HBVdb

Dataset for protein HBe of genotype RF

[Download (right click)] [Sequences] [Repertoires]

1031 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


AY161140_HBe_P-RF-AD      SKLCLGWLWGMDIDPHKEFGATVELLSFLPSDFFPSARDLLDTASALYRE
MF488699_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB014375_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB031265_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB033559_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
AB048702_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
AB105172_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB194949_HBe_P-RF-AE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB198084_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFMPSDFFPSIRDLLDTASALYRE
AB222708_HBe_P-RF-AD      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB330368_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AB367393_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB367400_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRE
AB367419_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
AB367800_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB453985_HBe_P-RF-AC      SKLCLGWLWGMDIDPYKEFGASVELISFLPPDFFPSIRDLLDTASALYRE
AB493838_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB493842_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB554022_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB583679_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AB670303_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB674434_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRE
AF297620_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AF461361_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AJ344117_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AM494716_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY057948_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVEVLSFLPSDFFPSNRDLLDTASALDRE
AY123424_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY161141_HBe_P-RF-AD      SKLCLGWLWGMDIDPHKEIGATVELLSFLPSDFFPSARDLLDTASALYRE
AY161145_HBe_P-RF-AD      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY161147_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSDRDLLDTASALYRE
AY206374_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYRE
AY233277_HBe_P-RF-AC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
AY233293_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY233295_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY817512_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY817513_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY862864_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
DQ315777_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ315780_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
DQ464167_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
DQ478886_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
DQ478898_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EF103282_HBe_P-RF-AD      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EF494376_HBe_P-RF-CA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EF494378_HBe_P-RF-CA      SKLCLGWLWGMDIDPYKEFGASVQLLSFLPSDFFPSIRDLLDTASALYRE
EU185780_HBe_P-RF-AD      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU522070_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU589339_HBe_P-RF-CB      SKLCLGWLWDMDINTYKEFGASVELLSFLPSDFFPSIRDLLDTATALHRE
EU594406_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU787435_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYRE
EU833891_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFSPSVRDLLDTASALYRE
EU871981_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871985_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALCRE
EU871992_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871995_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871997_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU881995_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU882006_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
EU916228_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFFASDLFPSVRDLLDTATALYRE
EU916232_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU916239_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU916240_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU939565_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
EU939577_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU939581_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHRE
EU939589_HBe_P-RF-CB      SKLCLGWLWGMDIDVYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU939623_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPNIRDLLDTASALYRE
EU939627_HBe_P-RF-BC      SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALHRE
EU939629_HBe_P-RF-BC      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ023659_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ023664_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ349241_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHRE
FJ386578_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ386581_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
FJ386633_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYRE
FJ386643_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ562229_HBe_P-RF-CB      SKLCLGWLXGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHRE
FJ562263_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYRE
FJ562278_HBe_P-RF-DC      SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
FJ562287_HBe_P-RF-CB      FKVCLGGLWGMGLDPYKEFGAFGELLFFLPFDFFPSIRDLLDTASALYRE
FJ562302_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ562305_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ562336_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLVDTATALYRE
FJ692536_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FJ715345_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ715387_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ882610_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ882611_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
FJ882612_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
FJ882613_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
FJ882617_HBe_P-RF-GC      SKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
FJ882618_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
FJ904409_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTATALFRD
FJ904425_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGATVQLLSFLPSDFYPSVRDLLDTASALYRD
FJ904440_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FN594767_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGASVELLSFLPHDFFPSVKDLLDTASALYRD
FN594770_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRD
FN594771_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
FR714496_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSILPSDFFPSTRDLLDTASALYRE
GQ161753_HBe_P-RF-AE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ161754_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ161806_HBe_P-RF-EA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ161837_HBe_P-RF-AE      SKLCLGWLWGMDIDPYKEFGATVELLSVLPFGFFPSVRDXLDTASXLYRD
GQ161838_HBe_P-RF-AE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDXLDTASXLYRD
GQ205377_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDFLDTAAALYRD
GQ205378_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
GQ205379_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
GQ331048_HBe_P-RF-AE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ377590_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYRE
GQ377594_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377602_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377613_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377633_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GU177079_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GU357843_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GU563560_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRE
HE981179_HBe_P-RF-FG      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HE981180_HBe_P-RF-GF      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM146131_HBe_P-RF-AD      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
HM750142_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYRE
HM750144_HBe_P-RF-DC      SKQCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HM750147_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HM750148_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRE
HQ700485_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYRE
HQ700509_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700515_HBe_P-RF-CB      ---CLGWLWGMDIYPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700520_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
HQ700523_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRD
HQ700526_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYRE
HQ700530_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRD
HQ700535_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700538_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700557_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JF436919_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
JF436923_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JF439995_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439996_HBe_P-RF-DE      SKPCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439999_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440007_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440011_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440012_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRE
JF440013_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRE
JF440017_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN104438_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JN257174_HBe_P-RF-DE      SKLCLGWLWGMDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257191_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN257216_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN400086_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYRE
JN664915_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JN664929_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
JN664933_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYRE
JN664935_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JN664943_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYRD
JQ040130_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JQ040148_HBe_P-RF-CB      SKLXLGWLWGMDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYRE
JQ707714_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JX026887_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALHRE
JX429896_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JX661485_HBe_P-RF-CB      LQLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JX661486_HBe_P-RF-CB      RELCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC315400_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774305_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774349_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774414_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774425_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774447_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KC774449_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774450_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRE
KC774453_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
KC774454_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774479_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774482_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774485_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KC774490_HBe_P-RF-DC      PKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC875338_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF170740_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KF192833_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KF192835_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF192837_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KF192838_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KF192840_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KF214656_HBe_P-RF-AC      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF779353_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF873511_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KF873513_HBe_P-RF-CB      SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KF873518_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KF873519_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYRE
KF873522_HBe_P-RF-CB      SKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KF873523_HBe_P-RF-CB      SKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KF873530_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KF873533_HBe_P-RF-CB      SKLCLGWLXGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KF873538_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRD
KF873540_HBe_P-RF-CB      SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRD
KF873542_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRD
KF873543_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRD
KF917451_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173280_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173358_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGAFVELLSFLPSDFFPSIRDLLDTASALYRE
KJ410497_HBe_P-RF-BC      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ410506_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSTRDLLDTASALYRE
KJ586803_HBe_P-RF-AF      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ647351_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFYPSVRDLLDTASALYRD
KJ803753_HBe_P-RF-CB      SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ803772_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ803782_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KJ803785_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALCRD
KJ803788_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVEIPFFLPSDFFPSIRDLLYTTSVLYRE
KJ803798_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KJ803804_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ803822_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ803827_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYRE
KM386676_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KM524336_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAVYRD
KM606750_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KM875422_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
KP148442_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVALLSFLPSDFFPSIRDLLDTASALYRE
KT991419_HBe_P-RF-DC      SKLCLGWLWGMDIDHYEEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
KT991420_HBe_P-RF-DC      SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
KT991424_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU577083_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRELLDTASALYRD
KU668440_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU679940_HBe_P-RF-CB      SKLCLGWLXXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KU679941_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU679943_HBe_P-RF-BC      SKLCLGWLWXMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYRE
KU679944_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KU679945_HBe_P-RF-CB      SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTALALYRD
KU679946_HBe_P-RF-BC      SKQCLEWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KU679948_HBe_P-RF-CB      SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KU679953_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KU679954_HBe_P-RF-CB      SKLCLGWLWXMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU679955_HBe_P-RF-CB      SKLCLGWLXGMDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTAAALYRE
KU679956_HBe_P-RF-CB      SKLCLGWLXGMDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTASALYRE
KU695745_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU736914_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736916_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736921_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736922_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU964006_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964010_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964315_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRE
KX357628_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVQLLSFLPADFFPSVRDLLDTASALYRD
KX357630_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KX357632_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTAAALFRD
KX357634_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYRD
KX660677_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYRE
KX660684_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KX660689_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KX827299_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRD
KX827302_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATLELLSFLPSDFYPSVRDLLDTASALYRD
KY470843_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYRE
KY470853_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYRE
KY470893_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGTSVELLSFLPSDFFPSIRDLLDTASALYRE
KY670781_HBe_P-RF-DC      SKLCLGWLWGMDIDXYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRE
LC416040_HBe_P-RF-CB      SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC519800_HBe_P-RF-CB      SKLCLGWLWDMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC519801_HBe_P-RF-CB      SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LT718449_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
M38454_HBe_P-RF-CB        SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MF488702_HBe_P-RF-DE      SKLCLRWIWGMDIDTYKEFGATVEILSFLSPDFFPSLRDLLDTASALYRD
MF488705_HBe_P-RF-AD      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF925360_HBe_P-RF-DB      SKLCLGWLWDMDIDPYKEFGATVELLSFLPADFFPSVRALLDTASALYRE
MF925371_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF925386_HBe_P-RF-AC      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVGDLLDTASALYRE
MF925388_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MF925396_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRE
MF925397_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MF925401_HBe_P-RF-DB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MG826151_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MG893561_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MH464846_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH464851_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH481859_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
MH481860_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
MH481862_HBe_P-RF-DE      SKLCLGWLWGMDSDPYKEFGATMELLSFLPSDFFPSVRDLLDTAAALYRD
MH685719_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK052967_HBe_P-RF-BD      SKLCLGWLWGMDIDPYKEFGASVELLSSLPSDFFPSIRDLLDTASALYRE
MK052968_HBe_P-RF-BD      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK052969_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK052970_HBe_P-RF-BD      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK052976_HBe_P-RF-BD      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534555_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534556_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534561_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534566_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534568_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534582_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534583_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534584_HBe_P-RF-BC      SKLCLGWLWGMDIDPHKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534590_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATAMYRE
MK534615_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASAELISFLPADFFPSVRDLLDTASALYRE
MK534620_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534630_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534632_HBe_P-RF-CB      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534635_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534653_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534686_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534689_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534706_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534712_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534713_HBe_P-RF-CB      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534714_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
MK534715_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
MK534719_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534721_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534726_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFSPSDFFPSIRDLLDTASALYRE
MK534728_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
MK534729_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
MK534730_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDSFPSIHDLLDTASALYRE
MK534734_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
MK598652_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK598656_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN507835_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN650068_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650069_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYRE
MN650077_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKECGASVELLSFLPSDFFPSIRDILDTASALYRE
MN650084_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASEELLSFLPSDFFPSIRDLLDTASALYRE
MN657316_HBe_P-RF-DC      YKLFRGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN657317_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683580_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683588_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683611_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683627_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683634_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683669_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPTVRDLIDTASALYRE
MN683670_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683675_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683677_HBe_P-RF-DC      SKLCLDWLWGMDIDPYKEFVASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683691_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683712_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRE
MN683716_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683717_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYRE
MN683725_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT210033_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MT426089_HBe_P-RF-AB      SKLCLGWLWGMDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRE
MT426110_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRE
MT426112_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRD
MT426494_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426501_HBe_P-RF-CB      SKLSLGWLWGMDLDPYKELGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426506_HBe_P-RF-CB      SKLCLGWLWGLDIEPYKEFGASVELLSFFPSDFFPSIRDLLDTASALYRE
MT426514_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
MT426531_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
MT426532_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426533_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426536_HBe_P-RF-CB      YKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426545_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
MT426550_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426553_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
MT426555_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426561_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALNRE
MT426568_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT591274_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRD
MT591280_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT645015_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRE
MT645029_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHRE
MT645048_HBe_P-RF-CB      SQLGLGWLWGMDIDPYKEFGTSVELLSFLPSDFFPSIRDLLDTASALYRE
MT645060_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT645062_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
MT645063_HBe_P-RF-DC      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT645067_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MW601227_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MW601230_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MW601241_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MW601264_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRD
MW601296_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYSE
MZ043066_HBe_P-RF-AC      SKLCLGWLWDMDIDPYKEFGASVELLSFLPHDFFPSVRDLQDTASALFRE
MZ097667_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097680_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRD
MZ097703_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRD
MZ097716_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYRD
MZ097745_HBe_P-RF-DE      SKLCLGWLWXMDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALFRD
MZ439673_HBe_P-RF-CB      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYRE
OK143491_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
OL362104_HBe_P-RF-ED      SKLCLGWLWGMDXDPYXEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
OP153948_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPQDFFPSVRDLLDTASALYRD
OP153949_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTTSALYRE
OP153963_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
OY983045_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
X68292_HBe_P-RF-DA        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
Y18856_HBe_P-RF-CB        SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
AB033557_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB195939_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB195940_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB195941_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB195950_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB195951_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB195955_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB195956_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB195957_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB241109_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB674504_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AP011104_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AP011105_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AP011108_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY040627_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY123041_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY167095_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY247030_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY800249_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY817510_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY817511_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY817515_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY862865_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY862866_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
DQ144601_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
DQ478887_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
DQ478889_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
DQ478890_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
DQ478892_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
DQ478897_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU787434_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU835240_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ386649_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ562314_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ715384_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ715385_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ715411_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ715412_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ715413_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ715414_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ787446_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ787480_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377516_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377520_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377534_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377539_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377544_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377548_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377549_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377560_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377564_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377565_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377573_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377581_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377595_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377596_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377611_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377614_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377626_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377630_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377634_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ377635_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ924618_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HM750133_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HM750143_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HM750145_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HM750146_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HM750149_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HM750150_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700505_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700507_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700508_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700521_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700547_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JF491448_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JF491449_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JF491451_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JF491455_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JF491456_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JN104442_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JQ040146_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JQ040174_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JQ040175_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JQ732168_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JQ801476_HBe_P-RF-CG      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JQ801477_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JX429898_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JX661487_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JX661494_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
JX661498_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774183_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774186_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774198_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774201_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774212_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774234_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774258_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774294_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774317_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774322_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774324_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774328_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774332_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774341_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774344_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774423_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774424_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774426_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774448_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774452_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774455_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774456_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774457_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774458_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774470_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774471_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774480_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774489_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774495_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774499_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KF873524_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KF873527_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KF873531_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KF873532_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KF873534_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173279_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173299_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173300_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173320_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173322_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173325_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173326_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173329_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173330_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173349_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ173350_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ410520_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KJ803802_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KP148352_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KP276253_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KP276254_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KP276255_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KP276256_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KR013816_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KT003704_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KT991421_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU519422_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU519423_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU679942_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU963990_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU963991_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU963993_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU963994_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU963995_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU963998_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU963999_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964001_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964003_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964005_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964007_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964008_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964009_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964303_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964304_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964305_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964306_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964307_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964308_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964309_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964310_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964311_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964312_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964313_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964314_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964316_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU964317_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KX660674_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KX660675_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KX660680_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC279263_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC279264_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC279265_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC279266_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC279267_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC365290_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC458432_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC519797_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LC519803_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MG826144_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MG826146_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MG826147_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MG826148_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MG893554_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MG893555_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MG893559_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MH094410_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK321265_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534574_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534606_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534623_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534637_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534641_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534664_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534672_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534682_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534684_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534685_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534717_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534722_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534723_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534724_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534735_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534736_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK720627_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK720628_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650072_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650073_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650074_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650075_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650078_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650080_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650081_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650082_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650085_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650086_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650087_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN657315_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683571_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683572_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683574_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683579_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683582_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683584_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683586_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683587_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683590_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683592_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683594_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683596_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683605_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683607_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683609_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683612_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683613_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683614_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683615_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683616_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683619_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683623_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683626_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683628_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683630_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683632_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683635_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683639_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683643_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683644_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683645_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683647_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683649_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683652_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683653_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683654_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683656_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683658_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683659_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683661_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683662_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683663_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683671_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683673_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683684_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683685_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683686_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683689_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683690_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683692_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683693_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683694_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683695_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683696_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683697_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683699_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683700_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683713_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683714_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683715_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683723_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683724_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426456_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426463_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426465_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426466_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426467_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426468_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426471_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426472_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426480_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426484_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426485_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426488_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426491_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426493_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426495_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426496_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426497_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426498_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426499_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426500_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426502_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426505_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426508_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426509_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426511_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426512_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426513_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426517_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426518_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426519_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426520_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426521_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426522_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426524_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426525_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426526_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426528_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426529_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426530_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426534_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426537_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426538_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426539_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426540_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426541_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426543_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426546_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426547_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426549_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426554_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426556_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426557_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426558_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426559_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426560_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426562_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426563_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426565_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426566_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426567_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426569_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426570_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426571_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426572_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426573_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426574_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426575_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426576_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT645035_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT645049_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT645065_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT645066_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MW887644_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
OM732333_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
DQ315779_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
GQ205387_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700497_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700501_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700503_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700524_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700525_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700541_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700581_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700582_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700583_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
HQ700584_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
JN664940_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KJ470884_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KJ470886_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KJ470887_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KJ470888_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KJ470890_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KT366505_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
MH481858_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
MH481861_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
MK516279_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
MK516280_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
AB493837_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB493840_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB493847_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB554014_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB554015_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB554019_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB554021_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AB644286_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AP011102_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AP011103_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ358155_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
GQ358156_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700498_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700499_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700518_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700519_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700527_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700528_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700542_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU695741_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU695742_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU695743_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU695744_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KU695746_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683622_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683624_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683625_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AF297619_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439776_HBe_P-RF-AG      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KJ586810_HBe_P-RF-AF      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF925404_HBe_P-RF-AC      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MN683683_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
AY373430_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
DQ111987_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EF103285_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU594435_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
EU594436_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
GQ183486_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
JQ687532_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KM524359_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KM577663_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KM577664_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP168416_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP168417_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP168418_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT366492_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736917_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KU736923_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KX357623_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
LK995391_HBe_P-RF-ED      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK598654_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MK618439_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN507850_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MT426114_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ097850_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
X80925_HBe_P-RF-DE        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
AY236161_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898686_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898687_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898688_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898690_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898693_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898695_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898696_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898698_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JX898699_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KM524357_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KR905422_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366503_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KT366504_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF925392_HBe_P-RF-DB      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MF967563_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MH724222_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618438_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618440_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618442_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618444_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK618445_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MT426111_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MT426113_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
U95551_HBe_P-RF-DE        SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
AY161146_HBe_P-RF-AD      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
GQ377627_HBe_P-RF-CD      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU939606_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KM524337_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KC012653_HBe_P-RF-AD      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
EU871983_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871984_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871986_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871987_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871988_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871989_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871990_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871999_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774442_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534577_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650076_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650083_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683655_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683720_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871993_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU871996_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU872014_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU872015_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774178_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774364_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT645071_HBe_P-RF-CB      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
EU916241_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ023667_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ023670_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ023673_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FR714490_HBe_P-RF-GB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC172106_HBe_P-RF-GB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MG826145_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MH746811_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MH746812_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MH746813_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534669_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ386585_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426482_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
MT426490_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
KT991417_HBe_P-RF-DC      SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
KT991423_HBe_P-RF-DC      SKLCLGWLWGMDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
KY363262_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KY363263_HBe_P-RF-CB      SKLCLGWLWGMDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ715346_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ715347_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
FJ882614_HBe_P-RF-GC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HF571060_HBe_P-RF-AE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MF925389_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYRE
KP148337_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534662_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534687_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534690_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
LT935669_HBe_P-RF-FD      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MN683636_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYRE
MN683637_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYRE
MN683638_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYRE
MN683651_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYRE
MN683703_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYRE
JF828933_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRE
JF828934_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRE
JF828935_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRE
JF828936_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRE
JF828938_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRE
Y18857_HBe_P-RF-CB        SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYRE
HQ700560_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
X75656_HBe_P-RF-CB        SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
HQ700531_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRD
HQ700532_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRD
HQ700537_HBe_P-RF-DE      SKLCLGWLXGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
JF440000_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440001_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440002_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440003_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440004_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440005_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440006_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440008_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440009_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440010_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440014_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF440015_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JF439998_HBe_P-RF-DE      SKPCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
JN664925_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN683722_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534616_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534688_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MF925370_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426542_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426564_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KX660685_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
MN683641_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYRE
KC774461_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774463_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774484_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774494_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN650079_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683597_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683610_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683621_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683640_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683642_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683650_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683676_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683687_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683688_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683718_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683719_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683660_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774487_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774492_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC774497_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KC875339_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MF618346_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KF192839_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
KF192841_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
MF618347_HBe_P-RF-DE      SKLCLGWLWGMDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRD
OP256005_HBe_P-RF-DA      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
KF873515_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KF873517_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KU679939_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
MT645069_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KF873521_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYRE
KM606751_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KP995112_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
KT991427_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534716_HBe_P-RF-BC      SKLCLGWLWGMDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYRE
MN683706_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MN683711_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
KY470844_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYRE
KY470846_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYRE
KY470847_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYRE
KY470849_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYRE
KY470850_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYRE
KY470854_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYRE
KY470855_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYRE
KY470856_HBe_P-RF-DC      SKLCLGWLWDMDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYRE
MH464852_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MK534558_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534559_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534560_HBe_P-RF-CB      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534562_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534563_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534564_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534567_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534569_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534579_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534580_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534589_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534598_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534607_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534610_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534625_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534633_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534639_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534648_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534651_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534654_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534655_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534670_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534695_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534718_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534731_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534609_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534646_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534681_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534663_HBe_P-RF-CB      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534617_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK534618_HBe_P-RF-BC      SKLCLGWLWSMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MK598653_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MN683678_HBe_P-RF-DC      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRE
MT426515_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
MT426523_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
MT426527_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
MT426551_HBe_P-RF-CB      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYRE
MT591275_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRD
OP121186_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ097719_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRE
MZ097724_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
MZ097767_HBe_P-RF-DE      SKLCLGWLWDMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYSE
OP153975_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPQDFFPSVRDLLDTASALYRD
OP153984_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPQDFFPSVRDLLDTASALYRD
OP153995_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPQDFFPSVRDLLDTASALYRD
OP153972_HBe_P-RF-DE      SKLCLGWLWGMDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRD
                                 :  :.   : *  :   :    . .  *       *:  :  :

AY161140_HBe_P-RF-AD      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
MF488699_HBe_P-RF-DE      ALESPEHCSSHHTALRQSVLCWRELMTLATWVGTNLEDPASRDLVVSYVD
AB014375_HBe_P-RF-CB      ALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVN
AB031265_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB033559_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
AB048702_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
AB105172_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AB194949_HBe_P-RF-AE      ALESPEHCSPHHTALRQATLCWGELMTLATWVGNNLQDPASRDLVVNYVN
AB198084_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
AB222708_HBe_P-RF-AD      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVN
AB330368_HBe_P-RF-DA      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
AB367393_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVN
AB367400_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB367419_HBe_P-RF-CB      ALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
AB367800_HBe_P-RF-CB      ALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVN
AB453985_HBe_P-RF-AC      ALESSEHCSAHHTALRQAILCWGELMTLANWVGNNLQDPASRDLVVNYVN
AB493838_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AB493842_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AB554022_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLDDPASRELVVSYVN
AB583679_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AB670303_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVXYXN
AB674434_HBe_P-RF-DE      ALESPEHCSAHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
AF297620_HBe_P-RF-DA      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVN
AF461361_HBe_P-RF-CB      ALESPEHCSPHHTALRHAILCWGELMNLATWVGSNLEDQASRELVVGYVN
AJ344117_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AM494716_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY057948_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY123424_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNPATWVGSNLEDPASRELVVSYVN
AY161141_HBe_P-RF-AD      GLESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY161145_HBe_P-RF-AD      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
AY161147_HBe_P-RF-DA      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
AY206374_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY233277_HBe_P-RF-AC      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
AY233293_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY233295_HBe_P-RF-DE      ALESPEHCSPHHTALRRAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY817512_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY817513_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY862864_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
DQ315777_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
DQ315780_HBe_P-RF-DE      ALESSEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
DQ464167_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDQASRDLIVSYVN
DQ478886_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
DQ478898_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
EF103282_HBe_P-RF-AD      ALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVN
EF494376_HBe_P-RF-CA      ALESPEHRSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
EF494378_HBe_P-RF-CA      ALESPEHCTPHHTALRQTILCWGELVNLATWVGSNLDDPASRELVVGYVN
EU185780_HBe_P-RF-AD      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVGYVN
EU522070_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVN
EU589339_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASGELVVSYVN
EU594406_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU787435_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU833891_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLDDPGSRDLVVTYVN
EU871981_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871985_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871992_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871995_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871997_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVASNLEGPASRELVVSYVN
EU881995_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU882006_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
EU916228_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
EU916232_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU916239_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVD
EU916240_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU939565_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIXCWGEXMNLATWVGSNLEDPASRELVVSYVN
EU939577_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
EU939581_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVNYVN
EU939589_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
EU939623_HBe_P-RF-CB      ALESPEHCSPHHTAIRQAIVCWGELMNLATWVGGNLDDPASRELIVNYVN
EU939627_HBe_P-RF-BC      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
EU939629_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGTNLEDPASRELVVSYVN
FJ023659_HBe_P-RF-BC      ALESPEHCSPHHTALRQAFLCWGELMTLATWVGSNLEDPASRDLVVSYVN
FJ023664_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
FJ349241_HBe_P-RF-DC      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ386578_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
FJ386581_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
FJ386633_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ386643_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ562229_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ562263_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ562278_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVN
FJ562287_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ562302_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
FJ562305_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVN
FJ562336_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGELTNLATWVGSNLEDPASRELVVSYVN
FJ692536_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FJ715345_HBe_P-RF-CB      ALESPEHCSPHHTAVRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
FJ715387_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ882610_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
FJ882611_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
FJ882612_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLXDPGSRDLVVTYVN
FJ882613_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPSSRDLVVTYVN
FJ882617_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPGSRDLVVTYVN
FJ882618_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPGSRDLVVTYVN
FJ904409_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDVMNIATWVGVNLQDQASRDQVVNYVN
FJ904425_HBe_P-RF-DE      ALESPEHCTPHHTALRQAILCWGELMTLATWVGSNL-DPVSRDLVVSYVN
FJ904440_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVN
FN594767_HBe_P-RF-DE      ALESPEHCSPHHTALRQAIVCWGNIMTLATWVGVNLEDQASRDLLVSYVN
FN594770_HBe_P-RF-DE      ALESPEHCSPHHTAFRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
FN594771_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGEFTSHSTWVGVNLEDPASRDLVVSYVN
FR714496_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVRYVN
GQ161753_HBe_P-RF-AE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161754_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ161806_HBe_P-RF-EA      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
GQ161837_HBe_P-RF-AE      ALESXEHCSPHHTALRQAILCWGELMTLATWVGINLEDPASRDLVVSYVN
GQ161838_HBe_P-RF-AE      XLESXXHXSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ205377_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
GQ205378_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVN
GQ205379_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
GQ331048_HBe_P-RF-AE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVN
GQ377590_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377594_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377602_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377613_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377633_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GU177079_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GU357843_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGNNLEDPASRELVVSYVN
GU563560_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
HE981179_HBe_P-RF-FG      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HE981180_HBe_P-RF-GF      ALESPEHCTPSHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM146131_HBe_P-RF-AD      ALESPEHCSPHHTALRQAILCWGELTTLGTWVGNNLQDPASRDQVVNYVN
HM750142_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HM750144_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HM750147_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HM750148_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700485_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700509_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700515_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700520_HBe_P-RF-CB      ALESPEHCSHHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVN
HQ700523_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELXVSYVN
HQ700526_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700530_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700535_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGXLMTLATWVGTNLEDPASRDLVVSYVN
HQ700538_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
HQ700557_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
JF436919_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
JF436923_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVN
JF439995_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF439996_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF439999_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440007_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPVSRDLVVSYVN
JF440011_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440012_HBe_P-RF-DE      ALEPPEHWSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440013_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440017_HBe_P-RF-DA      SLESPEHCSPHHTALRQDILCWGELMTLATWVGTNLEDPASRDLVVNYVN
JN104438_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JN257174_HBe_P-RF-DE      ALESPEHCSPHHTALRQAIQCWGXLMTLATWVGGNLEDPISRDLVVSXVN
JN257191_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPXSRDLVVSYVN
JN257216_HBe_P-RF-DE      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
JN400086_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JN664915_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVN
JN664929_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLITLSTWVGANLEDPASRDLVVSYVN
JN664933_HBe_P-RF-DA      ALESPEHCTPHHTALRQAVLCWVELMTLATWVGNNLEDPASRDLVVNYVN
JN664935_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JN664943_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ040130_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
JQ040148_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JQ707714_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
JX026887_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
JX429896_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JX661485_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JX661486_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC315400_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774305_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
KC774349_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774414_HBe_P-RF-BC      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774425_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
KC774447_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVN
KC774449_HBe_P-RF-DC      ALESPEHCSPHHTALRNAIVCWGELMNLATWVGSNLEDPASRELIVSYVN
KC774450_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KC774453_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774454_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774479_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
KC774482_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774485_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774490_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC875338_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KF170740_HBe_P-RF-DE      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGVNLEDPASRDLVVSYVN
KF192833_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
KF192835_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
KF192837_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
KF192838_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
KF192840_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVN
KF214656_HBe_P-RF-AC      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVN
KF779353_HBe_P-RF-DA      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
KF873511_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873513_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVN
KF873518_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873519_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873522_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873523_HBe_P-RF-CB      ALESPEHCSPHHTALRQXILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873530_HBe_P-RF-CB      ALESAEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873533_HBe_P-RF-CB      ALEXPEHCSPHHTALRQAILXWGELMNLATWVGSNLEDPASRELVVSYVN
KF873538_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873540_HBe_P-RF-CB      ALESPEHCSPHHTALRQAXLCWGELMNLATWVGSNLEDPASRELVXSYVN
KF873542_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873543_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF917451_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173280_HBe_P-RF-CB      ALKSPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173358_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ410497_HBe_P-RF-BC      ALESPEHCSPQHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ410506_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVN
KJ586803_HBe_P-RF-AF      ALESPEHCTPNHTAFRQAILCWGELMTLASWGGNNLEDPAARDLVVNYVN
KJ647351_HBe_P-RF-DE      ALESPEHCSPHHTALRQAVLCWGDLMNLATWVGANLEDPASRDLVVSYVN
KJ803753_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVN
KJ803772_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ803782_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGEVMNLATWVGSNLEDPASRELVVSYVN
KJ803785_HBe_P-RF-CB      ALESPEHVSAHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ803788_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ803798_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGEVMNLATWVGSNLEDPASRELVVSYVN
KJ803804_HBe_P-RF-CB      ALESPEHCSHHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVN
KJ803822_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ803827_HBe_P-RF-BC      ALESPEHCSPHHTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVN
KM386676_HBe_P-RF-DE      ALESPEHCTPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVTYVN
KM524336_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
KM606750_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KM875422_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILSWGELMNLATWVGSNLEDPASRELVVSYVN
KP148442_HBe_P-RF-BC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
KT991419_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVN
KT991420_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVN
KT991424_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU577083_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVN
KU668440_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLDDPASRDLVVSYVN
KU679940_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU679941_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU679943_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVN
KU679944_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU679945_HBe_P-RF-CB      ALESPEXCSAHHTALRQAIVCWGELMNLATWVGSNLEDQASRELVVSYVN
KU679946_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU679948_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
KU679953_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU679954_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVN
KU679955_HBe_P-RF-CB      ALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDXASRELVVSYVN
KU679956_HBe_P-RF-CB      ALESPEHCSPHHTALRQAXLCWGELMNLATWVGSNLEDPASRELVVXYVN
KU695745_HBe_P-RF-CB      ALESPEHCSPHHTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
KU736914_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736916_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVN
KU736921_HBe_P-RF-DE      ALXSPEHCSPHHTALRQAILCWGELMTLATWVGVNLEBPASRDLVVSYVN
KU736922_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU964006_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964010_HBe_P-RF-CB      ALESPEHGSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964315_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KX357628_HBe_P-RF-DE      ALESPEHCTPHHTALRQAILCWGDVLSLATWVGVNLEDPASRDLVVGYVN
KX357630_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
KX357632_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
KX357634_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX660677_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KX660684_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KX660689_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KX827299_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX827302_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVN
KY470843_HBe_P-RF-DC      ALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY470853_HBe_P-RF-DC      ALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY470893_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY670781_HBe_P-RF-DC      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
LC416040_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LC519800_HBe_P-RF-CB      ALESPEHCSPHHTALRQAFLCWGELMNLATWVGSNLEDPASRELVVSYVN
LC519801_HBe_P-RF-CB      ALESPEHCSPHHTALRQAFLCWGELMNLATWVGSNLEDPASRELVVSYVN
LT718449_HBe_P-RF-DE      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
M38454_HBe_P-RF-CB        ALESPEHCSPHHTALRQAILCWRELMNLATWVGSNLEDPASRELVVSYVN
MF488702_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF488705_HBe_P-RF-AD      ALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVN
MF925360_HBe_P-RF-DB      ALESPEHCSSHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
MF925371_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF925386_HBe_P-RF-AC      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
MF925388_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF925396_HBe_P-RF-DC      ALESPEHCTPHHTALRQAILCWGELMTLATWVGVNLEDPASRDQVVSYVN
MF925397_HBe_P-RF-DC      ALESPEHCTPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MF925401_HBe_P-RF-DB      ALESPEHCSPHHTALRQAILCWAELMNLATWVGVNLEDPASRDLVVSYVN
MG826151_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
MG893561_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASGKLVVSYVN
MH464846_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH464851_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH481859_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
MH481860_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
MH481862_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
MH685719_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MK052967_HBe_P-RF-BD      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK052968_HBe_P-RF-BD      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK052969_HBe_P-RF-DE      ALESPEHCTPHHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVN
MK052970_HBe_P-RF-BD      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRKLVVSYVN
MK052976_HBe_P-RF-BD      ALESPEHCTPHHTAIRQAILCWGELMTLATWVGTNLEDPASRDLIVSYVN
MK534555_HBe_P-RF-BC      ALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLDDPTSREAIVGYVN
MK534556_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534561_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534566_HBe_P-RF-BC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
MK534568_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534582_HBe_P-RF-BC      ALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLDDPASRELVVGYVN
MK534583_HBe_P-RF-BC      PLESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVNYVN
MK534584_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534590_HBe_P-RF-BC      ALESPVHGSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
MK534615_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534620_HBe_P-RF-BC      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534630_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
MK534632_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVGYVN
MK534635_HBe_P-RF-BC      ALESPEHCSPHHTALRQAVLCWVELMNLATWVGGNLEDPASRELVVSYVN
MK534653_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534686_HBe_P-RF-BC      ALESPEHVSAHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVN
MK534689_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534706_HBe_P-RF-CB      ALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
MK534712_HBe_P-RF-BC      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534713_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534714_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVN
MK534715_HBe_P-RF-BC      ALESPEHGTPHHTALRQAIVCWGELMNLATWVGSNLDDPASRELVVSYVN
MK534719_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPASREAVVSYVN
MK534721_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVN
MK534726_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534728_HBe_P-RF-BC      ALESPEHCSAHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVRYVN
MK534729_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534730_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534734_HBe_P-RF-BC      ALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK598652_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
MK598656_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
MN507835_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MN650068_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650069_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650077_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650084_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN657316_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN657317_HBe_P-RF-DC      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELIVSYVN
MN683580_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPPSRELVVSYVN
MN683588_HBe_P-RF-DC      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRESVVSYVN
MN683611_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVN
MN683627_HBe_P-RF-DC      ALESPEHCTPHHTALRQAILCWGELMNLATWVGSNLQDPASRDLVVSYVN
MN683634_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683669_HBe_P-RF-DC      ALESPEHCTPHHTALRQAILCWGELMNLATWVGGNLQDPASREAVVSYVN
MN683670_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVFSYVN
MN683675_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVN
MN683677_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683691_HBe_P-RF-DC      ALESPEHCSPHHTALKQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683712_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683716_HBe_P-RF-DC      ALESPQHCSPHHTALRQAILCWGELMNLATWVGGNLEDPQSREAVVSYVN
MN683717_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEHPASRELVVSYVN
MN683725_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPPSRELVVGYVN
MT210033_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT426089_HBe_P-RF-AB      ALESPEHCSPHHTAIRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
MT426110_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT426112_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMQLATWVGANLQDPTSRDLVVSYVN
MT426494_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426501_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426506_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426514_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426531_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426532_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426533_HBe_P-RF-CB      ALESPEQCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426536_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426545_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426550_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426553_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426555_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426561_HBe_P-RF-CB      ALESTEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426568_HBe_P-RF-CB      ALESPDHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT591274_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQSSRDLVVSYVN
MT591280_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMNLGTWVGVNLEDPASRDLVVSYVN
MT645015_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT645029_HBe_P-RF-CB      ALESPEQCSPHHTALRQAIVCWGEVMNLATWVGSNLEDPASRELVVSYVN
MT645048_HBe_P-RF-CB      ALESPEHCSPHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVRYVN
MT645060_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT645062_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
MT645063_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNSEDPASRELVVSYVN
MT645067_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
MW601227_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVGYVN
MW601230_HBe_P-RF-DE      ALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MW601241_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MW601264_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
MW601296_HBe_P-RF-DE      ALQSPEHCSPHHTALRQAILCWGELMTLATWVGVNLQDQTSRDLVVSYVN
MZ043066_HBe_P-RF-AC      ALESPEHCTPHHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVN
MZ097667_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MZ097680_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVGYVN
MZ097703_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPTSRDLVVGYVN
MZ097716_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVGYVN
MZ097745_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVN
MZ439673_HBe_P-RF-CB      ALESPEHCSPHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVN
OK143491_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWVELMSLATWVGANLEDQASRDLVVSYVN
OL362104_HBe_P-RF-ED      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVXSYVN
OP153948_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLINLSTWVGANLEDQASRDLVVSYVN
OP153949_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELRTLATWVGVNLEDPASRDLVVSYVN
OP153963_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
OY983045_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
X68292_HBe_P-RF-DA        ALESPEHCSPHHTALRQAILCWGELMTLASWVGDNLEDPASRDLVVSYVN
Y18856_HBe_P-RF-CB        ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB033557_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB195939_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB195940_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB195941_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB195950_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB195951_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB195955_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB195956_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB195957_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB241109_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AB674504_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AP011104_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AP011105_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AP011108_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY040627_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY123041_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY167095_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY247030_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY800249_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY817510_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY817511_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY817515_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY862865_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
AY862866_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
DQ144601_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
DQ478887_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
DQ478889_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
DQ478890_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
DQ478892_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
DQ478897_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU787434_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU835240_HBe_P-RF-GC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ386649_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ562314_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ715384_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ715385_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ715411_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ715412_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ715413_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ715414_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ787446_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
FJ787480_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377516_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377520_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377534_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377539_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377544_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377548_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377549_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377560_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377564_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377565_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377573_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377581_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377595_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377596_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377611_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377614_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377626_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377630_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377634_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ377635_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ924618_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HM750133_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HM750143_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HM750145_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HM750146_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HM750149_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HM750150_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700505_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700507_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700508_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700521_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700547_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JF491448_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JF491449_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JF491451_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JF491455_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JF491456_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JN104442_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JQ040146_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JQ040174_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JQ040175_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JQ732168_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JQ801476_HBe_P-RF-CG      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JQ801477_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JX429898_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JX661487_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JX661494_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JX661498_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774183_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774186_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774198_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774201_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774212_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774234_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774258_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774294_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774317_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774322_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774324_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774328_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774332_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774341_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774344_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774423_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774424_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774426_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774448_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774452_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774455_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774456_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774457_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774458_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774470_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774471_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774480_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774489_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774495_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774499_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873524_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873527_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873531_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873532_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873534_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173279_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173299_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173300_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173320_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173322_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173325_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173326_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173329_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173330_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173349_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ173350_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ410520_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KJ803802_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KP148352_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KP276253_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KP276254_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KP276255_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KP276256_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KR013816_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KT003704_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KT991421_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU519422_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU519423_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU679942_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU963990_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU963991_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU963993_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU963994_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU963995_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU963998_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU963999_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964001_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964003_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964005_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964007_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964008_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964009_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964303_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964304_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964305_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964306_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964307_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964308_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964309_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964310_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964311_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964312_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964313_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964314_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964316_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU964317_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KX660674_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KX660675_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KX660680_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LC279263_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LC279264_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LC279265_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LC279266_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LC279267_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LC365290_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LC458432_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LC519797_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LC519803_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MG826144_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MG826146_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MG826147_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MG826148_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MG893554_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MG893555_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MG893559_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MH094410_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK321265_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534574_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534606_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534623_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534637_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534641_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534664_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534672_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534682_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534684_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534685_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534717_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534722_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534723_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534724_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534735_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534736_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK720627_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK720628_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650072_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650073_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650074_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650075_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650078_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650080_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650081_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650082_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650085_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650086_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650087_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN657315_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683571_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683572_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683574_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683579_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683582_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683584_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683586_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683587_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683590_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683592_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683594_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683596_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683605_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683607_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683609_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683612_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683613_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683614_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683615_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683616_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683619_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683623_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683626_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683628_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683630_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683632_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683635_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683639_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683643_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683644_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683645_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683647_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683649_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683652_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683653_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683654_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683656_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683658_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683659_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683661_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683662_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683663_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683671_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683673_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683684_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683685_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683686_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683689_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683690_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683692_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683693_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683694_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683695_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683696_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683697_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683699_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683700_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683713_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683714_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683715_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683723_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683724_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426456_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426463_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426465_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426466_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426467_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426468_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426471_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426472_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426480_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426484_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426485_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426488_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426491_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426493_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426495_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426496_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426497_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426498_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426499_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426500_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426502_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426505_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426508_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426509_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426511_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426512_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426513_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426517_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426518_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426519_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426520_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426521_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426522_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426524_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426525_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426526_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426528_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426529_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426530_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426534_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426537_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426538_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426539_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426540_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426541_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426543_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426546_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426547_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426549_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426554_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426556_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426557_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426558_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426559_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426560_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426562_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426563_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426565_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426566_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426567_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426569_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426570_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426571_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426572_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426573_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426574_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426575_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426576_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT645035_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT645049_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT645065_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT645066_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MW887644_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
OM732333_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
DQ315779_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
GQ205387_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HQ700497_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HQ700501_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HQ700503_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HQ700524_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HQ700525_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HQ700541_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HQ700581_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HQ700582_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HQ700583_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
HQ700584_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
JN664940_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KJ470884_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KJ470886_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KJ470887_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KJ470888_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KJ470890_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KT366505_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
MH481858_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
MH481861_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
MK516279_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
MK516280_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
AB493837_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AB493840_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AB493847_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AB554014_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AB554015_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AB554019_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AB554021_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AB644286_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AP011102_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AP011103_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ358155_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
GQ358156_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700498_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700499_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700518_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700519_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700527_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700528_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700542_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
KU695741_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
KU695742_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
KU695743_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
KU695744_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
KU695746_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683622_HBe_P-RF-DC      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683624_HBe_P-RF-DC      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683625_HBe_P-RF-DC      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AF297619_HBe_P-RF-DA      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
JF439776_HBe_P-RF-AG      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
KJ586810_HBe_P-RF-AF      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
MF925404_HBe_P-RF-AC      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
MN683683_HBe_P-RF-DC      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
AY373430_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
DQ111987_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EF103285_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594435_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
EU594436_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
GQ183486_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JQ687532_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524359_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM577663_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM577664_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP168416_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP168417_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KP168418_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT366492_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736917_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KU736923_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KX357623_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
LK995391_HBe_P-RF-ED      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK598654_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618439_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MN507850_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT426114_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ097850_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
X80925_HBe_P-RF-DE        ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY236161_HBe_P-RF-DA      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898686_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898687_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898688_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898690_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898693_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898695_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898696_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898698_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JX898699_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KM524357_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KR905422_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT366503_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
KT366504_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF925392_HBe_P-RF-DB      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF967563_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MH724222_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618438_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618440_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618442_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618444_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK618445_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT426111_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MT426113_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
U95551_HBe_P-RF-DE        ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
AY161146_HBe_P-RF-AD      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
GQ377627_HBe_P-RF-CD      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVN
EU939606_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KM524337_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
KC012653_HBe_P-RF-AD      ALESPEHCSPHHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVGYVN
EU871983_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871984_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871986_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871987_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871988_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871989_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871990_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871999_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774442_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534577_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650076_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650083_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683655_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683720_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871993_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU871996_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU872014_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU872015_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774178_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774364_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT645071_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
EU916241_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVD
FJ023667_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
FJ023670_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
FJ023673_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
FR714490_HBe_P-RF-GB      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
KC172106_HBe_P-RF-GB      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
MG826145_HBe_P-RF-BC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
MH746811_HBe_P-RF-BC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
MH746812_HBe_P-RF-BC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
MH746813_HBe_P-RF-BC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
MK534669_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
FJ386585_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
MT426482_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
MT426490_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
KT991417_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVN
KT991423_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVN
KY363262_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVN
KY363263_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVN
FJ715346_HBe_P-RF-CB      ALESPEHCSPHHTAVRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
FJ715347_HBe_P-RF-CB      ALESPEHCSPHHTAVRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
FJ882614_HBe_P-RF-GC      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
HF571060_HBe_P-RF-AE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MF925389_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KP148337_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534662_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534687_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534690_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
LT935669_HBe_P-RF-FD      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MN683636_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683637_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683638_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683651_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683703_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JF828933_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JF828934_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JF828935_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JF828936_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
JF828938_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
Y18857_HBe_P-RF-CB        ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700560_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
X75656_HBe_P-RF-CB        ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700531_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700532_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVN
HQ700537_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGXLMTLATWVGTNLEDPASRDLVVSYVN
JF440000_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440001_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440002_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440003_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440004_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440005_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440006_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440008_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440009_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440010_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440014_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF440015_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JF439998_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
JN664925_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVN
MN683722_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534616_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534688_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MF925370_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVN
MT426542_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
MT426564_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
KX660685_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683641_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774461_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774463_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774484_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774494_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN650079_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683597_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683610_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683621_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683640_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683642_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683650_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683676_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683687_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683688_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683718_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683719_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683660_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVN
KC774487_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774492_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC774497_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KC875339_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
MF618346_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
KF192839_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
KF192841_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
MF618347_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVN
OP256005_HBe_P-RF-DA      ALESPEHCSPHHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVN
KF873515_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873517_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KU679939_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT645069_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KF873521_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KM606751_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KP995112_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVN
KT991427_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534716_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683706_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MN683711_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY470844_HBe_P-RF-DC      ALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY470846_HBe_P-RF-DC      ALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY470847_HBe_P-RF-DC      ALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY470849_HBe_P-RF-DC      ALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY470850_HBe_P-RF-DC      ALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY470854_HBe_P-RF-DC      ALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY470855_HBe_P-RF-DC      ALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVN
KY470856_HBe_P-RF-DC      ALESPEHCSPHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVN
MH464852_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MK534558_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534559_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534560_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534562_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534563_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534564_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534567_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534569_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534579_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534580_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534589_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534598_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534607_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534610_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534625_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534633_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534639_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534648_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534651_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534654_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534655_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534670_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534695_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534718_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534731_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534609_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534646_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534681_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534663_HBe_P-RF-CB      ALESPEHCSPHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVN
MK534617_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK534618_HBe_P-RF-BC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MK598653_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVN
MN683678_HBe_P-RF-DC      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPPSRELVVSYVN
MT426515_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426523_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426527_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT426551_HBe_P-RF-CB      ALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVN
MT591275_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDQSSRDLVVSYVN
OP121186_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMNLGTWVGVNLEDPASRDLVVSYVN
MZ097719_HBe_P-RF-DE      ALESPEHCSHHHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVN
MZ097724_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVN
MZ097767_HBe_P-RF-DE      ALQSPEHCSPHHTALRQAILCWGELMTLATWVGVNLQDQTSRDLVVSYVN
OP153975_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLINLSTWVGANLEDQASRDLVVSYVN
OP153984_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLINLSTWVGANLEDQASRDLVVSYVN
OP153995_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLINLSTWVGANLEDQASRDLVVSYVN
OP153972_HBe_P-RF-DE      ALESPEHCSPHHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVN
                           *      :  ***.:.    *      ..* . *     : .      :

AY161140_HBe_P-RF-AD      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPIL
MF488699_HBe_P-RF-DE      TNMGLKFRQLLWFHISCLTFGRDTFLEYLVAFGVSIRTPTAYRPPHAPIL
AB014375_HBe_P-RF-CB      VNMGLKLRQILWFHVSCLTFGRDTVLEYLVSFGVWIRTPTAYRPPNAPIL
AB031265_HBe_P-RF-CB      VNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AB033559_HBe_P-RF-DE      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AB048702_HBe_P-RF-DE      TNVGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AB105172_HBe_P-RF-CB      VNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AB194949_HBe_P-RF-AE      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPIL
AB198084_HBe_P-RF-CB      VNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AB222708_HBe_P-RF-AD      TNMGLKIRQLLWFHTSCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPIL
AB330368_HBe_P-RF-DA      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AB367393_HBe_P-RF-CB      VNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AB367400_HBe_P-RF-CB      VNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPIL
AB367419_HBe_P-RF-CB      VNMGLKLRQLLWFHLSCLMFGRETVLEYLVSFGVWIRTPAAYRPPNAPIL
AB367800_HBe_P-RF-CB      VNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPIL
AB453985_HBe_P-RF-AC      TNMGLKLRQILWFHVSCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AB493838_HBe_P-RF-CB      VNMGLKIRQLLGFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AB493842_HBe_P-RF-CB      VNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPIL
AB554022_HBe_P-RF-CB      VNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPIL
AB583679_HBe_P-RF-DE      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPIL
AB670303_HBe_P-RF-CB      VNMGLKXRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPIL
AB674434_HBe_P-RF-DE      THMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPIL
AF297620_HBe_P-RF-DA      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AF461361_HBe_P-RF-CB      VNMGLKLRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AJ344117_HBe_P-RF-DE      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPIL
AM494716_HBe_P-RF-DE      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AY057948_HBe_P-RF-DC      VNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AY123424_HBe_P-RF-CB      VNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AY161141_HBe_P-RF-AD      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPIL
AY161145_HBe_P-RF-AD      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPIL
AY161147_HBe_P-RF-DA      TNMGLKIRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPIL
AY206374_HBe_P-RF-CB      VNMGLKLRQILWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPIL
AY233277_HBe_P-RF-AC      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AY233293_HBe_P-RF-DE      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPIL
AY233295_HBe_P-RF-DE      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPIL
AY817512_HBe_P-RF-DC      VNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPIL
AY817513_HBe_P-RF-DC      VNTGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
AY862864_HBe_P-RF-DC      VNMGLKIRQLLWFHISCLTFGRKTVLEYLVSFGVWIRTPPAYRPPNAPIL
DQ315777_HBe_P-RF-DE      TNMGLKFRQLLWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPIL
DQ315780_HBe_P-RF-DE      TNMGLKFRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPIL
DQ464167_HBe_P-RF-DE      TNMGLKFRQLLWFHVSCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPIL
DQ478886_HBe_P-RF-DC      VNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAP