012)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173326_HBe_P-RF-CB Product feature CHAIN KJ173326_HBe_P-RF-CB of FT:mat_peptide KJ173326_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P004-M(014)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173329_HBe_P-RF-CB Product feature CHAIN KJ173329_HBe_P-RF-CB of FT:mat_peptide KJ173329_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P011-C(b168)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173330_HBe_P-RF-CB Product feature CHAIN KJ173330_HBe_P-RF-CB of FT:mat_peptide KJ173330_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate P011-M2(170)). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173349_HBe_P-RF-CB Product feature CHAIN KJ173349_HBe_P-RF-CB of FT:mat_peptide KJ173349_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX017C(e226)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173350_HBe_P-RF-CB Product feature CHAIN KJ173350_HBe_P-RF-CB of FT:mat_peptide KJ173350_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX017M(e227)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ173358_HBe_P-RF-CB Product feature CHAIN KJ173358_HBe_P-RF-CB of FT:mat_peptide KJ173358_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CX065M(e314)). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGAFVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ410497_HBe_P-RF-BC Product feature CHAIN KJ410497_HBe_P-RF-BC of FT:mat_peptide KJ410497_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate HK_1325). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPQHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ410506_HBe_P-RF-CB Product feature CHAIN KJ410506_HBe_P-RF-CB of FT:mat_peptide KJ410506_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Occult_HK526). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVRYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ410520_HBe_P-RF-CB Product feature CHAIN KJ410520_HBe_P-RF-CB of FT:mat_peptide KJ410520_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Occult_HK4869). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ470884_HBe_P-RF-DE Product feature CHAIN KJ470884_HBe_P-RF-DE of FT:mat_peptide KJ470884_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8145). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ470886_HBe_P-RF-DE Product feature CHAIN KJ470886_HBe_P-RF-DE of FT:mat_peptide KJ470886_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8117). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ470887_HBe_P-RF-DE Product feature CHAIN KJ470887_HBe_P-RF-DE of FT:mat_peptide KJ470887_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8064). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ470888_HBe_P-RF-DE Product feature CHAIN KJ470888_HBe_P-RF-DE of FT:mat_peptide KJ470888_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8035). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ470890_HBe_P-RF-DE Product feature CHAIN KJ470890_HBe_P-RF-DE of FT:mat_peptide KJ470890_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 8033). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ586803_HBe_P-RF-AF Product feature CHAIN KJ586803_HBe_P-RF-AF of FT:mat_peptide KJ586803_HBe_P-RF-AF of [Viruses] Hepatitis B Virus recombinant form AF. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTAFRQAILCWGELMTLAS
WGGNNLEDPAARDLVVNYVNTNMGLKIRQLLGFHISSLTFGRETVFEYLVFFGVW
>gnl|hbvpro|KJ586810_HBe_P-RF-AF Product feature CHAIN KJ586810_HBe_P-RF-AF of FT:mat_peptide KJ586810_HBe_P-RF-AF of [Viruses] Hepatitis B Virus recombinant form AF. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ647351_HBe_P-RF-DE Product feature CHAIN KJ647351_HBe_P-RF-DE of FT:mat_peptide KJ647351_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV202). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFYPSVRDLLDTASALYRDALESPEHCSPHHTALRQAVLCWGDLMNLAT
WVGANLEDPASRDLVVSYVNTNIALKFRQLXWFHVSCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KJ803753_HBe_P-RF-CB Product feature CHAIN KJ803753_HBe_P-RF-CB of FT:mat_peptide KJ803753_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY515920). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ803772_HBe_P-RF-BC Product feature CHAIN KJ803772_HBe_P-RF-BC of FT:mat_peptide KJ803772_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate MY816598). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ803782_HBe_P-RF-CB Product feature CHAIN KJ803782_HBe_P-RF-CB of FT:mat_peptide KJ803782_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY34118). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGEVMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ803785_HBe_P-RF-CB Product feature CHAIN KJ803785_HBe_P-RF-CB of FT:mat_peptide KJ803785_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY34920). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALCRDALESPEHVSAHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ803788_HBe_P-RF-CB Product feature CHAIN KJ803788_HBe_P-RF-CB of FT:mat_peptide KJ803788_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY541105). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVEIPFFLPSDFFPSIRDLLYTTSVLYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ803798_HBe_P-RF-CB Product feature CHAIN KJ803798_HBe_P-RF-CB of FT:mat_peptide KJ803798_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY464961). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGEVMNLAT
WVGSNLEDPASRELVVSYVNGNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ803802_HBe_P-RF-CB Product feature CHAIN KJ803802_HBe_P-RF-CB of FT:mat_peptide KJ803802_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY604675). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ803804_HBe_P-RF-CB Product feature CHAIN KJ803804_HBe_P-RF-CB of FT:mat_peptide KJ803804_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY590465). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMNLAT
WVGSNLEDPASREAVVSYVNVNMGLKIRQLLWFHISCLTFGRETVPEYLVSFGVW
>gnl|hbvpro|KJ803822_HBe_P-RF-CB Product feature CHAIN KJ803822_HBe_P-RF-CB of FT:mat_peptide KJ803822_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate MY091938). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KJ803827_HBe_P-RF-BC Product feature CHAIN KJ803827_HBe_P-RF-BC of FT:mat_peptide KJ803827_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate MY830498). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTAIRQAVLCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM386676_HBe_P-RF-DE Product feature CHAIN KM386676_HBe_P-RF-DE of FT:mat_peptide KM386676_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate CM1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVTYVNTNMGLKFRQLLWFHTSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KM524336_HBe_P-RF-DE Product feature CHAIN KM524336_HBe_P-RF-DE of FT:mat_peptide KM524336_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV010_EP-CHB). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAVYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KM524337_HBe_P-RF-DE Product feature CHAIN KM524337_HBe_P-RF-DE of FT:mat_peptide KM524337_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV013_EP-CHB). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KM524357_HBe_P-RF-DE Product feature CHAIN KM524357_HBe_P-RF-DE of FT:mat_peptide KM524357_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV.I-146_HIV-HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KM524359_HBe_P-RF-DE Product feature CHAIN KM524359_HBe_P-RF-DE of FT:mat_peptide KM524359_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EHBV.I-058_HIV-HBV). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KM577663_HBe_P-RF-DE Product feature CHAIN KM577663_HBe_P-RF-DE of FT:mat_peptide KM577663_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KM577664_HBe_P-RF-DE Product feature CHAIN KM577664_HBe_P-RF-DE of FT:mat_peptide KM577664_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NIR-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KM606750_HBe_P-RF-DE Product feature CHAIN KM606750_HBe_P-RF-DE of FT:mat_peptide KM606750_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Cuba60). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KM606751_HBe_P-RF-DE Product feature CHAIN KM606751_HBe_P-RF-DE of FT:mat_peptide KM606751_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Cuba64). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KM875422_HBe_P-RF-CB Product feature CHAIN KM875422_HBe_P-RF-CB of FT:mat_peptide KM875422_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate pt12N). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILSWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP148337_HBe_P-RF-BC Product feature CHAIN KP148337_HBe_P-RF-BC of FT:mat_peptide KP148337_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D282-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP148352_HBe_P-RF-CB Product feature CHAIN KP148352_HBe_P-RF-CB of FT:mat_peptide KP148352_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate D71-6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP148442_HBe_P-RF-BC Product feature CHAIN KP148442_HBe_P-RF-BC of FT:mat_peptide KP148442_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate Y132-2-5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVALLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP168416_HBe_P-RF-DE Product feature CHAIN KP168416_HBe_P-RF-DE of FT:mat_peptide KP168416_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD422). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP168417_HBe_P-RF-DE Product feature CHAIN KP168417_HBe_P-RF-DE of FT:mat_peptide KP168417_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD429). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP168418_HBe_P-RF-DE Product feature CHAIN KP168418_HBe_P-RF-DE of FT:mat_peptide KP168418_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ELD416). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP243541_HBe_P-RF-ED Product feature CHAIN KP243541_HBe_P-RF-ED of FT:mat_peptide KP243541_HBe_P-RF-ED of [Viruses] Hepatitis B Virus recombinant form ED (isolate 955843_NL_2011). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KP276253_HBe_P-RF-DC Product feature CHAIN KP276253_HBe_P-RF-DC of FT:mat_peptide KP276253_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1874). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP276254_HBe_P-RF-DC Product feature CHAIN KP276254_HBe_P-RF-DC of FT:mat_peptide KP276254_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1887). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP276255_HBe_P-RF-DC Product feature CHAIN KP276255_HBe_P-RF-DC of FT:mat_peptide KP276255_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1888). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP276256_HBe_P-RF-DC Product feature CHAIN KP276256_HBe_P-RF-DC of FT:mat_peptide KP276256_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate Tibet-1925). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KP995112_HBe_P-RF-DE Product feature CHAIN KP995112_HBe_P-RF-DE of FT:mat_peptide KP995112_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 1925-HCC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KR013816_HBe_P-RF-CB Product feature CHAIN KR013816_HBe_P-RF-CB of FT:mat_peptide KR013816_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KR905422_HBe_P-RF-DE Product feature CHAIN KR905422_HBe_P-RF-DE of FT:mat_peptide KR905422_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate EICI-4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT003704_HBe_P-RF-CB Product feature CHAIN KT003704_HBe_P-RF-CB of FT:mat_peptide KT003704_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate IND-DIB-RMRC-667). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT366492_HBe_P-RF-DE Product feature CHAIN KT366492_HBe_P-RF-DE of FT:mat_peptide KT366492_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.40). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT366503_HBe_P-RF-DE Product feature CHAIN KT366503_HBe_P-RF-DE of FT:mat_peptide KT366503_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT366504_HBe_P-RF-DE Product feature CHAIN KT366504_HBe_P-RF-DE of FT:mat_peptide KT366504_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KT366505_HBe_P-RF-DE Product feature CHAIN KT366505_HBe_P-RF-DE of FT:mat_peptide KT366505_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate C-EICI.17). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT991417_HBe_P-RF-DC Product feature CHAIN KT991417_HBe_P-RF-DC of FT:mat_peptide KT991417_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT991419_HBe_P-RF-DC Product feature CHAIN KT991419_HBe_P-RF-DC of FT:mat_peptide KT991419_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-21). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYEEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT991420_HBe_P-RF-DC Product feature CHAIN KT991420_HBe_P-RF-DC of FT:mat_peptide KT991420_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSSGVW
>gnl|hbvpro|KT991421_HBe_P-RF-DC Product feature CHAIN KT991421_HBe_P-RF-DC of FT:mat_peptide KT991421_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT991423_HBe_P-RF-DC Product feature CHAIN KT991423_HBe_P-RF-DC of FT:mat_peptide KT991423_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I137-8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KT991424_HBe_P-RF-DC Product feature CHAIN KT991424_HBe_P-RF-DC of FT:mat_peptide KT991424_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I113-1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRGTVLEYLVSFGVW
>gnl|hbvpro|KT991427_HBe_P-RF-DC Product feature CHAIN KT991427_HBe_P-RF-DC of FT:mat_peptide KT991427_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate I113-2-5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRGTVLEYLVSFGVW
>gnl|hbvpro|KU519422_HBe_P-RF-DC Product feature CHAIN KU519422_HBe_P-RF-DC of FT:mat_peptide KU519422_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetLinzhi-1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU519423_HBe_P-RF-DC Product feature CHAIN KU519423_HBe_P-RF-DC of FT:mat_peptide KU519423_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetLinzhi-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU577083_HBe_P-RF-BC Product feature CHAIN KU577083_HBe_P-RF-BC of FT:mat_peptide KU577083_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 29-6). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRELLDTASALYRDALESPEHCSPHHTALRQAILCWVELMSLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU668440_HBe_P-RF-DE Product feature CHAIN KU668440_HBe_P-RF-DE of FT:mat_peptide KU668440_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-HCV169). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLDDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|KU679939_HBe_P-RF-CB Product feature CHAIN KU679939_HBe_P-RF-CB of FT:mat_peptide KU679939_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 083_WA_Man). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU679940_HBe_P-RF-CB Product feature CHAIN KU679940_HBe_P-RF-CB of FT:mat_peptide KU679940_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 084_WA_Man). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQXLWFHISCLTFGXXTVLEYLVSFGVW
>gnl|hbvpro|KU679941_HBe_P-RF-CB Product feature CHAIN KU679941_HBe_P-RF-CB of FT:mat_peptide KU679941_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 087_WA_Jab). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU679942_HBe_P-RF-CB Product feature CHAIN KU679942_HBe_P-RF-CB of FT:mat_peptide KU679942_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 094_CA_Mim). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU679943_HBe_P-RF-BC Product feature CHAIN KU679943_HBe_P-RF-BC of FT:mat_peptide KU679943_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 096_CA_Mim). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWXMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVXYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU679944_HBe_P-RF-BC Product feature CHAIN KU679944_HBe_P-RF-BC of FT:mat_peptide KU679944_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 097_EA_Mil). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNXNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU679945_HBe_P-RF-CB Product feature CHAIN KU679945_HBe_P-RF-CB of FT:mat_peptide KU679945_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 098_DR_Wad). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTALALYRDALESPEXCSAHHTALRQAIVCWGELMNLAT
WVGSNLEDQASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU679946_HBe_P-RF-BC Product feature CHAIN KU679946_HBe_P-RF-BC of FT:mat_peptide KU679946_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 100_EA_Gal). Complete genome. [Hepadnaviridae] (length=135 residues).
SKQCLEWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU679948_HBe_P-RF-CB Product feature CHAIN KU679948_HBe_P-RF-CB of FT:mat_peptide KU679948_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 103_EA_Gap). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU679953_HBe_P-RF-BC Product feature CHAIN KU679953_HBe_P-RF-BC of FT:mat_peptide KU679953_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 116_EA_Num). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVX
>gnl|hbvpro|KU679954_HBe_P-RF-CB Product feature CHAIN KU679954_HBe_P-RF-CB of FT:mat_peptide KU679954_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 119_CA_Ood). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU679955_HBe_P-RF-CB Product feature CHAIN KU679955_HBe_P-RF-CB of FT:mat_peptide KU679955_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 120_K_Ngk). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTAAALYREALESPEHCSAHHTALRQAILCWGELMNLAT
WVGSNLEDXASRELVVSYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU679956_HBe_P-RF-CB Product feature CHAIN KU679956_HBe_P-RF-CB of FT:mat_peptide KU679956_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 121_CA_Tit). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLXGMDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAXLCWGELMNLAT
WVGSNLEDPASRELVVXYVNVNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU695741_HBe_P-RF-CB Product feature CHAIN KU695741_HBe_P-RF-CB of FT:mat_peptide KU695741_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5022). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU695742_HBe_P-RF-CB Product feature CHAIN KU695742_HBe_P-RF-CB of FT:mat_peptide KU695742_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5072). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU695743_HBe_P-RF-CB Product feature CHAIN KU695743_HBe_P-RF-CB of FT:mat_peptide KU695743_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5073). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU695744_HBe_P-RF-CB Product feature CHAIN KU695744_HBe_P-RF-CB of FT:mat_peptide KU695744_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5075). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU695745_HBe_P-RF-CB Product feature CHAIN KU695745_HBe_P-RF-CB of FT:mat_peptide KU695745_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5081). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNINMGLKLRQILWFHVSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU695746_HBe_P-RF-CB Product feature CHAIN KU695746_HBe_P-RF-CB of FT:mat_peptide KU695746_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 5093). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU736914_HBe_P-RF-DE Product feature CHAIN KU736914_HBe_P-RF-DE of FT:mat_peptide KU736914_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVX
>gnl|hbvpro|KU736916_HBe_P-RF-DE Product feature CHAIN KU736916_HBe_P-RF-DE of FT:mat_peptide KU736916_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Sudan_11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMSLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736917_HBe_P-RF-DE Product feature CHAIN KU736917_HBe_P-RF-DE of FT:mat_peptide KU736917_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Sudan_19). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU736921_HBe_P-RF-DE Product feature CHAIN KU736921_HBe_P-RF-DE of FT:mat_peptide KU736921_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALXSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEBPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVW
>gnl|hbvpro|KU736922_HBe_P-RF-DE Product feature CHAIN KU736922_HBe_P-RF-DE of FT:mat_peptide KU736922_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Ethiopia_5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVW
>gnl|hbvpro|KU736923_HBe_P-RF-DE Product feature CHAIN KU736923_HBe_P-RF-DE of FT:mat_peptide KU736923_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate Somalia_1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KU963990_HBe_P-RF-CB Product feature CHAIN KU963990_HBe_P-RF-CB of FT:mat_peptide KU963990_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU963991_HBe_P-RF-CB Product feature CHAIN KU963991_HBe_P-RF-CB of FT:mat_peptide KU963991_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU963993_HBe_P-RF-CB Product feature CHAIN KU963993_HBe_P-RF-CB of FT:mat_peptide KU963993_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU963994_HBe_P-RF-CB Product feature CHAIN KU963994_HBe_P-RF-CB of FT:mat_peptide KU963994_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU963995_HBe_P-RF-CB Product feature CHAIN KU963995_HBe_P-RF-CB of FT:mat_peptide KU963995_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU963998_HBe_P-RF-CB Product feature CHAIN KU963998_HBe_P-RF-CB of FT:mat_peptide KU963998_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU963999_HBe_P-RF-CB Product feature CHAIN KU963999_HBe_P-RF-CB of FT:mat_peptide KU963999_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964001_HBe_P-RF-CB Product feature CHAIN KU964001_HBe_P-RF-CB of FT:mat_peptide KU964001_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964003_HBe_P-RF-CB Product feature CHAIN KU964003_HBe_P-RF-CB of FT:mat_peptide KU964003_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 14_14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964005_HBe_P-RF-CB Product feature CHAIN KU964005_HBe_P-RF-CB of FT:mat_peptide KU964005_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964006_HBe_P-RF-CB Product feature CHAIN KU964006_HBe_P-RF-CB of FT:mat_peptide KU964006_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFLISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964007_HBe_P-RF-CB Product feature CHAIN KU964007_HBe_P-RF-CB of FT:mat_peptide KU964007_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964008_HBe_P-RF-CB Product feature CHAIN KU964008_HBe_P-RF-CB of FT:mat_peptide KU964008_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964009_HBe_P-RF-CB Product feature CHAIN KU964009_HBe_P-RF-CB of FT:mat_peptide KU964009_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964010_HBe_P-RF-CB Product feature CHAIN KU964010_HBe_P-RF-CB of FT:mat_peptide KU964010_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 15_7). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHGSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964303_HBe_P-RF-CB Product feature CHAIN KU964303_HBe_P-RF-CB of FT:mat_peptide KU964303_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964304_HBe_P-RF-CB Product feature CHAIN KU964304_HBe_P-RF-CB of FT:mat_peptide KU964304_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964305_HBe_P-RF-CB Product feature CHAIN KU964305_HBe_P-RF-CB of FT:mat_peptide KU964305_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964306_HBe_P-RF-CB Product feature CHAIN KU964306_HBe_P-RF-CB of FT:mat_peptide KU964306_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964307_HBe_P-RF-CB Product feature CHAIN KU964307_HBe_P-RF-CB of FT:mat_peptide KU964307_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964308_HBe_P-RF-CB Product feature CHAIN KU964308_HBe_P-RF-CB of FT:mat_peptide KU964308_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964309_HBe_P-RF-CB Product feature CHAIN KU964309_HBe_P-RF-CB of FT:mat_peptide KU964309_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_7). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964310_HBe_P-RF-CB Product feature CHAIN KU964310_HBe_P-RF-CB of FT:mat_peptide KU964310_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964311_HBe_P-RF-CB Product feature CHAIN KU964311_HBe_P-RF-CB of FT:mat_peptide KU964311_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964312_HBe_P-RF-CB Product feature CHAIN KU964312_HBe_P-RF-CB of FT:mat_peptide KU964312_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964313_HBe_P-RF-CB Product feature CHAIN KU964313_HBe_P-RF-CB of FT:mat_peptide KU964313_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964314_HBe_P-RF-CB Product feature CHAIN KU964314_HBe_P-RF-CB of FT:mat_peptide KU964314_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964315_HBe_P-RF-CB Product feature CHAIN KU964315_HBe_P-RF-CB of FT:mat_peptide KU964315_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_13). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964316_HBe_P-RF-CB Product feature CHAIN KU964316_HBe_P-RF-CB of FT:mat_peptide KU964316_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KU964317_HBe_P-RF-CB Product feature CHAIN KU964317_HBe_P-RF-CB of FT:mat_peptide KU964317_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 36_15). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX354997_HBe_P-RF-DC Product feature CHAIN KX354997_HBe_P-RF-DC of FT:mat_peptide KX354997_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate B118_2012_CD). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX357623_HBe_P-RF-DE Product feature CHAIN KX357623_HBe_P-RF-DE of FT:mat_peptide KX357623_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BL43ETH). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KX357628_HBe_P-RF-DE Product feature CHAIN KX357628_HBe_P-RF-DE of FT:mat_peptide KX357628_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BL70ETH). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVQLLSFLPADFFPSVRDLLDTASALYRDALESPEHCTPHHTALRQAILCWGDVLSLAT
WVGVNLEDPASRDLVVGYVNNNMGLKFRQLLWFHLSCLMFGRETVVEYLVSFGVW
>gnl|hbvpro|KX357630_HBe_P-RF-DE Product feature CHAIN KX357630_HBe_P-RF-DE of FT:mat_peptide KX357630_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA124ETH). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KX357632_HBe_P-RF-DE Product feature CHAIN KX357632_HBe_P-RF-DE of FT:mat_peptide KX357632_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA141ETH). Partial genome (Contains: HBe, HBc, HBx, SHBs, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTHMGLKFRQLLWFHISCLTFGREIVLEYLVSFGVW
>gnl|hbvpro|KX357634_HBe_P-RF-DE Product feature CHAIN KX357634_HBe_P-RF-DE of FT:mat_peptide KX357634_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate AA33ETH). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX660674_HBe_P-RF-DC Product feature CHAIN KX660674_HBe_P-RF-DC of FT:mat_peptide KX660674_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX660675_HBe_P-RF-DC Product feature CHAIN KX660675_HBe_P-RF-DC of FT:mat_peptide KX660675_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX660677_HBe_P-RF-DC Product feature CHAIN KX660677_HBe_P-RF-DC of FT:mat_peptide KX660677_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX660680_HBe_P-RF-DC Product feature CHAIN KX660680_HBe_P-RF-DC of FT:mat_peptide KX660680_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetAli-2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX660682_HBe_P-RF-DC Product feature CHAIN KX660682_HBe_P-RF-DC of FT:mat_peptide KX660682_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetLahsa). Partial genome (Contains: HBe, HBc, HBx, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLXDTASALYREALEXPEHCSPHHTALRQAIXCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX660684_HBe_P-RF-DC Product feature CHAIN KX660684_HBe_P-RF-DC of FT:mat_peptide KX660684_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetShannan-5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX660685_HBe_P-RF-DC Product feature CHAIN KX660685_HBe_P-RF-DC of FT:mat_peptide KX660685_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetShannan-6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX660689_HBe_P-RF-DC Product feature CHAIN KX660689_HBe_P-RF-DC of FT:mat_peptide KX660689_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TibetRikaze-5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KX827299_HBe_P-RF-DE Product feature CHAIN KX827299_HBe_P-RF-DE of FT:mat_peptide KX827299_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate geno20.11). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|KX827302_HBe_P-RF-DE Product feature CHAIN KX827302_HBe_P-RF-DE of FT:mat_peptide KX827302_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate geno31.9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATLELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGANLEDPASRDLVVSYVNTNMGLKFRQLLWFHTSCLTFGRDTVVEYLVSFGVW
>gnl|hbvpro|KY363262_HBe_P-RF-CB Product feature CHAIN KY363262_HBe_P-RF-CB of FT:mat_peptide KY363262_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate geno6.1). Partial genome (Contains: HBe, HBc, HBx, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY363263_HBe_P-RF-CB Product feature CHAIN KY363263_HBe_P-RF-CB of FT:mat_peptide KY363263_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate geno6.3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDQASRDLVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470843_HBe_P-RF-DC Product feature CHAIN KY470843_HBe_P-RF-DC of FT:mat_peptide KY470843_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-10-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470844_HBe_P-RF-DC Product feature CHAIN KY470844_HBe_P-RF-DC of FT:mat_peptide KY470844_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-109). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470846_HBe_P-RF-DC Product feature CHAIN KY470846_HBe_P-RF-DC of FT:mat_peptide KY470846_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-118). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470847_HBe_P-RF-DC Product feature CHAIN KY470847_HBe_P-RF-DC of FT:mat_peptide KY470847_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-120). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470849_HBe_P-RF-DC Product feature CHAIN KY470849_HBe_P-RF-DC of FT:mat_peptide KY470849_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-123). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470850_HBe_P-RF-DC Product feature CHAIN KY470850_HBe_P-RF-DC of FT:mat_peptide KY470850_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-124). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470853_HBe_P-RF-DC Product feature CHAIN KY470853_HBe_P-RF-DC of FT:mat_peptide KY470853_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470854_HBe_P-RF-DC Product feature CHAIN KY470854_HBe_P-RF-DC of FT:mat_peptide KY470854_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-8). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470855_HBe_P-RF-DC Product feature CHAIN KY470855_HBe_P-RF-DC of FT:mat_peptide KY470855_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-9-3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470856_HBe_P-RF-DC Product feature CHAIN KY470856_HBe_P-RF-DC of FT:mat_peptide KY470856_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate 15-X-1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQDILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY470893_HBe_P-RF-CB Product feature CHAIN KY470893_HBe_P-RF-CB of FT:mat_peptide KY470893_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 24-B1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGTSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY670781_HBe_P-RF-DC Product feature CHAIN KY670781_HBe_P-RF-DC of FT:mat_peptide KY670781_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate TYM01067). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKITQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|KY881840_HBe_P-RF-CB Product feature CHAIN KY881840_HBe_P-RF-CB of FT:mat_peptide KY881840_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate patient-03). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC279263_HBe_P-RF-CB Product feature CHAIN LC279263_HBe_P-RF-CB of FT:mat_peptide LC279263_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_child_nail). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC279264_HBe_P-RF-CB Product feature CHAIN LC279264_HBe_P-RF-CB of FT:mat_peptide LC279264_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_father_hair). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC279265_HBe_P-RF-CB Product feature CHAIN LC279265_HBe_P-RF-CB of FT:mat_peptide LC279265_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_father_nail). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC279266_HBe_P-RF-CB Product feature CHAIN LC279266_HBe_P-RF-CB of FT:mat_peptide LC279266_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi_father_serum). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC279267_HBe_P-RF-CB Product feature CHAIN LC279267_HBe_P-RF-CB of FT:mat_peptide LC279267_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Hi-child_serum). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC416040_HBe_P-RF-CB Product feature CHAIN LC416040_HBe_P-RF-CB of FT:mat_peptide LC416040_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate CT_1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LC458432_HBe_P-RF-CB Product feature CHAIN LC458432_HBe_P-RF-CB of FT:mat_peptide LC458432_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate JRC-HB02). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|LK995391_HBe_P-RF-ED Product feature CHAIN LK995391_HBe_P-RF-ED of FT:mat_peptide LK995391_HBe_P-RF-ED of [Viruses] Hepatitis B Virus recombinant form ED (isolate NAT2037631). Partial genome (Contains: HBe, HBc, HBx, Pol, HBSP). [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|M38454_HBe_P-RF-CB Product feature CHAIN M38454_HBe_P-RF-CB of FT:mat_peptide M38454_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWRELMNLAT
WVGSNLEDPASRELVVSYVNVNIGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF488699_HBe_P-RF-DE Product feature CHAIN MF488699_HBe_P-RF-DE of FT:mat_peptide MF488699_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-CRP058). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSSHHTALRQSVLCWRELMTLAT
WVGTNLEDPASRDLVVSYVDTNMGLKFRQLLWFHISCLTFGRDTFLEYLVAFGVS
>gnl|hbvpro|MF488702_HBe_P-RF-DE Product feature CHAIN MF488702_HBe_P-RF-DE of FT:mat_peptide MF488702_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-PCP015). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLRWIWGMDIDTYKEFGATVEILSFLSPDFFPSLRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MF488705_HBe_P-RF-AD Product feature CHAIN MF488705_HBe_P-RF-AD of FT:mat_peptide MF488705_HBe_P-RF-AD of [Viruses] Hepatitis B Virus recombinant form AD (isolate OHBV-PCP243). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGNNLQDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRQTVLEYLVSFGVW
>gnl|hbvpro|MF618346_HBe_P-RF-DE Product feature CHAIN MF618346_HBe_P-RF-DE of FT:mat_peptide MF618346_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-HIV076). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF618347_HBe_P-RF-DE Product feature CHAIN MF618347_HBe_P-RF-DE of FT:mat_peptide MF618347_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate OHBV-HIV078). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGTNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF925360_HBe_P-RF-DB Product feature CHAIN MF925360_HBe_P-RF-DB of FT:mat_peptide MF925360_HBe_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV03). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPADFFPSVRALLDTASALYREALESPEHCSSHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVLDYLVSFGVW
>gnl|hbvpro|MF925370_HBe_P-RF-CB Product feature CHAIN MF925370_HBe_P-RF-CB of FT:mat_peptide MF925370_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate BD-HBV14). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF925371_HBe_P-RF-DC Product feature CHAIN MF925371_HBe_P-RF-DC of FT:mat_peptide MF925371_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV15). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNDNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MF925386_HBe_P-RF-AC Product feature CHAIN MF925386_HBe_P-RF-AC of FT:mat_peptide MF925386_HBe_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate BD-HBV30). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVGDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|MF925388_HBe_P-RF-DC Product feature CHAIN MF925388_HBe_P-RF-DC of FT:mat_peptide MF925388_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV32). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MF925389_HBe_P-RF-DC Product feature CHAIN MF925389_HBe_P-RF-DC of FT:mat_peptide MF925389_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV33). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF925392_HBe_P-RF-DB Product feature CHAIN MF925392_HBe_P-RF-DB of FT:mat_peptide MF925392_HBe_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV37). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MF925396_HBe_P-RF-DC Product feature CHAIN MF925396_HBe_P-RF-DC of FT:mat_peptide MF925396_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV42). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDQVVSYVNTNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVW
>gnl|hbvpro|MF925397_HBe_P-RF-DC Product feature CHAIN MF925397_HBe_P-RF-DC of FT:mat_peptide MF925397_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate BD-HBV43). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF925401_HBe_P-RF-DB Product feature CHAIN MF925401_HBe_P-RF-DB of FT:mat_peptide MF925401_HBe_P-RF-DB of [Viruses] Hepatitis B Virus recombinant form DB (isolate BD-HBV47). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWAELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF925404_HBe_P-RF-AC Product feature CHAIN MF925404_HBe_P-RF-AC of FT:mat_peptide MF925404_HBe_P-RF-AC of [Viruses] Hepatitis B Virus recombinant form AC (isolate BD-HBV50). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MF967563_HBe_P-RF-DE Product feature CHAIN MF967563_HBe_P-RF-DE of FT:mat_peptide MF967563_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MG826144_HBe_P-RF-CB Product feature CHAIN MG826144_HBe_P-RF-CB of FT:mat_peptide MG826144_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM21). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MG826145_HBe_P-RF-BC Product feature CHAIN MG826145_HBe_P-RF-BC of FT:mat_peptide MG826145_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MG826146_HBe_P-RF-CB Product feature CHAIN MG826146_HBe_P-RF-CB of FT:mat_peptide MG826146_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM40H). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MG826147_HBe_P-RF-CB Product feature CHAIN MG826147_HBe_P-RF-CB of FT:mat_peptide MG826147_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM19H). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MG826148_HBe_P-RF-CB Product feature CHAIN MG826148_HBe_P-RF-CB of FT:mat_peptide MG826148_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate YNKM50). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MG826151_HBe_P-RF-BC Product feature CHAIN MG826151_HBe_P-RF-BC of FT:mat_peptide MG826151_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM26H). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MG893554_HBe_P-RF-CB Product feature CHAIN MG893554_HBe_P-RF-CB of FT:mat_peptide MG893554_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14021). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MG893555_HBe_P-RF-CB Product feature CHAIN MG893555_HBe_P-RF-CB of FT:mat_peptide MG893555_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14022). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MG893559_HBe_P-RF-CB Product feature CHAIN MG893559_HBe_P-RF-CB of FT:mat_peptide MG893559_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14052). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MG893561_HBe_P-RF-CB Product feature CHAIN MG893561_HBe_P-RF-CB of FT:mat_peptide MG893561_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SD14075). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASGKLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH094410_HBe_P-RF-BC Product feature CHAIN MH094410_HBe_P-RF-BC of FT:mat_peptide MH094410_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate J61). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH464846_HBe_P-RF-DE Product feature CHAIN MH464846_HBe_P-RF-DE of FT:mat_peptide MH464846_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA124). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH464851_HBe_P-RF-DE Product feature CHAIN MH464851_HBe_P-RF-DE of FT:mat_peptide MH464851_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA129). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH464852_HBe_P-RF-DE Product feature CHAIN MH464852_HBe_P-RF-DE of FT:mat_peptide MH464852_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate MA130). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH481858_HBe_P-RF-DE Product feature CHAIN MH481858_HBe_P-RF-DE of FT:mat_peptide MH481858_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH481859_HBe_P-RF-DE Product feature CHAIN MH481859_HBe_P-RF-DE of FT:mat_peptide MH481859_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH481860_HBe_P-RF-DE Product feature CHAIN MH481860_HBe_P-RF-DE of FT:mat_peptide MH481860_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRGTVLGYLVSFGVW
>gnl|hbvpro|MH481861_HBe_P-RF-DE Product feature CHAIN MH481861_HBe_P-RF-DE of FT:mat_peptide MH481861_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH481862_HBe_P-RF-DE Product feature CHAIN MH481862_HBe_P-RF-DE of FT:mat_peptide MH481862_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate ZADGM6964C6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDSDPYKEFGATMELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH685719_HBe_P-RF-DE Product feature CHAIN MH685719_HBe_P-RF-DE of FT:mat_peptide MH685719_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate E0-055). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH724222_HBe_P-RF-DE Product feature CHAIN MH724222_HBe_P-RF-DE of FT:mat_peptide MH724222_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BR12). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MH746811_HBe_P-RF-BC Product feature CHAIN MH746811_HBe_P-RF-BC of FT:mat_peptide MH746811_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91_1). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH746812_HBe_P-RF-BC Product feature CHAIN MH746812_HBe_P-RF-BC of FT:mat_peptide MH746812_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91_2). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MH746813_HBe_P-RF-BC Product feature CHAIN MH746813_HBe_P-RF-BC of FT:mat_peptide MH746813_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate YNKM91_3). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK052967_HBe_P-RF-BD Product feature CHAIN MK052967_HBe_P-RF-BD of FT:mat_peptide MK052967_HBe_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSSLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK052968_HBe_P-RF-BD Product feature CHAIN MK052968_HBe_P-RF-BD of FT:mat_peptide MK052968_HBe_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-7). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFRVW
>gnl|hbvpro|MK052969_HBe_P-RF-DE Product feature CHAIN MK052969_HBe_P-RF-DE of FT:mat_peptide MK052969_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NP137Q-8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Hepadnaviridae] (length=134 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGANLDPVSRDLVVSYVNTNMGLKFRQLLRFHYSCLTFGRDTVLNYLVSFGVW
>gnl|hbvpro|MK052970_HBe_P-RF-BD Product feature CHAIN MK052970_HBe_P-RF-BD of FT:mat_peptide MK052970_HBe_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRKLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLKYLVSFGVW
>gnl|hbvpro|MK052976_HBe_P-RF-BD Product feature CHAIN MK052976_HBe_P-RF-BD of FT:mat_peptide MK052976_HBe_P-RF-BD of [Viruses] Hepatitis B Virus recombinant form BD (isolate NP137Q-20). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTAIRQAILCWGELMTLAT
WVGTNLEDPASRDLIVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK321265_HBe_P-RF-CB Product feature CHAIN MK321265_HBe_P-RF-CB of FT:mat_peptide MK321265_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1331). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK516279_HBe_P-RF-DE Product feature CHAIN MK516279_HBe_P-RF-DE of FT:mat_peptide MK516279_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 012/14/0533). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK516280_HBe_P-RF-DE Product feature CHAIN MK516280_HBe_P-RF-DE of FT:mat_peptide MK516280_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 012/15/4535). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGTNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534555_HBe_P-RF-BC Product feature CHAIN MK534555_HBe_P-RF-BC of FT:mat_peptide MK534555_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 406). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLAT
WVGSNLDDPTSREAIVGYVNVNMGIKIRQLLWFHISCLTFGRTTVLEYLVSFGVW
>gnl|hbvpro|MK534556_HBe_P-RF-BC Product feature CHAIN MK534556_HBe_P-RF-BC of FT:mat_peptide MK534556_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 407). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534558_HBe_P-RF-BC Product feature CHAIN MK534558_HBe_P-RF-BC of FT:mat_peptide MK534558_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 412). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534559_HBe_P-RF-BC Product feature CHAIN MK534559_HBe_P-RF-BC of FT:mat_peptide MK534559_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 416). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534560_HBe_P-RF-CB Product feature CHAIN MK534560_HBe_P-RF-CB of FT:mat_peptide MK534560_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 440). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534561_HBe_P-RF-BC Product feature CHAIN MK534561_HBe_P-RF-BC of FT:mat_peptide MK534561_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 442). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534562_HBe_P-RF-BC Product feature CHAIN MK534562_HBe_P-RF-BC of FT:mat_peptide MK534562_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 448). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534563_HBe_P-RF-BC Product feature CHAIN MK534563_HBe_P-RF-BC of FT:mat_peptide MK534563_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 449). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534564_HBe_P-RF-BC Product feature CHAIN MK534564_HBe_P-RF-BC of FT:mat_peptide MK534564_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 454). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534566_HBe_P-RF-BC Product feature CHAIN MK534566_HBe_P-RF-BC of FT:mat_peptide MK534566_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 457). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534567_HBe_P-RF-BC Product feature CHAIN MK534567_HBe_P-RF-BC of FT:mat_peptide MK534567_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 458). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534568_HBe_P-RF-BC Product feature CHAIN MK534568_HBe_P-RF-BC of FT:mat_peptide MK534568_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 459). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534569_HBe_P-RF-BC Product feature CHAIN MK534569_HBe_P-RF-BC of FT:mat_peptide MK534569_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 462). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534574_HBe_P-RF-CB Product feature CHAIN MK534574_HBe_P-RF-CB of FT:mat_peptide MK534574_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 479). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534577_HBe_P-RF-BC Product feature CHAIN MK534577_HBe_P-RF-BC of FT:mat_peptide MK534577_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 489). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534579_HBe_P-RF-BC Product feature CHAIN MK534579_HBe_P-RF-BC of FT:mat_peptide MK534579_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 493). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534580_HBe_P-RF-BC Product feature CHAIN MK534580_HBe_P-RF-BC of FT:mat_peptide MK534580_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 497). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534582_HBe_P-RF-BC Product feature CHAIN MK534582_HBe_P-RF-BC of FT:mat_peptide MK534582_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 502). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLAT
WVGSNLDDPASRELVVGYVNVNMGLKFRQLLWFHISCLTFGQETVLEYLVSFGVW
>gnl|hbvpro|MK534583_HBe_P-RF-BC Product feature CHAIN MK534583_HBe_P-RF-BC of FT:mat_peptide MK534583_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 503). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREPLESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASREAVVNYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MK534584_HBe_P-RF-BC Product feature CHAIN MK534584_HBe_P-RF-BC of FT:mat_peptide MK534584_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 504). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPHKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534589_HBe_P-RF-BC Product feature CHAIN MK534589_HBe_P-RF-BC of FT:mat_peptide MK534589_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 510). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534590_HBe_P-RF-BC Product feature CHAIN MK534590_HBe_P-RF-BC of FT:mat_peptide MK534590_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 511). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATAMYREALESPVHGSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534598_HBe_P-RF-BC Product feature CHAIN MK534598_HBe_P-RF-BC of FT:mat_peptide MK534598_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate 556). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534606_HBe_P-RF-BC Product feature CHAIN MK534606_HBe_P-RF-BC of FT:mat_peptide MK534606_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D404). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534607_HBe_P-RF-BC Product feature CHAIN MK534607_HBe_P-RF-BC of FT:mat_peptide MK534607_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D405). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534609_HBe_P-RF-BC Product feature CHAIN MK534609_HBe_P-RF-BC of FT:mat_peptide MK534609_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D410). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534610_HBe_P-RF-BC Product feature CHAIN MK534610_HBe_P-RF-BC of FT:mat_peptide MK534610_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D411). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534615_HBe_P-RF-BC Product feature CHAIN MK534615_HBe_P-RF-BC of FT:mat_peptide MK534615_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D420). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELISFLPADFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534616_HBe_P-RF-BC Product feature CHAIN MK534616_HBe_P-RF-BC of FT:mat_peptide MK534616_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D422). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534617_HBe_P-RF-BC Product feature CHAIN MK534617_HBe_P-RF-BC of FT:mat_peptide MK534617_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D423). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534618_HBe_P-RF-BC Product feature CHAIN MK534618_HBe_P-RF-BC of FT:mat_peptide MK534618_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D424). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534620_HBe_P-RF-BC Product feature CHAIN MK534620_HBe_P-RF-BC of FT:mat_peptide MK534620_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D427). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534623_HBe_P-RF-BC Product feature CHAIN MK534623_HBe_P-RF-BC of FT:mat_peptide MK534623_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D431). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534625_HBe_P-RF-BC Product feature CHAIN MK534625_HBe_P-RF-BC of FT:mat_peptide MK534625_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D433). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534630_HBe_P-RF-BC Product feature CHAIN MK534630_HBe_P-RF-BC of FT:mat_peptide MK534630_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D448). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534632_HBe_P-RF-CB Product feature CHAIN MK534632_HBe_P-RF-CB of FT:mat_peptide MK534632_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate D452). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWVELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534633_HBe_P-RF-BC Product feature CHAIN MK534633_HBe_P-RF-BC of FT:mat_peptide MK534633_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D453). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534635_HBe_P-RF-BC Product feature CHAIN MK534635_HBe_P-RF-BC of FT:mat_peptide MK534635_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D456). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWVELMNLAT
WVGGNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534637_HBe_P-RF-BC Product feature CHAIN MK534637_HBe_P-RF-BC of FT:mat_peptide MK534637_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D459). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534639_HBe_P-RF-BC Product feature CHAIN MK534639_HBe_P-RF-BC of FT:mat_peptide MK534639_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D465). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534641_HBe_P-RF-BC Product feature CHAIN MK534641_HBe_P-RF-BC of FT:mat_peptide MK534641_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D470). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534646_HBe_P-RF-BC Product feature CHAIN MK534646_HBe_P-RF-BC of FT:mat_peptide MK534646_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D477). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534648_HBe_P-RF-BC Product feature CHAIN MK534648_HBe_P-RF-BC of FT:mat_peptide MK534648_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D482). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534651_HBe_P-RF-BC Product feature CHAIN MK534651_HBe_P-RF-BC of FT:mat_peptide MK534651_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D492). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534653_HBe_P-RF-BC Product feature CHAIN MK534653_HBe_P-RF-BC of FT:mat_peptide MK534653_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D496). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534654_HBe_P-RF-BC Product feature CHAIN MK534654_HBe_P-RF-BC of FT:mat_peptide MK534654_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D498). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534655_HBe_P-RF-BC Product feature CHAIN MK534655_HBe_P-RF-BC of FT:mat_peptide MK534655_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D499). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534662_HBe_P-RF-BC Product feature CHAIN MK534662_HBe_P-RF-BC of FT:mat_peptide MK534662_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D506). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534663_HBe_P-RF-CB Product feature CHAIN MK534663_HBe_P-RF-CB of FT:mat_peptide MK534663_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate D509). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534664_HBe_P-RF-BC Product feature CHAIN MK534664_HBe_P-RF-BC of FT:mat_peptide MK534664_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D511). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534669_HBe_P-RF-CB Product feature CHAIN MK534669_HBe_P-RF-CB of FT:mat_peptide MK534669_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate D520). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMTLAT
WVGSNLEDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534670_HBe_P-RF-BC Product feature CHAIN MK534670_HBe_P-RF-BC of FT:mat_peptide MK534670_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D521). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534672_HBe_P-RF-BC Product feature CHAIN MK534672_HBe_P-RF-BC of FT:mat_peptide MK534672_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D524). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534681_HBe_P-RF-BC Product feature CHAIN MK534681_HBe_P-RF-BC of FT:mat_peptide MK534681_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D585). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534682_HBe_P-RF-CB Product feature CHAIN MK534682_HBe_P-RF-CB of FT:mat_peptide MK534682_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate D586). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534684_HBe_P-RF-BC Product feature CHAIN MK534684_HBe_P-RF-BC of FT:mat_peptide MK534684_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D588). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534685_HBe_P-RF-BC Product feature CHAIN MK534685_HBe_P-RF-BC of FT:mat_peptide MK534685_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D591). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534686_HBe_P-RF-BC Product feature CHAIN MK534686_HBe_P-RF-BC of FT:mat_peptide MK534686_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D595). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSAHHTALRQAILCWGELMNLAT
WVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534687_HBe_P-RF-BC Product feature CHAIN MK534687_HBe_P-RF-BC of FT:mat_peptide MK534687_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D601). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534688_HBe_P-RF-BC Product feature CHAIN MK534688_HBe_P-RF-BC of FT:mat_peptide MK534688_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D604). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534689_HBe_P-RF-BC Product feature CHAIN MK534689_HBe_P-RF-BC of FT:mat_peptide MK534689_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D702). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534690_HBe_P-RF-BC Product feature CHAIN MK534690_HBe_P-RF-BC of FT:mat_peptide MK534690_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate D705). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534695_HBe_P-RF-BC Product feature CHAIN MK534695_HBe_P-RF-BC of FT:mat_peptide MK534695_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H409). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534706_HBe_P-RF-CB Product feature CHAIN MK534706_HBe_P-RF-CB of FT:mat_peptide MK534706_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate H426). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534712_HBe_P-RF-BC Product feature CHAIN MK534712_HBe_P-RF-BC of FT:mat_peptide MK534712_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H509). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534713_HBe_P-RF-CB Product feature CHAIN MK534713_HBe_P-RF-CB of FT:mat_peptide MK534713_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate H510). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGREVVLEYLVSFGVW
>gnl|hbvpro|MK534714_HBe_P-RF-BC Product feature CHAIN MK534714_HBe_P-RF-BC of FT:mat_peptide MK534714_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H512). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534715_HBe_P-RF-BC Product feature CHAIN MK534715_HBe_P-RF-BC of FT:mat_peptide MK534715_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H513). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHGTPHHTALRQAIVCWGELMNLAT
WVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLDYLVSFGVW
>gnl|hbvpro|MK534716_HBe_P-RF-BC Product feature CHAIN MK534716_HBe_P-RF-BC of FT:mat_peptide MK534716_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H514). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534717_HBe_P-RF-CB Product feature CHAIN MK534717_HBe_P-RF-CB of FT:mat_peptide MK534717_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate H516). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534718_HBe_P-RF-BC Product feature CHAIN MK534718_HBe_P-RF-BC of FT:mat_peptide MK534718_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H518). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534719_HBe_P-RF-CB Product feature CHAIN MK534719_HBe_P-RF-CB of FT:mat_peptide MK534719_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate H519). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLDDPASREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MK534721_HBe_P-RF-BC Product feature CHAIN MK534721_HBe_P-RF-BC of FT:mat_peptide MK534721_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H521). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWDELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534722_HBe_P-RF-BC Product feature CHAIN MK534722_HBe_P-RF-BC of FT:mat_peptide MK534722_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H523). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534723_HBe_P-RF-BC Product feature CHAIN MK534723_HBe_P-RF-BC of FT:mat_peptide MK534723_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H524). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534724_HBe_P-RF-CB Product feature CHAIN MK534724_HBe_P-RF-CB of FT:mat_peptide MK534724_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate H526). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534726_HBe_P-RF-BC Product feature CHAIN MK534726_HBe_P-RF-BC of FT:mat_peptide MK534726_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H529). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFSPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534728_HBe_P-RF-BC Product feature CHAIN MK534728_HBe_P-RF-BC of FT:mat_peptide MK534728_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H532). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSAHHTALRQAILCWGELMNLAT
WVGSNLEDPASREAVVRYVNVNMGLKLRQILWFHISCLTFGKETVLEYLVSFGVW
>gnl|hbvpro|MK534729_HBe_P-RF-BC Product feature CHAIN MK534729_HBe_P-RF-BC of FT:mat_peptide MK534729_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H533). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534730_HBe_P-RF-BC Product feature CHAIN MK534730_HBe_P-RF-BC of FT:mat_peptide MK534730_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H534). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDSFPSIHDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534731_HBe_P-RF-BC Product feature CHAIN MK534731_HBe_P-RF-BC of FT:mat_peptide MK534731_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H535). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534734_HBe_P-RF-BC Product feature CHAIN MK534734_HBe_P-RF-BC of FT:mat_peptide MK534734_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H538). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534735_HBe_P-RF-CB Product feature CHAIN MK534735_HBe_P-RF-CB of FT:mat_peptide MK534735_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate H539). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK534736_HBe_P-RF-BC Product feature CHAIN MK534736_HBe_P-RF-BC of FT:mat_peptide MK534736_HBe_P-RF-BC of [Viruses] Hepatitis B Virus recombinant form BC (isolate H543). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK598652_HBe_P-RF-DE Product feature CHAIN MK598652_HBe_P-RF-DE of FT:mat_peptide MK598652_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_occult_VNovg25). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK598653_HBe_P-RF-DE Product feature CHAIN MK598653_HBe_P-RF-DE of FT:mat_peptide MK598653_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_occult_VNovg73). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMNLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK598654_HBe_P-RF-DE Product feature CHAIN MK598654_HBe_P-RF-DE of FT:mat_peptide MK598654_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_occult_VNovg9). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK598656_HBe_P-RF-DE Product feature CHAIN MK598656_HBe_P-RF-DE of FT:mat_peptide MK598656_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_occult_VNovg4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK618438_HBe_P-RF-DE Product feature CHAIN MK618438_HBe_P-RF-DE of FT:mat_peptide MK618438_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_occult_Arkh10). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK618439_HBe_P-RF-DE Product feature CHAIN MK618439_HBe_P-RF-DE of FT:mat_peptide MK618439_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_occult_Arkh27). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK618440_HBe_P-RF-DE Product feature CHAIN MK618440_HBe_P-RF-DE of FT:mat_peptide MK618440_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_occult_Arkh31). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK618442_HBe_P-RF-DE Product feature CHAIN MK618442_HBe_P-RF-DE of FT:mat_peptide MK618442_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_occult_Arkh29). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK618444_HBe_P-RF-DE Product feature CHAIN MK618444_HBe_P-RF-DE of FT:mat_peptide MK618444_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_occult_Arkh40). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK618445_HBe_P-RF-DE Product feature CHAIN MK618445_HBe_P-RF-DE of FT:mat_peptide MK618445_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HBV_occult_Arkh30). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MK720627_HBe_P-RF-CB Product feature CHAIN MK720627_HBe_P-RF-CB of FT:mat_peptide MK720627_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate p1331_RCA). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MK720628_HBe_P-RF-CB Product feature CHAIN MK720628_HBe_P-RF-CB of FT:mat_peptide MK720628_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate p1331_CL). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN507835_HBe_P-RF-DE Product feature CHAIN MN507835_HBe_P-RF-DE of FT:mat_peptide MN507835_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 954_ocHBVd_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN507850_HBe_P-RF-DE Product feature CHAIN MN507850_HBe_P-RF-DE of FT:mat_peptide MN507850_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 2526_ocHBVd_GC). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MN650068_HBe_P-RF-DC Product feature CHAIN MN650068_HBe_P-RF-DC of FT:mat_peptide MN650068_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN753). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKFRTLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650069_HBe_P-RF-DC Product feature CHAIN MN650069_HBe_P-RF-DC of FT:mat_peptide MN650069_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN916). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650072_HBe_P-RF-DC Product feature CHAIN MN650072_HBe_P-RF-DC of FT:mat_peptide MN650072_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN1339). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650073_HBe_P-RF-DC Product feature CHAIN MN650073_HBe_P-RF-DC of FT:mat_peptide MN650073_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN1849). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650074_HBe_P-RF-DC Product feature CHAIN MN650074_HBe_P-RF-DC of FT:mat_peptide MN650074_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN4244). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650075_HBe_P-RF-DC Product feature CHAIN MN650075_HBe_P-RF-DC of FT:mat_peptide MN650075_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN4457). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650076_HBe_P-RF-DC Product feature CHAIN MN650076_HBe_P-RF-DC of FT:mat_peptide MN650076_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN5189). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650077_HBe_P-RF-DC Product feature CHAIN MN650077_HBe_P-RF-DC of FT:mat_peptide MN650077_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN5213). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKECGASVELLSFLPSDFFPSIRDILDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650078_HBe_P-RF-DC Product feature CHAIN MN650078_HBe_P-RF-DC of FT:mat_peptide MN650078_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN6462). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650079_HBe_P-RF-DC Product feature CHAIN MN650079_HBe_P-RF-DC of FT:mat_peptide MN650079_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN6975). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650080_HBe_P-RF-DC Product feature CHAIN MN650080_HBe_P-RF-DC of FT:mat_peptide MN650080_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN7589). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650081_HBe_P-RF-DC Product feature CHAIN MN650081_HBe_P-RF-DC of FT:mat_peptide MN650081_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN7648). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650082_HBe_P-RF-DC Product feature CHAIN MN650082_HBe_P-RF-DC of FT:mat_peptide MN650082_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN7661). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650083_HBe_P-RF-DC Product feature CHAIN MN650083_HBe_P-RF-DC of FT:mat_peptide MN650083_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN7683). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650084_HBe_P-RF-DC Product feature CHAIN MN650084_HBe_P-RF-DC of FT:mat_peptide MN650084_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN7688). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASEELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650085_HBe_P-RF-DC Product feature CHAIN MN650085_HBe_P-RF-DC of FT:mat_peptide MN650085_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN7708). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650086_HBe_P-RF-DC Product feature CHAIN MN650086_HBe_P-RF-DC of FT:mat_peptide MN650086_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN7764). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN650087_HBe_P-RF-DC Product feature CHAIN MN650087_HBe_P-RF-DC of FT:mat_peptide MN650087_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate KRN7805). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN657315_HBe_P-RF-DC Product feature CHAIN MN657315_HBe_P-RF-DC of FT:mat_peptide MN657315_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ74). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN657316_HBe_P-RF-DC Product feature CHAIN MN657316_HBe_P-RF-DC of FT:mat_peptide MN657316_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ241). Complete genome. [Riboviria] (length=135 residues).
YKLFRGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN657317_HBe_P-RF-DC Product feature CHAIN MN657317_HBe_P-RF-DC of FT:mat_peptide MN657317_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ253). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683571_HBe_P-RF-DC Product feature CHAIN MN683571_HBe_P-RF-DC of FT:mat_peptide MN683571_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ130). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683572_HBe_P-RF-DC Product feature CHAIN MN683572_HBe_P-RF-DC of FT:mat_peptide MN683572_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH396). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683574_HBe_P-RF-DC Product feature CHAIN MN683574_HBe_P-RF-DC of FT:mat_peptide MN683574_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH11). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683579_HBe_P-RF-DC Product feature CHAIN MN683579_HBe_P-RF-DC of FT:mat_peptide MN683579_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH267). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683580_HBe_P-RF-DC Product feature CHAIN MN683580_HBe_P-RF-DC of FT:mat_peptide MN683580_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH282). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPPSRELVVSYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MN683582_HBe_P-RF-DC Product feature CHAIN MN683582_HBe_P-RF-DC of FT:mat_peptide MN683582_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH325). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683584_HBe_P-RF-DC Product feature CHAIN MN683584_HBe_P-RF-DC of FT:mat_peptide MN683584_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH383). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683586_HBe_P-RF-DC Product feature CHAIN MN683586_HBe_P-RF-DC of FT:mat_peptide MN683586_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ11). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683587_HBe_P-RF-DC Product feature CHAIN MN683587_HBe_P-RF-DC of FT:mat_peptide MN683587_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ113). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683588_HBe_P-RF-DC Product feature CHAIN MN683588_HBe_P-RF-DC of FT:mat_peptide MN683588_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ118). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRESVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683590_HBe_P-RF-DC Product feature CHAIN MN683590_HBe_P-RF-DC of FT:mat_peptide MN683590_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ126). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683592_HBe_P-RF-DC Product feature CHAIN MN683592_HBe_P-RF-DC of FT:mat_peptide MN683592_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ128). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683594_HBe_P-RF-DC Product feature CHAIN MN683594_HBe_P-RF-DC of FT:mat_peptide MN683594_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ131). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683596_HBe_P-RF-DC Product feature CHAIN MN683596_HBe_P-RF-DC of FT:mat_peptide MN683596_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ136). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683597_HBe_P-RF-DC Product feature CHAIN MN683597_HBe_P-RF-DC of FT:mat_peptide MN683597_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ139). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683605_HBe_P-RF-DC Product feature CHAIN MN683605_HBe_P-RF-DC of FT:mat_peptide MN683605_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ160). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683607_HBe_P-RF-DC Product feature CHAIN MN683607_HBe_P-RF-DC of FT:mat_peptide MN683607_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ169). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683609_HBe_P-RF-DC Product feature CHAIN MN683609_HBe_P-RF-DC of FT:mat_peptide MN683609_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ179). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683610_HBe_P-RF-DC Product feature CHAIN MN683610_HBe_P-RF-DC of FT:mat_peptide MN683610_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ180). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683611_HBe_P-RF-DC Product feature CHAIN MN683611_HBe_P-RF-DC of FT:mat_peptide MN683611_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ181). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLDDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683612_HBe_P-RF-DC Product feature CHAIN MN683612_HBe_P-RF-DC of FT:mat_peptide MN683612_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ183). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683613_HBe_P-RF-DC Product feature CHAIN MN683613_HBe_P-RF-DC of FT:mat_peptide MN683613_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ186). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683614_HBe_P-RF-DC Product feature CHAIN MN683614_HBe_P-RF-DC of FT:mat_peptide MN683614_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ187). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683615_HBe_P-RF-DC Product feature CHAIN MN683615_HBe_P-RF-DC of FT:mat_peptide MN683615_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ188). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683616_HBe_P-RF-DC Product feature CHAIN MN683616_HBe_P-RF-DC of FT:mat_peptide MN683616_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ191). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683619_HBe_P-RF-DC Product feature CHAIN MN683619_HBe_P-RF-DC of FT:mat_peptide MN683619_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ196). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683621_HBe_P-RF-DC Product feature CHAIN MN683621_HBe_P-RF-DC of FT:mat_peptide MN683621_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ199). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683622_HBe_P-RF-DC Product feature CHAIN MN683622_HBe_P-RF-DC of FT:mat_peptide MN683622_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ204). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683623_HBe_P-RF-DC Product feature CHAIN MN683623_HBe_P-RF-DC of FT:mat_peptide MN683623_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ210). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683624_HBe_P-RF-DC Product feature CHAIN MN683624_HBe_P-RF-DC of FT:mat_peptide MN683624_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ211). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683625_HBe_P-RF-DC Product feature CHAIN MN683625_HBe_P-RF-DC of FT:mat_peptide MN683625_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ218). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683626_HBe_P-RF-DC Product feature CHAIN MN683626_HBe_P-RF-DC of FT:mat_peptide MN683626_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ223). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683627_HBe_P-RF-DC Product feature CHAIN MN683627_HBe_P-RF-DC of FT:mat_peptide MN683627_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ225). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
WVGSNLQDPASRDLVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683628_HBe_P-RF-DC Product feature CHAIN MN683628_HBe_P-RF-DC of FT:mat_peptide MN683628_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ227). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683630_HBe_P-RF-DC Product feature CHAIN MN683630_HBe_P-RF-DC of FT:mat_peptide MN683630_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ246). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683632_HBe_P-RF-DC Product feature CHAIN MN683632_HBe_P-RF-DC of FT:mat_peptide MN683632_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ249). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683634_HBe_P-RF-DC Product feature CHAIN MN683634_HBe_P-RF-DC of FT:mat_peptide MN683634_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ250). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683635_HBe_P-RF-DC Product feature CHAIN MN683635_HBe_P-RF-DC of FT:mat_peptide MN683635_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ251). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683636_HBe_P-RF-DC Product feature CHAIN MN683636_HBe_P-RF-DC of FT:mat_peptide MN683636_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ26). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683637_HBe_P-RF-DC Product feature CHAIN MN683637_HBe_P-RF-DC of FT:mat_peptide MN683637_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ27). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683638_HBe_P-RF-DC Product feature CHAIN MN683638_HBe_P-RF-DC of FT:mat_peptide MN683638_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ29). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683639_HBe_P-RF-DC Product feature CHAIN MN683639_HBe_P-RF-DC of FT:mat_peptide MN683639_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ30). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683640_HBe_P-RF-DC Product feature CHAIN MN683640_HBe_P-RF-DC of FT:mat_peptide MN683640_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ31). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683641_HBe_P-RF-DC Product feature CHAIN MN683641_HBe_P-RF-DC of FT:mat_peptide MN683641_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ319). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683642_HBe_P-RF-DC Product feature CHAIN MN683642_HBe_P-RF-DC of FT:mat_peptide MN683642_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ32). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683643_HBe_P-RF-DC Product feature CHAIN MN683643_HBe_P-RF-DC of FT:mat_peptide MN683643_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ33). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683644_HBe_P-RF-DC Product feature CHAIN MN683644_HBe_P-RF-DC of FT:mat_peptide MN683644_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ35). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683645_HBe_P-RF-DC Product feature CHAIN MN683645_HBe_P-RF-DC of FT:mat_peptide MN683645_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ36). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683647_HBe_P-RF-DC Product feature CHAIN MN683647_HBe_P-RF-DC of FT:mat_peptide MN683647_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ39). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683649_HBe_P-RF-DC Product feature CHAIN MN683649_HBe_P-RF-DC of FT:mat_peptide MN683649_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ40). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683650_HBe_P-RF-DC Product feature CHAIN MN683650_HBe_P-RF-DC of FT:mat_peptide MN683650_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ41). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683651_HBe_P-RF-DC Product feature CHAIN MN683651_HBe_P-RF-DC of FT:mat_peptide MN683651_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ42). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683652_HBe_P-RF-DC Product feature CHAIN MN683652_HBe_P-RF-DC of FT:mat_peptide MN683652_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ46). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683653_HBe_P-RF-DC Product feature CHAIN MN683653_HBe_P-RF-DC of FT:mat_peptide MN683653_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ47). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683654_HBe_P-RF-DC Product feature CHAIN MN683654_HBe_P-RF-DC of FT:mat_peptide MN683654_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ48). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683655_HBe_P-RF-DC Product feature CHAIN MN683655_HBe_P-RF-DC of FT:mat_peptide MN683655_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ51). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683656_HBe_P-RF-DC Product feature CHAIN MN683656_HBe_P-RF-DC of FT:mat_peptide MN683656_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ54). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683658_HBe_P-RF-DC Product feature CHAIN MN683658_HBe_P-RF-DC of FT:mat_peptide MN683658_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ56). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683659_HBe_P-RF-DC Product feature CHAIN MN683659_HBe_P-RF-DC of FT:mat_peptide MN683659_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ57). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683660_HBe_P-RF-DC Product feature CHAIN MN683660_HBe_P-RF-DC of FT:mat_peptide MN683660_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ60). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683661_HBe_P-RF-DC Product feature CHAIN MN683661_HBe_P-RF-DC of FT:mat_peptide MN683661_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ63). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683662_HBe_P-RF-DC Product feature CHAIN MN683662_HBe_P-RF-DC of FT:mat_peptide MN683662_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ65). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683663_HBe_P-RF-DC Product feature CHAIN MN683663_HBe_P-RF-DC of FT:mat_peptide MN683663_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ67). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683669_HBe_P-RF-DC Product feature CHAIN MN683669_HBe_P-RF-DC of FT:mat_peptide MN683669_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ72). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPTVRDLIDTASALYREALESPEHCTPHHTALRQAILCWGELMNLAT
WVGGNLQDPASREAVVSYVNVNMGLKFRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MN683670_HBe_P-RF-DC Product feature CHAIN MN683670_HBe_P-RF-DC of FT:mat_peptide MN683670_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ73). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVFSYVNVNMGLEIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683671_HBe_P-RF-DC Product feature CHAIN MN683671_HBe_P-RF-DC of FT:mat_peptide MN683671_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ75). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683673_HBe_P-RF-DC Product feature CHAIN MN683673_HBe_P-RF-DC of FT:mat_peptide MN683673_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ78). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683675_HBe_P-RF-DC Product feature CHAIN MN683675_HBe_P-RF-DC of FT:mat_peptide MN683675_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ8). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683676_HBe_P-RF-DC Product feature CHAIN MN683676_HBe_P-RF-DC of FT:mat_peptide MN683676_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ84). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683677_HBe_P-RF-DC Product feature CHAIN MN683677_HBe_P-RF-DC of FT:mat_peptide MN683677_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ86). Complete genome. [Riboviria] (length=135 residues).
SKLCLDWLWGMDIDPYKEFVASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683678_HBe_P-RF-DC Product feature CHAIN MN683678_HBe_P-RF-DC of FT:mat_peptide MN683678_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ87). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPPSRELVVSYVNVNMGLKLRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MN683683_HBe_P-RF-DC Product feature CHAIN MN683683_HBe_P-RF-DC of FT:mat_peptide MN683683_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZDP2). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683684_HBe_P-RF-DC Product feature CHAIN MN683684_HBe_P-RF-DC of FT:mat_peptide MN683684_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ135). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683685_HBe_P-RF-DC Product feature CHAIN MN683685_HBe_P-RF-DC of FT:mat_peptide MN683685_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ114). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683686_HBe_P-RF-DC Product feature CHAIN MN683686_HBe_P-RF-DC of FT:mat_peptide MN683686_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ100). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683687_HBe_P-RF-DC Product feature CHAIN MN683687_HBe_P-RF-DC of FT:mat_peptide MN683687_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ101). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683688_HBe_P-RF-DC Product feature CHAIN MN683688_HBe_P-RF-DC of FT:mat_peptide MN683688_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ102). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683689_HBe_P-RF-DC Product feature CHAIN MN683689_HBe_P-RF-DC of FT:mat_peptide MN683689_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ103). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683690_HBe_P-RF-DC Product feature CHAIN MN683690_HBe_P-RF-DC of FT:mat_peptide MN683690_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ104). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683691_HBe_P-RF-DC Product feature CHAIN MN683691_HBe_P-RF-DC of FT:mat_peptide MN683691_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ105). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALKQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683692_HBe_P-RF-DC Product feature CHAIN MN683692_HBe_P-RF-DC of FT:mat_peptide MN683692_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ106). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683693_HBe_P-RF-DC Product feature CHAIN MN683693_HBe_P-RF-DC of FT:mat_peptide MN683693_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ107). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683694_HBe_P-RF-DC Product feature CHAIN MN683694_HBe_P-RF-DC of FT:mat_peptide MN683694_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ108). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683695_HBe_P-RF-DC Product feature CHAIN MN683695_HBe_P-RF-DC of FT:mat_peptide MN683695_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ109). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683696_HBe_P-RF-DC Product feature CHAIN MN683696_HBe_P-RF-DC of FT:mat_peptide MN683696_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ110). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683697_HBe_P-RF-DC Product feature CHAIN MN683697_HBe_P-RF-DC of FT:mat_peptide MN683697_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ111). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683699_HBe_P-RF-DC Product feature CHAIN MN683699_HBe_P-RF-DC of FT:mat_peptide MN683699_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ116). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683700_HBe_P-RF-DC Product feature CHAIN MN683700_HBe_P-RF-DC of FT:mat_peptide MN683700_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ172). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683703_HBe_P-RF-DC Product feature CHAIN MN683703_HBe_P-RF-DC of FT:mat_peptide MN683703_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ2). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683706_HBe_P-RF-DC Product feature CHAIN MN683706_HBe_P-RF-DC of FT:mat_peptide MN683706_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ318). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683711_HBe_P-RF-DC Product feature CHAIN MN683711_HBe_P-RF-DC of FT:mat_peptide MN683711_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ439). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683712_HBe_P-RF-DC Product feature CHAIN MN683712_HBe_P-RF-DC of FT:mat_peptide MN683712_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ5). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKFRQLLWFHISCLTFGRQTVIEYLVSFGVW
>gnl|hbvpro|MN683713_HBe_P-RF-DC Product feature CHAIN MN683713_HBe_P-RF-DC of FT:mat_peptide MN683713_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ64). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683714_HBe_P-RF-DC Product feature CHAIN MN683714_HBe_P-RF-DC of FT:mat_peptide MN683714_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ67). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683715_HBe_P-RF-DC Product feature CHAIN MN683715_HBe_P-RF-DC of FT:mat_peptide MN683715_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ7). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683716_HBe_P-RF-DC Product feature CHAIN MN683716_HBe_P-RF-DC of FT:mat_peptide MN683716_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ76). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPQHCSPHHTALRQAILCWGELMNLAT
WVGGNLEDPQSREAVVSYVNVNMGLKLRQILWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MN683717_HBe_P-RF-DC Product feature CHAIN MN683717_HBe_P-RF-DC of FT:mat_peptide MN683717_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ79). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEHPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
>gnl|hbvpro|MN683718_HBe_P-RF-DC Product feature CHAIN MN683718_HBe_P-RF-DC of FT:mat_peptide MN683718_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ80). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683719_HBe_P-RF-DC Product feature CHAIN MN683719_HBe_P-RF-DC of FT:mat_peptide MN683719_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ81). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683720_HBe_P-RF-DC Product feature CHAIN MN683720_HBe_P-RF-DC of FT:mat_peptide MN683720_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ82). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683722_HBe_P-RF-DC Product feature CHAIN MN683722_HBe_P-RF-DC of FT:mat_peptide MN683722_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ88). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKLRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683723_HBe_P-RF-DC Product feature CHAIN MN683723_HBe_P-RF-DC of FT:mat_peptide MN683723_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ90). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683724_HBe_P-RF-DC Product feature CHAIN MN683724_HBe_P-RF-DC of FT:mat_peptide MN683724_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZ97). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MN683725_HBe_P-RF-DC Product feature CHAIN MN683725_HBe_P-RF-DC of FT:mat_peptide MN683725_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate XZDP5). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPPSRELVVGYVNVNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT210033_HBe_P-RF-DE Product feature CHAIN MT210033_HBe_P-RF-DE of FT:mat_peptide MT210033_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate 258). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT426089_HBe_P-RF-AB Product feature CHAIN MT426089_HBe_P-RF-AB of FT:mat_peptide MT426089_HBe_P-RF-AB of [Viruses] Hepatitis B Virus recombinant form AB (isolate H0900 transfection clone). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMTLAT
WVGNNLEDPASRDLVVNYVNTNMGLKIRQLLWFHISCITFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426110_HBe_P-RF-DE Product feature CHAIN MT426110_HBe_P-RF-DE of FT:mat_peptide MT426110_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BM2177 transfection clone). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT426111_HBe_P-RF-DE Product feature CHAIN MT426111_HBe_P-RF-DE of FT:mat_peptide MT426111_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate DEN6028 transfection clone). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT426112_HBe_P-RF-DE Product feature CHAIN MT426112_HBe_P-RF-DE of FT:mat_peptide MT426112_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate H006 transfection clone). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMQLAT
WVGANLQDPTSRDLVVSYVNTNMGLKFRQLLWFHTSCITFGRQTVVEYLVSFGVW
>gnl|hbvpro|MT426113_HBe_P-RF-DE Product feature CHAIN MT426113_HBe_P-RF-DE of FT:mat_peptide MT426113_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HLD1 transfection clone). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT426114_HBe_P-RF-DE Product feature CHAIN MT426114_HBe_P-RF-DE of FT:mat_peptide MT426114_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate NTBS538 transfection clone). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT426456_HBe_P-RF-CB Product feature CHAIN MT426456_HBe_P-RF-CB of FT:mat_peptide MT426456_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426463_HBe_P-RF-CB Product feature CHAIN MT426463_HBe_P-RF-CB of FT:mat_peptide MT426463_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C51). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426465_HBe_P-RF-CB Product feature CHAIN MT426465_HBe_P-RF-CB of FT:mat_peptide MT426465_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426466_HBe_P-RF-CB Product feature CHAIN MT426466_HBe_P-RF-CB of FT:mat_peptide MT426466_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C15). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426467_HBe_P-RF-CB Product feature CHAIN MT426467_HBe_P-RF-CB of FT:mat_peptide MT426467_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C9). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426468_HBe_P-RF-CB Product feature CHAIN MT426468_HBe_P-RF-CB of FT:mat_peptide MT426468_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C36). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426471_HBe_P-RF-CB Product feature CHAIN MT426471_HBe_P-RF-CB of FT:mat_peptide MT426471_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426472_HBe_P-RF-CB Product feature CHAIN MT426472_HBe_P-RF-CB of FT:mat_peptide MT426472_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426480_HBe_P-RF-CB Product feature CHAIN MT426480_HBe_P-RF-CB of FT:mat_peptide MT426480_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C31). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426482_HBe_P-RF-CB Product feature CHAIN MT426482_HBe_P-RF-CB of FT:mat_peptide MT426482_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C58). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426484_HBe_P-RF-CB Product feature CHAIN MT426484_HBe_P-RF-CB of FT:mat_peptide MT426484_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C43). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426485_HBe_P-RF-CB Product feature CHAIN MT426485_HBe_P-RF-CB of FT:mat_peptide MT426485_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C59). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426488_HBe_P-RF-CB Product feature CHAIN MT426488_HBe_P-RF-CB of FT:mat_peptide MT426488_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C40). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426490_HBe_P-RF-CB Product feature CHAIN MT426490_HBe_P-RF-CB of FT:mat_peptide MT426490_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C38). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426491_HBe_P-RF-CB Product feature CHAIN MT426491_HBe_P-RF-CB of FT:mat_peptide MT426491_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C35). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426493_HBe_P-RF-CB Product feature CHAIN MT426493_HBe_P-RF-CB of FT:mat_peptide MT426493_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C30). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426494_HBe_P-RF-CB Product feature CHAIN MT426494_HBe_P-RF-CB of FT:mat_peptide MT426494_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426495_HBe_P-RF-CB Product feature CHAIN MT426495_HBe_P-RF-CB of FT:mat_peptide MT426495_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426496_HBe_P-RF-CB Product feature CHAIN MT426496_HBe_P-RF-CB of FT:mat_peptide MT426496_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C39). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426497_HBe_P-RF-CB Product feature CHAIN MT426497_HBe_P-RF-CB of FT:mat_peptide MT426497_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C20). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426498_HBe_P-RF-CB Product feature CHAIN MT426498_HBe_P-RF-CB of FT:mat_peptide MT426498_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C48). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426499_HBe_P-RF-CB Product feature CHAIN MT426499_HBe_P-RF-CB of FT:mat_peptide MT426499_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C60). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426500_HBe_P-RF-CB Product feature CHAIN MT426500_HBe_P-RF-CB of FT:mat_peptide MT426500_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C3). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426501_HBe_P-RF-CB Product feature CHAIN MT426501_HBe_P-RF-CB of FT:mat_peptide MT426501_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C57). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLSLGWLWGMDLDPYKELGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426502_HBe_P-RF-CB Product feature CHAIN MT426502_HBe_P-RF-CB of FT:mat_peptide MT426502_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C60). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426505_HBe_P-RF-CB Product feature CHAIN MT426505_HBe_P-RF-CB of FT:mat_peptide MT426505_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C19). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426506_HBe_P-RF-CB Product feature CHAIN MT426506_HBe_P-RF-CB of FT:mat_peptide MT426506_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C13). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGLDIEPYKEFGASVELLSFFPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426508_HBe_P-RF-CB Product feature CHAIN MT426508_HBe_P-RF-CB of FT:mat_peptide MT426508_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C26). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426509_HBe_P-RF-CB Product feature CHAIN MT426509_HBe_P-RF-CB of FT:mat_peptide MT426509_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C5). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426511_HBe_P-RF-CB Product feature CHAIN MT426511_HBe_P-RF-CB of FT:mat_peptide MT426511_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426512_HBe_P-RF-CB Product feature CHAIN MT426512_HBe_P-RF-CB of FT:mat_peptide MT426512_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C12). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426513_HBe_P-RF-CB Product feature CHAIN MT426513_HBe_P-RF-CB of FT:mat_peptide MT426513_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426514_HBe_P-RF-CB Product feature CHAIN MT426514_HBe_P-RF-CB of FT:mat_peptide MT426514_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C53). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426515_HBe_P-RF-CB Product feature CHAIN MT426515_HBe_P-RF-CB of FT:mat_peptide MT426515_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C49). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426517_HBe_P-RF-CB Product feature CHAIN MT426517_HBe_P-RF-CB of FT:mat_peptide MT426517_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426518_HBe_P-RF-CB Product feature CHAIN MT426518_HBe_P-RF-CB of FT:mat_peptide MT426518_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C46). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426519_HBe_P-RF-CB Product feature CHAIN MT426519_HBe_P-RF-CB of FT:mat_peptide MT426519_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C27). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426520_HBe_P-RF-CB Product feature CHAIN MT426520_HBe_P-RF-CB of FT:mat_peptide MT426520_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C37). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426521_HBe_P-RF-CB Product feature CHAIN MT426521_HBe_P-RF-CB of FT:mat_peptide MT426521_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C54). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426522_HBe_P-RF-CB Product feature CHAIN MT426522_HBe_P-RF-CB of FT:mat_peptide MT426522_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426523_HBe_P-RF-CB Product feature CHAIN MT426523_HBe_P-RF-CB of FT:mat_peptide MT426523_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C25). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426524_HBe_P-RF-CB Product feature CHAIN MT426524_HBe_P-RF-CB of FT:mat_peptide MT426524_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426525_HBe_P-RF-CB Product feature CHAIN MT426525_HBe_P-RF-CB of FT:mat_peptide MT426525_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C47). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426526_HBe_P-RF-CB Product feature CHAIN MT426526_HBe_P-RF-CB of FT:mat_peptide MT426526_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426527_HBe_P-RF-CB Product feature CHAIN MT426527_HBe_P-RF-CB of FT:mat_peptide MT426527_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426528_HBe_P-RF-CB Product feature CHAIN MT426528_HBe_P-RF-CB of FT:mat_peptide MT426528_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426529_HBe_P-RF-CB Product feature CHAIN MT426529_HBe_P-RF-CB of FT:mat_peptide MT426529_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C43_2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426530_HBe_P-RF-CB Product feature CHAIN MT426530_HBe_P-RF-CB of FT:mat_peptide MT426530_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C49). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426531_HBe_P-RF-CB Product feature CHAIN MT426531_HBe_P-RF-CB of FT:mat_peptide MT426531_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C26). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQVVWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426532_HBe_P-RF-CB Product feature CHAIN MT426532_HBe_P-RF-CB of FT:mat_peptide MT426532_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C21). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKMRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426533_HBe_P-RF-CB Product feature CHAIN MT426533_HBe_P-RF-CB of FT:mat_peptide MT426533_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C1). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEQCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426534_HBe_P-RF-CB Product feature CHAIN MT426534_HBe_P-RF-CB of FT:mat_peptide MT426534_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C7). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426536_HBe_P-RF-CB Product feature CHAIN MT426536_HBe_P-RF-CB of FT:mat_peptide MT426536_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C34). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
YKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426537_HBe_P-RF-CB Product feature CHAIN MT426537_HBe_P-RF-CB of FT:mat_peptide MT426537_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C42). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426538_HBe_P-RF-CB Product feature CHAIN MT426538_HBe_P-RF-CB of FT:mat_peptide MT426538_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C39). Partial genome (Contains: HBe, HBc, HBx, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426539_HBe_P-RF-CB Product feature CHAIN MT426539_HBe_P-RF-CB of FT:mat_peptide MT426539_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C28). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426540_HBe_P-RF-CB Product feature CHAIN MT426540_HBe_P-RF-CB of FT:mat_peptide MT426540_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C30). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426541_HBe_P-RF-CB Product feature CHAIN MT426541_HBe_P-RF-CB of FT:mat_peptide MT426541_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426542_HBe_P-RF-CB Product feature CHAIN MT426542_HBe_P-RF-CB of FT:mat_peptide MT426542_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C52). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426543_HBe_P-RF-CB Product feature CHAIN MT426543_HBe_P-RF-CB of FT:mat_peptide MT426543_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C20). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426545_HBe_P-RF-CB Product feature CHAIN MT426545_HBe_P-RF-CB of FT:mat_peptide MT426545_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C16). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426546_HBe_P-RF-CB Product feature CHAIN MT426546_HBe_P-RF-CB of FT:mat_peptide MT426546_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C64). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426547_HBe_P-RF-CB Product feature CHAIN MT426547_HBe_P-RF-CB of FT:mat_peptide MT426547_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C56). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426549_HBe_P-RF-CB Product feature CHAIN MT426549_HBe_P-RF-CB of FT:mat_peptide MT426549_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426550_HBe_P-RF-CB Product feature CHAIN MT426550_HBe_P-RF-CB of FT:mat_peptide MT426550_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C38). Partial genome (Contains: HBe, HBc, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426551_HBe_P-RF-CB Product feature CHAIN MT426551_HBe_P-RF-CB of FT:mat_peptide MT426551_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C23). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426553_HBe_P-RF-CB Product feature CHAIN MT426553_HBe_P-RF-CB of FT:mat_peptide MT426553_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C8). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426554_HBe_P-RF-CB Product feature CHAIN MT426554_HBe_P-RF-CB of FT:mat_peptide MT426554_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C61). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426555_HBe_P-RF-CB Product feature CHAIN MT426555_HBe_P-RF-CB of FT:mat_peptide MT426555_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVPEYLVSFGVW
>gnl|hbvpro|MT426556_HBe_P-RF-CB Product feature CHAIN MT426556_HBe_P-RF-CB of FT:mat_peptide MT426556_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426557_HBe_P-RF-CB Product feature CHAIN MT426557_HBe_P-RF-CB of FT:mat_peptide MT426557_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C63). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426558_HBe_P-RF-CB Product feature CHAIN MT426558_HBe_P-RF-CB of FT:mat_peptide MT426558_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426559_HBe_P-RF-CB Product feature CHAIN MT426559_HBe_P-RF-CB of FT:mat_peptide MT426559_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C63). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426560_HBe_P-RF-CB Product feature CHAIN MT426560_HBe_P-RF-CB of FT:mat_peptide MT426560_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C50). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426561_HBe_P-RF-CB Product feature CHAIN MT426561_HBe_P-RF-CB of FT:mat_peptide MT426561_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C44). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALNREALESTEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426562_HBe_P-RF-CB Product feature CHAIN MT426562_HBe_P-RF-CB of FT:mat_peptide MT426562_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C24). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426563_HBe_P-RF-CB Product feature CHAIN MT426563_HBe_P-RF-CB of FT:mat_peptide MT426563_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C2). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426564_HBe_P-RF-CB Product feature CHAIN MT426564_HBe_P-RF-CB of FT:mat_peptide MT426564_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C18). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426565_HBe_P-RF-CB Product feature CHAIN MT426565_HBe_P-RF-CB of FT:mat_peptide MT426565_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C56). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426566_HBe_P-RF-CB Product feature CHAIN MT426566_HBe_P-RF-CB of FT:mat_peptide MT426566_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C55). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426567_HBe_P-RF-CB Product feature CHAIN MT426567_HBe_P-RF-CB of FT:mat_peptide MT426567_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C4). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426568_HBe_P-RF-CB Product feature CHAIN MT426568_HBe_P-RF-CB of FT:mat_peptide MT426568_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPDHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426569_HBe_P-RF-CB Product feature CHAIN MT426569_HBe_P-RF-CB of FT:mat_peptide MT426569_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426570_HBe_P-RF-CB Product feature CHAIN MT426570_HBe_P-RF-CB of FT:mat_peptide MT426570_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C14). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426571_HBe_P-RF-CB Product feature CHAIN MT426571_HBe_P-RF-CB of FT:mat_peptide MT426571_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C45). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426572_HBe_P-RF-CB Product feature CHAIN MT426572_HBe_P-RF-CB of FT:mat_peptide MT426572_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C33). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426573_HBe_P-RF-CB Product feature CHAIN MT426573_HBe_P-RF-CB of FT:mat_peptide MT426573_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C22). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426574_HBe_P-RF-CB Product feature CHAIN MT426574_HBe_P-RF-CB of FT:mat_peptide MT426574_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_4w_C11). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426575_HBe_P-RF-CB Product feature CHAIN MT426575_HBe_P-RF-CB of FT:mat_peptide MT426575_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C29). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT426576_HBe_P-RF-CB Product feature CHAIN MT426576_HBe_P-RF-CB of FT:mat_peptide MT426576_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate 1110_BL_C41). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT591274_HBe_P-RF-DE Product feature CHAIN MT591274_HBe_P-RF-DE of FT:mat_peptide MT591274_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BM-1171). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQSSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVW
>gnl|hbvpro|MT591275_HBe_P-RF-DE Product feature CHAIN MT591275_HBe_P-RF-DE of FT:mat_peptide MT591275_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BM-2025). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDQSSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVVEYLVSFGVW
>gnl|hbvpro|MT591280_HBe_P-RF-DE Product feature CHAIN MT591280_HBe_P-RF-DE of FT:mat_peptide MT591280_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate BM-1179). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMNLGT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MT645015_HBe_P-RF-CB Product feature CHAIN MT645015_HBe_P-RF-CB of FT:mat_peptide MT645015_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate GX4). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645029_HBe_P-RF-CB Product feature CHAIN MT645029_HBe_P-RF-CB of FT:mat_peptide MT645029_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HB16). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEQCSPHHTALRQAIVCWGEVMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645035_HBe_P-RF-CB Product feature CHAIN MT645035_HBe_P-RF-CB of FT:mat_peptide MT645035_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HB25). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645048_HBe_P-RF-CB Product feature CHAIN MT645048_HBe_P-RF-CB of FT:mat_peptide MT645048_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HN21). Complete genome. [Riboviria] (length=135 residues).
SQLGLGWLWGMDIDPYKEFGTSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAIVCWGELMNLAT
WVGSNLEDPASRELVVRYVNVNMGLKISQLQWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645049_HBe_P-RF-DC Product feature CHAIN MT645049_HBe_P-RF-DC of FT:mat_peptide MT645049_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate HN22). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645060_HBe_P-RF-DC Product feature CHAIN MT645060_HBe_P-RF-DC of FT:mat_peptide MT645060_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH10). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNGNMGLKIRQLLGFHISGLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645062_HBe_P-RF-DC Product feature CHAIN MT645062_HBe_P-RF-DC of FT:mat_peptide MT645062_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH12). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQILWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645063_HBe_P-RF-DC Product feature CHAIN MT645063_HBe_P-RF-DC of FT:mat_peptide MT645063_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH13). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNSEDPASRELVVSYVNVNMGLKIRQLVRFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645065_HBe_P-RF-DC Product feature CHAIN MT645065_HBe_P-RF-DC of FT:mat_peptide MT645065_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH15). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645066_HBe_P-RF-DC Product feature CHAIN MT645066_HBe_P-RF-DC of FT:mat_peptide MT645066_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH2). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645067_HBe_P-RF-DC Product feature CHAIN MT645067_HBe_P-RF-DC of FT:mat_peptide MT645067_HBe_P-RF-DC of [Viruses] Hepatitis B Virus recombinant form DC (isolate QH5). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELIVSYVNVNMGLKIRQLLWFHVSCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645069_HBe_P-RF-CB Product feature CHAIN MT645069_HBe_P-RF-CB of FT:mat_peptide MT645069_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate QH7). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MT645071_HBe_P-RF-CB Product feature CHAIN MT645071_HBe_P-RF-CB of FT:mat_peptide MT645071_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate SH3). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MW601227_HBe_P-RF-DE Product feature CHAIN MW601227_HBe_P-RF-DE of FT:mat_peptide MW601227_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGANLEDPASRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MW601230_HBe_P-RF-DE Product feature CHAIN MW601230_HBe_P-RF-DE of FT:mat_peptide MW601230_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVW
>gnl|hbvpro|MW601241_HBe_P-RF-DE Product feature CHAIN MW601241_HBe_P-RF-DE of FT:mat_peptide MW601241_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MW601264_HBe_P-RF-DE Product feature CHAIN MW601264_HBe_P-RF-DE of FT:mat_peptide MW601264_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MW601296_HBe_P-RF-DE Product feature CHAIN MW601296_HBe_P-RF-DE of FT:mat_peptide MW601296_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, Pol, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYSEALQSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLQDQTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
>gnl|hbvpro|MW887644_HBe_P-RF-CB Product feature CHAIN MW887644_HBe_P-RF-CB of FT:mat_peptide MW887644_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate DD13_36947). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|MZ097667_HBe_P-RF-DE Product feature CHAIN MZ097667_HBe_P-RF-DE of FT:mat_peptide MZ097667_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate DD14_07738). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ097680_HBe_P-RF-DE Product feature CHAIN MZ097680_HBe_P-RF-DE of FT:mat_peptide MZ097680_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate DD14_37327). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVGYVNTNIGLKFRQLLWFHISCLTFGRETVIQYLVSFGVW
>gnl|hbvpro|MZ097703_HBe_P-RF-DE Product feature CHAIN MZ097703_HBe_P-RF-DE of FT:mat_peptide MZ097703_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate D_HBV_5). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPTSRDLVVGYVNTNIGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ097716_HBe_P-RF-DE Product feature CHAIN MZ097716_HBe_P-RF-DE of FT:mat_peptide MZ097716_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FR_HBV_102). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGANLEDPASRDLVVGYVNTTVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ097719_HBe_P-RF-DE Product feature CHAIN MZ097719_HBe_P-RF-DE of FT:mat_peptide MZ097719_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FR_HBV_105). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSHHHTALRQAILCWGELMTLAT
WVGGNLEDPTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGKETVIEYLVSFGVW
>gnl|hbvpro|MZ097724_HBe_P-RF-DE Product feature CHAIN MZ097724_HBe_P-RF-DE of FT:mat_peptide MZ097724_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FR_HBV_116). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ097745_HBe_P-RF-DE Product feature CHAIN MZ097745_HBe_P-RF-DE of FT:mat_peptide MZ097745_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FR_HBV_141). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWXMDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALFRDALESPEHCSPHHTALRQAILCWGDLMTLAT
WVGGNLEDPVSRDLVVSYVNTNVGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ097767_HBe_P-RF-DE Product feature CHAIN MZ097767_HBe_P-RF-DE of FT:mat_peptide MZ097767_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate FR_HBV_174). Partial genome (Contains: HBe, HBc, HBx, LHBs, MHBs, SHBs, HBSP). [Riboviria] (length=135 residues).
SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYSEALQSPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLQDQTSRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRDTVIEYLVSFGVW
>gnl|hbvpro|MZ097850_HBe_P-RF-DE Product feature CHAIN MZ097850_HBe_P-RF-DE of FT:mat_peptide MZ097850_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate HN_HBV_18). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|MZ439673_HBe_P-RF-CB Product feature CHAIN MZ439673_HBe_P-RF-CB of FT:mat_peptide MZ439673_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate TN122-2007-Quasi-7). Complete genome. [Riboviria] (length=135 residues).
SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSPHHTAIRQAILCWGELMNLAT
WVGSNLDDPASREAVVGYVNVNMGLKFRQLLWFHISCLTFGSATVLEYLVSFGVW
>gnl|hbvpro|U95551_HBe_P-RF-DE Product feature CHAIN U95551_HBe_P-RF-DE of FT:mat_peptide U95551_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE. Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|X68292_HBe_P-RF-DA Product feature CHAIN X68292_HBe_P-RF-DA of FT:mat_peptide X68292_HBe_P-RF-DA of [Viruses] Hepatitis B Virus recombinant form DA (isolate Patient D, HBV subtype ayw). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMTLAS
WVGDNLEDPASRDLVVSYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|X75656_HBe_P-RF-CB Product feature CHAIN X75656_HBe_P-RF-CB of FT:mat_peptide X75656_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate Cha). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAVLCWGELMNLAT
WVGSNLEDPASRELVVSYVNINMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
>gnl|hbvpro|X80925_HBe_P-RF-DE Product feature CHAIN X80925_HBe_P-RF-DE of FT:mat_peptide X80925_HBe_P-RF-DE of [Viruses] Hepatitis B Virus recombinant form DE (isolate patient 4). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSPHHTALRQAILCWGELMTLAT
WVGVNLEDPASRDLVVSYVNTNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVW
>gnl|hbvpro|Y18856_HBe_P-RF-CB Product feature CHAIN Y18856_HBe_P-RF-CB of FT:mat_peptide Y18856_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV-C5). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLAFGRETVLEYLVSFGVW
>gnl|hbvpro|Y18857_HBe_P-RF-CB Product feature CHAIN Y18857_HBe_P-RF-CB of FT:mat_peptide Y18857_HBe_P-RF-CB of [Viruses] Hepatitis B Virus recombinant form CB (isolate HBV-C6). Complete genome. [Hepadnaviridae] (length=135 residues).
SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLAT
WVGSNLEDPASRELVVSYVNVNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
© 1998-2022Legal notice