HBVdb

Dataset for protein SHBs of genotype F

[Download (right click)] [Sequences] [Repertoires]

644 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KT630614_SHBs_P-F      MENITSGFLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036905_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036906_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036913_SHBs_P-F      MENITSGLXGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB064316_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AB086397_SHBs_P-F      MDNITSGLLGPLLVLQAAFFLLIKILTIPRSLDSWWTSLNFLGETPGCPG
AB116549_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB116550_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB116654_SHBs_P-F      MDNITSGLLGPLLVLQAVFSLLTKILTIPQSLDSWWTSLNFLGGTTGCPG
AB166850_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKIRTIPQSLDLWWTSLNFLGGLPGCPG
AB214516_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB365437_SHBs_P-F      MDNTTSGLRGPLLVLRAVCFLLTKIRTMPQSLDSWWTSLNFLGGLPGCPG
AB365443_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB365444_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGGLPGCLG
AB365446_SHBs_P-F      MDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGALPGCPG
AB365449_SHBs_P-F      MDNITSGLXGPLLVLQAVCFLWTKILKTPQSLDSWWTSLNFLGALPGCPG
AB365450_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AF043561_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AF043573_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AF043578_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGTPGCPG
AF223963_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AF223965_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AF288623_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWPSLNFLGGLPGCPG
AF288624_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AF288625_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AF288627_SHBs_P-F      MDNITSGLLGPLHVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AF288628_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY090455_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY090456_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AY254523_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY264387_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY264388_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLTGCPG
AY264389_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTRILTIPQSLDSWWTSLNFLGGLPGCPG
AY264390_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AY264391_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AY264392_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGGTPGCPG
AY264394_SHBs_P-F      MENITSRLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY264395_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY264396_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY264397_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY264398_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY264399_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGSPGCPG
AY264400_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY311347_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY311355_SHBs_P-F      TENITSGLLGPLLVLQAVCFWLTKIRKIPQSLDSWWTSLNFLGGLPGCPG
AY311358_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWGTSLNFLGGLPGCPG
AY311360_SHBs_P-F      MENITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY311361_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPG
AY311362_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGLPECPG
AY311369_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY311370_SHBs_P-F      MENITSGLLGPLLVLQAGGFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY739216_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY739217_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILKIPQSLDSWWTSLNFLGGLPGCPG
DQ131127_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ403173_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
DQ776247_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ899142_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ899146_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ899147_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ899148_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ899150_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF397981_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGALPGCPG
EF397983_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPG
EF397984_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLIKILTIPKSLDSWWTSLNFLGGLPGCPG
EF397986_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF397987_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGALPGCPG
EF397990_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGGLPGCPG
EF398029_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EF398030_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF398034_SHBs_P-F      MDNITSGLLGPLLVSQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF398037_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF398040_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EF398041_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF576808_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPRCPG
EF690484_SHBs_P-F      MDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690486_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690502_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690505_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690507_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGALPECPG
EF690508_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSRNFLGELPGCPG
EF690509_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690510_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTTPQSLDSWWTSLNFLGELPACPG
EF690511_SHBs_P-F      MDNITSGLLGPLLVLQAVSFLLIKILTIPQSLDSWWTSLNSLGALPGCPG
EU159674_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCSG
EU366132_SHBs_P-F      MDNITSGLLRPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EU670260_SHBs_P-F      MDNITSGLLGPLHVSQAVCSLLTKILTIPQRLDSWWTSLNFLGGTPGCPG
EU670261_SHBs_P-F      MDNITSGLPGPLLVSQAVCSSLTKILTIPKRLDSWWTSLNFLGGTPGCPG
FJ589065_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ589066_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLEGLPGCPG
FJ589067_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
FJ589070_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLEGLPGCPG
FJ657525_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLSFLGGTPGCPG
FJ709463_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709466_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTMPQSLDSWWTSLNFLGGTPGCPG
FJ709468_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709469_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQNLDSWWTSLNFLGGTXGCPG
FJ709473_SHBs_P-F      MDNITSGLLGPLLVLQAVCSLLIKILTIPQNLDSWWTSLNFLGGTPGCPG
FJ709480_SHBs_P-F      MDNITSGLLGPLLVLQAVCSLLTKILTIPQXLDSWWTSLNFLGGTPGCPG
FJ709482_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGETPGCPG
FJ709485_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709488_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGETPGCPG
GQ486140_SHBs_P-F      MDNITSGLLGPLLVLQAVXFLLTKILTXPXSLDSWWTSLNFLGXLPGCPG
GQ486493_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
GQ486515_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
GQ486570_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
GQ486779_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPECPG
GQ486830_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPXSLDSWWTSLNFLGGLPGCPG
HE981182_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM101096_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDLWWTSLNFLGGLPGCPG
HM101125_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
HM467760_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSRNFLGDLPGCPG
HM467762_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPG
HM467771_SHBs_P-F      MENIISGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
HM467772_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
HM467783_SHBs_P-F      MENITSGLLGPLLVLQAVFFLLIKILTIPQSLDSWWTSLNFLGGLPGCPG
HM467784_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGPHGCPG
HM467786_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPECPG
HM585200_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM622135_SHBs_P-F      MDNITSGHLGPLLVLQAVCSLLTKIRTIPQSLDSWWTSLNFLGGTPGCPG
JF439884_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
JN604198_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JN604201_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIRILTIPQSLDSWWTSLNFLGGTPGCPG
JN604211_SHBs_P-F      MENITSGLLGPLLVLQAVFFLLTKILTIPXXLDSWWTSLNFLGGLPGCPG
JN604225_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGETPGCPG
JN604233_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JN604271_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPRSLDSWWTSLNFLGETPGCPG
JN688701_SHBs_P-F      MDNITSGLLGPLLVLQAVXFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
JN688709_SHBs_P-F      MDNITSGLLGPLLVLQGVFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
JN688720_SHBs_P-F      MDNITSGLLGPLLVLQAVFFSLIKIRTIPQSLDSWWTSLNFLGELPGCPG
JN792916_SHBs_P-F      MDSITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JN792917_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTSFLTIPQSLDSWWTSLNFLGGTPGCPG
JN792918_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGTPGCPG
JN792921_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGXPGCPG
JN811655_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
JN983942_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
JN983943_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPG
JN983944_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKIRKIPQNLDSWWTSLNFLGGLPGCPG
JN983945_SHBs_P-F      MDNITSGLLGPLLVLQAVSSLLIKILTIPQSLDSWWTSLNSLGGLPGCPG
JN983946_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNSLGGLPGCPG
JN983947_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLSIKILTIPQSLDSWWTSLNFLGGLPGCPG
JQ272888_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGELPGCPG
JX079937_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
JX849635_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC494396_SHBs_P-F      MDNITSGLLGPLLVLHAVCFLLTKILTMPQSLDSWWTSLNFLGGLPGCPG
KC494397_SHBs_P-F      MDNTYSGLLRPLLVSQAVCSLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC494399_SHBs_P-F      MDNITSGLLGPLLVLQAVYFLLIKILIMPQSLDSWWTSLNFLGGLPGCPG
KC494400_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGRTPGCPG
KC494401_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF199901_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KF414651_SHBs_P-F      ----TSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414654_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGIPGCPG
KF414655_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KF414656_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTNILTIPQSLDSWWTSLNFLGGTPGCPG
KF414662_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414664_SHBs_P-F      MENITSGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414669_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414670_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414671_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDLWWTSLNFLGGTPGCPG
KF414672_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414674_SHBs_P-F      ---ITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGELPGCPG
KF414676_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ586805_SHBs_P-F      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPGCPG
KJ586807_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLNSWWTSLNFLGGTPGCPG
KJ638656_SHBs_P-F      MDNTTSGHLGLLLVLQAVCFLLTKILKIPQNLDSWWTSLNFLGGTPGCPG
KJ638657_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPXSLDSWWTSLNFLGGTPGCPG
KJ638659_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLXKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ638660_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ638662_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSRNFLGEIPGCPG
KJ638664_SHBs_P-F      MDNITSGLLGPLLVLQAVSFLLTKILTIPQSLDSWWTSLNFLGGPPGCPG
KJ676694_SHBs_P-F      MDNITSGLLGPLLVLQAVSFLLIKILTIPQSLDSWWTSLNFLGELPGCPG
KJ843163_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843167_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843168_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843185_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843202_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843203_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843207_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843220_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843223_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKIXTIPQSLDSWWTSLNFLGGLPGCPG
KJ843225_SHBs_P-F      MDNITSGLLGPLLVLQAVYFLLIKILTIPQNLDSWWTSLNFLGGLPGCPG
KJ843226_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KM998715_SHBs_P-F      MDNISSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KP718106_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP718107_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KP718110_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGTPGCPG
KP995085_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995087_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KP995089_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995097_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTMPQSLDLWWTSLSFLEGLPGCPG
KP995101_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGELPGCPG
KP995104_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995105_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGALPGCPG
KP995106_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCLG
KP995107_SHBs_P-F      MDNTTSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995110_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCLG
KP995111_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGGLPGCPG
KP995113_SHBs_P-F      MDNITSKLLGPLLVLQGVFFSLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995114_SHBs_P-F      MDNITSGLLRPLLVLQAVSFLLTKIRTIPQSLDSWWTSLNFLGGLPGCPG
KP995115_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPVCPG
KP995117_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILKIPQSLDSWWTSLNFLGGLPGCPG
KP995118_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995119_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995124_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP997611_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KT630622_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KT630623_SHBs_P-F      MXNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KT630633_SHBs_P-F      MXNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847477_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847479_SHBs_P-F      MDNITSELLGPPLGLQAVCSSLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847480_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KU847485_SHBs_P-F      MDNITSGLLGPLLVLQAVFFLLTKIXTXPQSLDSWWTSLNFLGGLPGCPG
KU847492_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXLPGCPG
KU847498_SHBs_P-F      MDNITSGLLGPLLVLQAVXFLLTKILTIPQSLDSWWTSLNFLGGLPXCPG
KU847502_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGETPGCPG
KU847516_SHBs_P-F      MDNITSRLPRPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KU847522_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGEKPGCPG
KU847524_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSHSFLGELPGCPG
KU847525_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLXKILTIPXSLDSWWTSLNFLGGTPGCPG
KU847528_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847536_SHBs_P-F      MDNITSGLLGPLLVLQVVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KU847549_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPG
KU847562_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847566_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847569_SHBs_P-F      MDNITSGLLGPLLVLQAVXFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847576_SHBs_P-F      MDNITSGLLGPLLVLQAVFFSLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847586_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGALPGCPG
KU847590_SHBs_P-F      MDNITSGLLGPLLVLQXVCXLLXKIXXIPQSLDSWWTSLXFLGXLPGCPG
KU847600_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXLPGCPG
KU847606_SHBs_P-F      -DNITSGLLGPLXVLQXVXSLLTKILTIPQSLDSWWTSLNFLGXTPGCPG
KU847608_SHBs_P-F      MDNTTSGLLGPLLVLQAVCFLLTKIRTIPXSLDSWWTSLNFLGEIPGCPG
KU847612_SHBs_P-F      MDNITSGLLGPLPVLQAVCSLLTKIRTIPKNLDSWWTSLNFLGGTPGCPG
KU847613_SHBs_P-F      MDNITSGLLGPLLVLQAVXFLLXKILTIPQSLDSWWTSLNFLGXLPGCPG
KU847616_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLXFLGGLPXCPG
KU847627_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGTPGCXG
KU847628_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPG
KU847653_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXLPGCPG
KU847686_SHBs_P-F      MDNITSGLLGPLLVLQVXFFXLTKILTIPQRLDSWWTSLNFLEGIPGCPG
KU847694_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847728_SHBs_P-F      MDNITSGLLGPLLVLQAVFFSLIKILTIPRSLDSWWTSLNFLGGLPGCPG
KX264660_SHBs_P-F      MDNITSGLLXPXXVLXAVCXLLTKILTIPQSLDSWWXSLNFLGGLPGCPG
KX264661_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KX264662_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPG
KX757665_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY382415_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY476323_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY476324_SHBs_P-F      MDNITSGLLGPLLVLQAVFFLLTKILTIPKSLDSWWTSLNFLGGTPGCPG
KY476325_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY476326_SHBs_P-F      MDNITSGLLGPLLVLXAVCFWLTKIRKIPQSLDSWWTSLNFLGGPPGCPG
KY476327_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQNLDSWWTSLNFLGGTPGCPG
KY476328_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY476329_SHBs_P-F      MDNISSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGTPGCPG
KY476330_SHBs_P-F      MDNITSGLLGPLLVLQAVCFSLTKILTIPQSLDSWWTSRNFLGETPGCPG
KY809938_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDLWWTSLNFLEGPPGCPG
KY809940_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKIRKIPQSLDLWWTSLNFLGALPECPG
KY809942_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLNFLGALPGCPG
KY809943_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KY809945_SHBs_P-F      MDNITSGLLGPLLVLQAVCFWLTKIRTIPQKLDSWWTSLSFLGGLPGCPG
KY809946_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPG
LT935661_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
LT935663_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
LT935666_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPKSLDSWWTSLNFLGGTPGCPG
LT935667_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGDTPGCPG
MF150693_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MG098564_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MG098565_SHBs_P-F      MDSITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPX
MG098566_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDXXWTSLXFLGELPGCPG
MG098569_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTXPQSLDSWWTSLSFLEGLPGCPG
MG098574_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MG098575_SHBs_P-F      MDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MG098578_SHBs_P-F      MDNITSGLLGPLLVLQAVCILLIKILTIPQSLDSWWTSLNFLGGLPGCPG
MG098579_SHBs_P-F      TDSITSEHLPPLLVSSAVSSLLTRIRTIPRSLDSWWTSLNFLGGVPGCPG
MG098582_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGLPGCPG
MG098583_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGALPGCPG
MG098584_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKIRTIPQSLDSWWTSLSFLGGLPECPG
MG877703_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MG877704_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXLPGCPG
MG877706_SHBs_P-F      MDNITSGLLGPLLVLQAVSFSLIKILTIPQSLDSWWTSLNFLGELPGCPG
MG877707_SHBs_P-F      MDNITSGLLGPLLVLQAVSFSLIKILTIPQSLDSWWTSLNFLGELPGCPG
MG877708_SHBs_P-F      MDNITSGLLGPLLVLQAVSFSLIKILTIPQSLDSWWTSLNFLGELPGCPG
MG877712_SHBs_P-F      MDNITSGLLGPLLVLQAAFFLLTKILTMPQSLDSWWTSLNFLGGLPGCPG
MG877714_SHBs_P-F      MDNITSGLLGPLLVXQAXFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MG877715_SHBs_P-F      MDNITSGLLGPLLXLQAVFFLLTKILTIPQSLDSWWTSLNFLGGPPXCPG
MG877716_SHBs_P-F      MDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGXPPXCPG
MG877717_SHBs_P-F      MDNITSGLLGPLLVLQAVFFLLTKILTIPQXLDSWWTSLNFLGXPPXCPG
MG877721_SHBs_P-F      MDTITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MG877722_SHBs_P-F      MDTITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGALPGCPG
MH051991_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK058437_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MK183631_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGLPGCPG
MK183632_SHBs_P-F      MDNITSGLLGPLLVLQAVSFLLIKILTIPQSLDSWWTSRNFLGELPXCPG
MK183636_SHBs_P-F      IDNITSGLLKPLLMLQAVYFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK183637_SHBs_P-F      MDSTTSGLLGPLPVLRAVCSLLTKIRRIPQSLDSWWISLNFLGGLPGCPG
MK183638_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK183644_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK183645_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPRSLDSWWTSLNFLGGLPGCPG
MN758704_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLSFLGGLPGCPG
MN758708_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGALPGCPG
MW999667_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MZ064547_SHBs_P-F      --NITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
OL907123_SHBs_P-F      MDXXTSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXTPGCPG
ON529685_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKIRKIPQSLDSWWTSLSFLGDLPGCPG
ON529686_SHBs_P-F      MDNITSGLLGPLLGLQAVCFLXTKILTIPQSLDSWWTSLNFLGALPGCPG
ON529708_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
ON585701_SHBs_P-F      MDNITSGHLGPLLVLQAVCSLLTKIRKIPQSLDSWWTSLSFLGGLPGCPG
U91821_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91823_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
X75658_SHBs_C-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
X75661_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
X75663_SHBs_P-F        MENITSGLLGPLRVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPRCPG
AB036909_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036910_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036911_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036912_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036914_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036915_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036916_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036917_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036918_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036919_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036920_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB037944_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB037945_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB037946_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB116551_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY264393_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ899149_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF397982_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF397985_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF397989_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690506_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
JN226078_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
JX849588_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC113400_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414675_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP718109_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP718112_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995123_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995125_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP997649_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KX264498_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MG839213_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MH051986_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MH051987_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036907_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB036908_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB116552_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AF223964_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AY090458_SHBs_C-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AY090459_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
AY090461_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
DQ823091_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
DQ823092_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
DQ823093_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
DQ823094_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
DQ823095_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EF690513_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EF690514_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EU366118_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EU366133_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EU670262_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ657529_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709459_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709460_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709461_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709464_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709465_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709476_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709481_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709484_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709487_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709491_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709493_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709494_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709495_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709496_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
GQ486468_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
GQ486537_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
GQ486582_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585186_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585187_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585188_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585189_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585190_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585191_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585192_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585193_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585194_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585195_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585196_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585197_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585198_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM585199_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM590471_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM590472_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM590473_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM627320_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HQ378247_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JN688691_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JN688699_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JN688703_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JN792914_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JN792919_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JN792920_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JN792922_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JX079936_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
JX849637_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KC113386_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KC113393_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KC113394_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KC113395_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KC494404_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KF414666_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KF779236_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ586808_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843164_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843171_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843174_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843176_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843177_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843178_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843179_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843180_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843181_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843190_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843193_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843194_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843195_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843196_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843197_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843198_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843199_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843200_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843201_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843204_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843206_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KM233681_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KP718104_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KP718113_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KP995098_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KP997612_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KP997613_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KU847620_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KX264496_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY458063_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY476322_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY476332_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
LT935660_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
LT935664_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
LT935668_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
LT935670_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MF150689_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MF150690_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MG877700_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999662_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999664_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999665_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999666_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999668_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999669_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999670_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999671_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999672_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999673_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999674_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999675_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999676_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MZ065410_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MZ065411_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MZ065412_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91805_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91806_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91807_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91808_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91811_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91812_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91813_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91814_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91815_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91817_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91818_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91822_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91826_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91828_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91829_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91830_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
U91831_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
HM467785_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AB365453_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AF043577_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AF223962_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AF288626_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ823086_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ823087_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ823088_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ823089_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ823090_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF576812_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690512_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
FJ657528_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
HE981181_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
JN811656_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843175_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843189_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843209_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843211_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843212_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843219_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843221_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843222_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843224_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KX264499_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KY382411_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KY809939_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MG098580_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK183630_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK183633_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK183639_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK183640_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK183641_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK183643_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MK183647_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
U91803_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
AY179735_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGTPGCPG
FJ709458_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLEGTPGCPG
MZ065413_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC113368_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC113383_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KC113381_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995086_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTRILTIPQSLDSWWTSLNFLGGLPGCPG
KC113389_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KC113399_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ131124_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ131128_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ899144_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ899145_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690470_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690485_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690487_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690488_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690489_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690490_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690491_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690492_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690493_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690494_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690495_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690496_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690497_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690498_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690499_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690500_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690501_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690503_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF690504_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
HM101098_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC113364_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC494394_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC494395_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC494403_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC494405_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414673_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843191_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP718103_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KT630619_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KT630634_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KT896494_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847512_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847515_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847689_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KX264497_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MZ065418_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MZ065419_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
ON529707_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
U91825_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
X69798_SHBs_P-F        MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ403174_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
DQ403175_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EU366116_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
FJ657519_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
FJ657522_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843208_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843210_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ843213_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
DQ899143_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
HM101130_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MZ065402_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MZ065417_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MZ065403_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995109_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPG
MZ065414_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPG
EF398033_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EF398035_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EF398039_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KF414677_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
EF398031_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF398032_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
EF398038_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414649_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414650_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847496_SHBs_P-F      MDNITSGLLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
HM101097_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KC494402_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
FJ709457_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
FJ709462_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KF414659_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MZ065415_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
FJ709478_SHBs_P-F      MDNITSGLLGPLLVLQAVCSLLIKILTIPQNLDSWWTSLNFLGGTPGCPG
KP718111_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
GQ486626_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
HE981183_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
ON585699_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
JF439885_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MZ065420_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847550_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPG
KU847723_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLIKILTIPQSLDSWWTSLNFLGGLPGCPG
MZ065416_SHBs_P-F      MDNITSGLLGPLLVLQAVSSLLIKILTIPQSLDSWWTSLNSLGGLPGCPG
KP995120_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KF414658_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MZ064548_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KJ586806_SHBs_P-F      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843169_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843170_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KJ843205_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KU847580_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MF150688_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MW999663_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY458061_SHBs_P-F      MDNISSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY458062_SHBs_P-F      MDNISSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KP995116_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KP995090_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MH051988_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MH051989_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MH051990_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MH051992_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KP995126_SHBs_P-F      MENITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
KY382416_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY382417_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
OK106257_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
LT935659_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
LT935662_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
LT935665_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
KY809944_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGLPGCPG
MF150694_SHBs_P-F      MDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGTPGCPG
MG877705_SHBs_P-F      MDSITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGXLPGCPG
                            *                  :   *  *:    *   *     *  

KT630614_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036905_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036906_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036913_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
AB064316_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB086397_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB116549_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB116550_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB116654_SHBs_P-F      QNSLSPTSNHLPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLLVLLDY
AB166850_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB214516_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB365437_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLVCLIFLLVLLDY
AB365443_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB365444_SHBs_P-F      QNSQSPTSNHLPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB365446_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB365449_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB365450_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF043561_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF043573_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF043578_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF223963_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
AF223965_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF288623_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF288624_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF288625_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF288627_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF288628_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090455_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090456_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY254523_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264387_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264388_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264389_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264390_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264391_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264392_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264394_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264395_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264396_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264397_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264398_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264399_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264400_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY311347_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY311355_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY311358_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY311360_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY311361_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY311362_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY311369_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY311370_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY739216_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY739217_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ131127_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ403173_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ776247_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ899142_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ899146_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLPRFIIFLFILLLCLIFLLVLLDY
DQ899147_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLQCLIFLLVLLDY
DQ899148_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
DQ899150_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
EF397981_SHBs_P-F      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF397983_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF397984_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
EF397986_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF397987_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF397990_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398029_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398030_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398034_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398037_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398040_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398041_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF576808_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690484_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690486_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690502_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690505_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690507_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690508_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690509_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690510_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690511_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU159674_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU366132_SHBs_P-F      QNSQSPTSNHLPTSCPLTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU670260_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU670261_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ589065_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ589066_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ589067_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ589070_SHBs_P-F      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ657525_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709463_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709466_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709468_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709469_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
FJ709473_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
FJ709480_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709482_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709485_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709488_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486140_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486493_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486515_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486570_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486779_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486830_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLXLLDY
HE981182_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM101096_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM101125_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467760_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467762_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467771_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467772_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
HM467783_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467784_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467786_SHBs_P-F      QNSQSPTSNHLLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585200_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM622135_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439884_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604198_SHBs_P-F      QNSLSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
JN604201_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLFLIFLLVLLDY
JN604211_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604225_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
JN604233_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604271_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688701_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688709_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688720_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792916_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792917_SHBs_P-F      QNSQSPTSNHLPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792918_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792921_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN811655_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983942_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
JN983943_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983944_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983945_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983946_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983947_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ272888_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX079937_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849635_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC494396_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC494397_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCRRRFIIFLFILLLCLIFLLVLLDY
KC494399_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC494400_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KC494401_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF199901_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414651_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414654_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414655_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414656_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILPLCLIFLLVLLDY
KF414662_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
KF414664_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414669_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414670_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414671_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414672_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414674_SHBs_P-F      QNSQSPTSNHLLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414676_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ586805_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ586807_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ638656_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KJ638657_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ638659_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ638660_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ638662_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ638664_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KJ676694_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843163_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843167_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843168_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KJ843185_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KJ843202_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843203_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843207_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843220_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843223_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843225_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843226_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM998715_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP718106_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP718107_SHBs_P-F      QNSQSPTSNHLXTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP718110_SHBs_P-F      QNSQSPTSNHLLTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995085_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995087_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KP995089_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995097_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995101_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995104_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KP995105_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995106_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995107_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995110_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995111_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDS
KP995113_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995114_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWTCLRRFIIFLFILLLCLIFLLVLLDY
KP995115_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995117_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995118_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
KP995119_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
KP995124_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997611_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KT630622_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT630623_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT630633_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847477_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847479_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847480_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLXDY
KU847485_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847492_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847498_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847502_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847516_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847522_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847524_SHBs_P-F      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847525_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847528_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847536_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLXLIFLLVLLDY
KU847549_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847562_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847566_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847569_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847576_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847586_SHBs_P-F      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847590_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847600_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLXLLDY
KU847606_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRXFIIFLFILLLCLIFLLVLXDY
KU847608_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847612_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847613_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847616_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847627_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847628_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIXLFILLLCLIFLLVLLDY
KU847653_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847686_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847694_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847728_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX264660_SHBs_P-F      QNSQSPTSNXLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX264661_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX264662_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX757665_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
KY382415_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY476323_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY476324_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY476325_SHBs_P-F      QNSQSPTSNHLPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY476326_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY476327_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY476328_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY476329_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY476330_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809938_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809940_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809942_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809943_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809945_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809946_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935661_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935663_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935666_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935667_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150693_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG098564_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG098565_SHBs_P-F      QNSQSPTSNHLPTSCPXTCPVYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG098566_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG098569_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPXYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG098574_SHBs_P-F      QNSQSPTSNHLPTSCPPTCHGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
MG098575_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG098578_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG098579_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG098582_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
MG098583_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWXCLRRFIIFLFILLLCLIFLLVLLDY
MG098584_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MG877703_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877704_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877706_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877707_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877708_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877712_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877714_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877715_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877716_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877717_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877721_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877722_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH051991_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK058437_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183631_SHBs_P-F      QNXQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183632_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183636_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183637_SHBs_P-F      QNSQSPTSNHLQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183638_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183644_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183645_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN758704_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN758708_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999667_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ064547_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OL907123_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON529685_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON529686_SHBs_P-F      QNSQSPISNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON529708_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON585701_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91821_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91823_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X75658_SHBs_C-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X75661_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X75663_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036909_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036910_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036911_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036912_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036914_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036915_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036916_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036917_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036918_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036919_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036920_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB037944_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB037945_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB037946_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB116551_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY264393_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ899149_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF397982_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF397985_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF397989_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690506_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226078_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849588_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113400_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414675_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP718109_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP718112_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995123_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995125_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997649_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX264498_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG839213_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH051986_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH051987_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036907_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB036908_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB116552_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF223964_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090458_SHBs_C-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090459_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090461_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ823091_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ823092_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ823093_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ823094_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ823095_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690513_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690514_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU366118_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU366133_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU670262_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ657529_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709459_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709460_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709461_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709464_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709465_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709476_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709481_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709484_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709487_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709491_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709493_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709494_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709495_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709496_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486468_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486537_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486582_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585186_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585187_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585188_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585189_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585190_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585191_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585192_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585193_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585194_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585195_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585196_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585197_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585198_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM585199_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM590471_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM590472_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM590473_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM627320_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ378247_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688691_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688699_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688703_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792914_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792919_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792920_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792922_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX079936_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849637_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113386_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113393_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113394_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113395_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC494404_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414666_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779236_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ586808_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843164_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843171_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843174_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843176_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843177_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843178_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843179_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843180_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843181_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843190_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843193_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843194_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843195_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843196_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843197_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843198_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843199_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843200_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843201_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843204_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843206_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM233681_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP718104_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP718113_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995098_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997612_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997613_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847620_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX264496_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY458063_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY476322_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY476332_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935660_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935664_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935668_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935670_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150689_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150690_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877700_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999662_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999664_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999665_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999666_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999668_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999669_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999670_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999671_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999672_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999673_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999674_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999675_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999676_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065410_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065411_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065412_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91805_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91806_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91807_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91808_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91811_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91812_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91813_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91814_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91815_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91817_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91818_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91822_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91826_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91828_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91829_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91830_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91831_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM467785_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB365453_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF043577_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF223962_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF288626_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ823086_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ823087_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ823088_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ823089_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ823090_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF576812_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690512_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ657528_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE981181_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN811656_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843175_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843189_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843209_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843211_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843212_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843219_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843221_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843222_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843224_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX264499_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY382411_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809939_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG098580_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183630_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183633_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183639_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183640_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183641_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183643_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK183647_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91803_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY179735_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709458_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065413_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113368_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113383_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113381_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995086_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113389_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113399_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ131124_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ131128_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ899144_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ899145_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690470_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690485_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690487_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690488_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690489_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690490_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690491_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690492_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690493_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690494_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690495_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690496_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690497_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690498_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690499_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690500_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690501_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690503_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690504_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM101098_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC113364_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC494394_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC494395_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC494403_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC494405_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414673_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843191_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP718103_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT630619_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT630634_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT896494_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847512_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847515_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847689_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX264497_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065418_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065419_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON529707_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U91825_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X69798_SHBs_P-F        QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ403174_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ403175_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU366116_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ657519_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ657522_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843208_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843210_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843213_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ899143_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM101130_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065402_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065417_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065403_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLQCLIFLLVLLDY
KP995109_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065414_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398033_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398035_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398039_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414677_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398031_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398032_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398038_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414649_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414650_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847496_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM101097_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC494402_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709457_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709462_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414659_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065415_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709478_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KP718111_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486626_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HE981183_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON585699_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439885_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065420_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KU847550_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847723_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065416_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995120_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF414658_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ064548_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ586806_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843169_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KJ843170_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KJ843205_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KU847580_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
MF150688_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
MW999663_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KY458061_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY458062_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995116_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KP995090_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH051988_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH051989_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH051990_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH051992_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995126_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY382416_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY382417_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OK106257_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935659_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935662_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT935665_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809944_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150694_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877705_SHBs_P-F      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
                       **  ** **     ** **  **       ** * **   * *** * * 

KT630614_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB036905_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036906_SHBs_P-F      QGMLPVCPLTNG---TSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036913_SHBs_P-F      RGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB064316_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB086397_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB116549_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB116550_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
AB116654_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB166850_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB214516_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB365437_SHBs_P-F      QGMLPVCPLIPGSTTTSTGACKTCTTLAQGTSMFPSCCCSKPSDRNCTCI
AB365443_SHBs_P-F      QGMLPVCPLIPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB365444_SHBs_P-F      QGILPVCPVIPGSTTTSTGPCKTCTTXAQGTSMFPSCCCSKPSDGNCTCI
AB365446_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB365449_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCNTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB365450_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTXMFPSCCCSKPSDGNCTCI
AF043561_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF043573_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF043578_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF223963_SHBs_P-F      QGMLPVCPPLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF223965_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF288623_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF288624_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF288625_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF288627_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF288628_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY090455_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY090456_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMLPSCCCTKPSDGNCTCI
AY254523_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264387_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTGTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264388_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264389_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264390_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264391_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264392_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264394_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264395_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTPAQSTSMFPSCCCSKPSDGNCTCI
AY264396_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPLDGNCTCI
AY264397_SHBs_P-F      QGMLPVCPLLPGSTATSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264398_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPLDGNCTCI
AY264399_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264400_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY311347_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY311355_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY311358_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY311360_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY311361_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY311362_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY311369_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY311370_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY739216_SHBs_P-F      QGMLPVCPLIPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY739217_SHBs_P-F      QGMLSVCPLLPGSTTTSTGPCKTCTSLAQGTSMFPSCCCSKPSDGTCTCI
DQ131127_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ403173_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ776247_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ899142_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ899146_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ899147_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQRTSMFPSCCCSKPSDGNCTCI
DQ899148_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ899150_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF397981_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF397983_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF397984_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF397986_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF397987_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF397990_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398029_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398030_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398034_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398037_SHBs_P-F      QGMLPVCPLLSGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398040_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398041_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF576808_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690484_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690486_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690502_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690505_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690507_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690508_SHBs_P-F      QGMLPVCPLLPGSTTTITGPCKTCTTIAQGTSMFPSCCCSKPSDGNCTCI
EF690509_SHBs_P-F      QGMLPVCPLRPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCICI
EF690510_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690511_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EU159674_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EU366132_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EU670260_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EU670261_SHBs_P-F      QGMLPVCPLLPESTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ589065_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ589066_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ589067_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ589070_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ657525_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709463_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709466_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709468_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709469_SHBs_P-F      QGMLPVCPLLPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709473_SHBs_P-F      QGMLPVCPLLPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709480_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709482_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709485_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709488_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486140_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486493_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486515_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCXKPSDGNCTCI
GQ486570_SHBs_P-F      QGMLPVCPLLPGSMTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486779_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486830_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HE981182_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM101096_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM101125_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM467760_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM467762_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM467771_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM467772_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM467783_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM467784_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM467786_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585200_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM622135_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JF439884_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN604198_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN604201_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN604211_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN604225_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN604233_SHBs_P-F      QGMLPVCPLLPGSTTTTTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN604271_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN688701_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN688709_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN688720_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN792916_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN792917_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN792918_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN792921_SHBs_P-F      QGMLPVCPLXPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN811655_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN983942_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN983943_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN983944_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN983945_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
JN983946_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN983947_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JQ272888_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX079937_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX849635_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC494396_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC494397_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMVPSCCCSKPSDGNCTCI
KC494399_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC494400_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC494401_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF199901_SHBs_P-F      QGMLPVCPLLPGTTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414651_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414654_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414655_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414656_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414662_SHBs_P-F      HGILPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414664_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414669_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414670_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSEGNCTCI
KF414671_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGPSMFPSCCCSKPLDGNCTCI
KF414672_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTPAQGTSMFPSCCCSKPSDGNCTCI
KF414674_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414676_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ586805_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ586807_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ638656_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSRPSDGNCTCI
KJ638657_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTXAQGTSMFPSCCCSKPSDGNCTCI
KJ638659_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ638660_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ638662_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ638664_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ676694_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KJ843163_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843167_SHBs_P-F      QGMLPVCPLLPGSMTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843168_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843185_SHBs_P-F      QGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KJ843202_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843203_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLALGTSMFPSCCCSKPSDGNCTCI
KJ843207_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KJ843220_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843223_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843225_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843226_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKXCTTLAQGTSMFPSCCCSKPSDGNCTCI
KM998715_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP718106_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP718107_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP718110_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995085_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995087_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995089_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995097_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995101_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995104_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KP995105_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995106_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KP995107_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995110_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTALAQGTSMFPSCCCSKPSDGNCTCI
KP995111_SHBs_P-F      QGMLPVCPLLPGSMTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KP995113_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KP995114_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KP995115_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KP995117_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTPLAQGTSMFPSCCCSKPSDGNCTCI
KP995118_SHBs_P-F      HGILPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995119_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995124_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP997611_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KT630622_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KT630623_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KT630633_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847477_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847479_SHBs_P-F      QGMLPVCPXIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847480_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847485_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847492_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTXLAQGTSMFPSCCCXKPSDGNCTCI
KU847498_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847502_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847516_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847522_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847524_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847525_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847528_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847536_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKSCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847549_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847562_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847566_SHBs_P-F      QGMLPVCPLXPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847569_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCIKPSEGNCTCI
KU847576_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847586_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KU847590_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847600_SHBs_P-F      QGMXPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847606_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847608_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMLPSCCCSKPSDGNCTCI
KU847612_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847613_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847616_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847627_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847628_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847653_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847686_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847694_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847728_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KX264660_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KX264661_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KX264662_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KX757665_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY382415_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY476323_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY476324_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY476325_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY476326_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQETSMFPSCCCSKPSDGNCTCI
KY476327_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY476328_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY476329_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY476330_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY809938_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY809940_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY809942_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY809943_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY809945_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSEGNCTCI
KY809946_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT935661_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT935663_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPWDGNCTCI
LT935666_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT935667_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MF150693_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098564_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098565_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098566_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098569_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098574_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098575_SHBs_P-F      QGMLPVCPLIPGSTTTTTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098578_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098579_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098582_SHBs_P-F      QGMLPVCPLIPGSTTTSTGXCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098583_SHBs_P-F      QGMLPVCPLIPGSTTTITGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098584_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877703_SHBs_P-F      QGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877704_SHBs_P-F      QGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877706_SHBs_P-F      QGMLPVCPLIPGSTTTSTGACKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877707_SHBs_P-F      QGMLPVCPLIPGSTTTSTGACKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877708_SHBs_P-F      QGMLPVCPLIPGSTTTSTGACKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877712_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877714_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877715_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877716_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877717_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877721_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877722_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH051991_SHBs_P-F      QGMLPVCPLLPESTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK058437_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSEGNCTCI
MK183631_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183632_SHBs_P-F      QGMLPVCPLIPGSTTTSTGQCKTCTTLAQGTSMLPSCCCTKPSDGNCTCI
MK183636_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183637_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183638_SHBs_P-F      QGXLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183644_SHBs_P-F      QGMLPVCPLIPGSMTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183645_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MN758704_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMLPSCCCSKPSDGNCTCI
MN758708_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999667_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ064547_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
OL907123_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
ON529685_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
ON529686_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
ON529708_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
ON585701_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91821_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91823_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMLPSCCCTKPSDGNCTCI
X75658_SHBs_C-F        QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
X75661_SHBs_P-F        QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
X75663_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTALAQGTSMFPSCCCSKPSDGNCTCI
AB036909_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036910_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036911_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036912_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036914_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036915_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036916_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036917_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036918_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036919_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036920_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB037944_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB037945_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB037946_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB116551_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY264393_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ899149_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF397982_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF397985_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF397989_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690506_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN226078_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX849588_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC113400_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414675_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP718109_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP718112_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995123_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995125_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP997649_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KX264498_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG839213_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH051986_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH051987_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036907_SHBs_P-F      QGMLPVCPLTNG---TSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB036908_SHBs_P-F      QGMLPVCPLTNG---TSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB116552_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF223964_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY090458_SHBs_C-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY090459_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY090461_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ823091_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ823092_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ823093_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ823094_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ823095_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690513_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690514_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EU366118_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EU366133_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EU670262_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ657529_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709459_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709460_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709461_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709464_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709465_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709476_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709481_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709484_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709487_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709491_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709493_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709494_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709495_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709496_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486468_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486537_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486582_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585186_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585187_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585188_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585189_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585190_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585191_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585192_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585193_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585194_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585195_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585196_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585197_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585198_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM585199_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM590471_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM590472_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM590473_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM627320_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HQ378247_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN688691_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN688699_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN688703_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN792914_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN792919_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN792920_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN792922_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX079936_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JX849637_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC113386_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC113393_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC113394_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC113395_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC494404_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414666_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF779236_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ586808_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843164_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843171_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843174_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843176_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843177_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843178_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843179_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843180_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843181_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843190_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843193_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843194_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843195_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843196_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843197_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843198_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843199_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843200_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843201_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843204_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843206_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KM233681_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP718104_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP718113_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995098_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP997612_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP997613_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847620_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KX264496_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY458063_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY476322_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY476332_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT935660_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT935664_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT935668_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT935670_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MF150689_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MF150690_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877700_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999662_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999664_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999665_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999666_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999668_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999669_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999670_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999671_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999672_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999673_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999674_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999675_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999676_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ065410_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ065411_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ065412_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91805_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91806_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91807_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91808_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91811_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91812_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91813_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91814_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91815_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91817_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91818_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91822_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91826_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91828_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91829_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91830_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91831_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM467785_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AB365453_SHBs_P-F      QGMLPVCPLIPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF043577_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF223962_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AF288626_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ823086_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ823087_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ823088_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ823089_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ823090_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF576812_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690512_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ657528_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HE981181_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JN811656_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843175_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843189_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843209_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843211_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843212_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843219_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843221_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843222_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843224_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KX264499_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY382411_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY809939_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG098580_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183630_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183633_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183639_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183640_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183641_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183643_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MK183647_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91803_SHBs_P-F        QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
AY179735_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709458_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ065413_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC113368_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC113383_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMLPSCCCTKPSDGNCTCI
KC113381_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTGTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995086_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC113389_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC113399_SHBs_P-F      QGMLPVCPLLPGSTATSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ131124_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ131128_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ899144_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ899145_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690470_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690485_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690487_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690488_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690489_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690490_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690491_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690492_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690493_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690494_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690495_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690496_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690497_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690498_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690499_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690500_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690501_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690503_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF690504_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM101098_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC113364_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC494394_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC494395_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC494403_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC494405_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414673_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843191_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP718103_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KT630619_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KT630634_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KT896494_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847512_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847515_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847689_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KX264497_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ065418_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ065419_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
ON529707_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
U91825_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
X69798_SHBs_P-F        QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ403174_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
DQ403175_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EU366116_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
FJ657519_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
FJ657522_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KJ843208_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KJ843210_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KJ843213_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
DQ899143_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
HM101130_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MZ065402_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MZ065417_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
MZ065403_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQRTSMFPSCCCSKPSDGNCTCI
KP995109_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ065414_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398033_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398035_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398039_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414677_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398031_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398032_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
EF398038_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414649_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414650_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847496_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
HM101097_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KC494402_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709457_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709462_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414659_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ065415_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
FJ709478_SHBs_P-F      QGMLPVCPLLPGSTTTSTGQCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP718111_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
GQ486626_SHBs_P-F      QGMLPVCPLIPGSTTTSTGPCKTCTTLAQGTSMFPSCCCXKPSDGNCTCI
HE981183_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
ON585699_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
JF439885_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ065420_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847550_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847723_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ065416_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCTKPSDGNCTCI
KP995120_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KF414658_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MZ064548_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ586806_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843169_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843170_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KJ843205_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KU847580_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MF150688_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MW999663_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY458061_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY458062_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995116_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995090_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH051988_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH051989_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH051990_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MH051992_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KP995126_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY382416_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY382417_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
OK106257_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT935659_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT935662_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
LT935665_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
KY809944_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MF150694_SHBs_P-F      QGMLPVCPLLPGSTTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGNCTCI
MG877705_SHBs_P-F      QGMLPVCPLIPGSSTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCI
                       :*  .***       * ** *.  *  *  . *.***** :* : .* **

KT630614_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB036905_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB036906_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB036913_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB064316_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB086397_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB116549_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
AB116550_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
AB116654_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB166850_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB214516_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLIIWMIWY
AB365437_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB365443_SHBs_P-F      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB365444_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB365446_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB365449_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AB365450_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF043561_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF043573_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF043578_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF223963_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF223965_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF288623_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF288624_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF288625_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF288627_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AF288628_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY090455_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVHFVQWCVGLSPTVWLLVIWMIWY
AY090456_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY254523_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264387_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264388_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264389_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264390_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264391_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLSAIWMIWY
AY264392_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264394_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264395_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264396_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264397_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264398_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLSAIWMIWY
AY264399_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY264400_SHBs_P-F      PIPSSWALGRYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY311347_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWGVGLSPTVWLLVIWMIWY
AY311355_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
AY311358_SHBs_P-F      PIPSSLALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY311360_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY311361_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY311362_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY311369_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY311370_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY739216_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
AY739217_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ131127_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ403173_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMTWY
DQ776247_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ899142_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ899146_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ899147_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ899148_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
DQ899150_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF397981_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF397983_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF397984_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF397986_SHBs_P-F      PIPSSWALGKYLWEWASARFSCLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF397987_SHBs_P-F      PIPSSWALGKYLWEWASARFYWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF397990_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF398029_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF398030_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF398034_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
EF398037_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
EF398040_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF398041_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
EF576808_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF690484_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF690486_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF690502_SHBs_P-F      PIPSSWALGKFLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF690505_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF690507_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVTWMIWY
EF690508_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF690509_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EF690510_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVRFVQWCVGLSPTVWLLVILMIWY
EF690511_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EU159674_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EU366132_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPIVWLLVIWMIWY
EU670260_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
EU670261_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ589065_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
FJ589066_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ589067_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ589070_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ657525_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ709463_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ709466_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ709468_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ709469_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ709473_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ709480_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ709482_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
FJ709485_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVISMIWY
FJ709488_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
GQ486140_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
GQ486493_SHBs_P-F      PIPSSWALGKYLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
GQ486515_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
GQ486570_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
GQ486779_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
GQ486830_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLXVIWMIWY
HE981182_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVPFVQWCVGLSPTVWLLVIWMIWY
HM101096_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLSVIWMIWY
HM101125_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM467760_SHBs_P-F      PIPSSWALGKYLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM467762_SHBs_P-F      PIPSSWALGKYLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM467771_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM467772_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
HM467783_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM467784_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM467786_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
HM585200_SHBs_P-F      PIPSSWALGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
HM622135_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JF439884_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN604198_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLVVQFVQWCVGLSPTVWLLVIWMIWY
JN604201_SHBs_P-F      PIPSSWALGKYLWEWXSARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN604211_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN604225_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN604233_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN604271_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN688701_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN688709_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN688720_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN792916_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN792917_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN792918_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN792921_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN811655_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN983942_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN983943_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN983944_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN983945_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN983946_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JN983947_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JQ272888_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
JX079937_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
JX849635_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLXLLVQFVQWCVGLSPTVWLLVIWMIWY
KC494396_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KC494397_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KC494399_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KC494400_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KC494401_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
KF199901_SHBs_P-F      PIPSSWALGKYLWEWASVRFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KF414651_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KF414654_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KF414655_SHBs_P-F      PIPSSWALGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
KF414656_SHBs_P-F      PIPSSWALGKYLWDWASARFPWLSSLVQFVQWCVGLSPTVWLLVMWMIWY
KF414662_SHBs_P-F      PIPSSWALGKFLWGWASARFSWLSLLVQFVQWCVELSPTVWLLVILMIWY
KF414664_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWF
KF414669_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
KF414670_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVLLLVIWMIWY
KF414671_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
KF414672_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KF414674_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KF414676_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
KJ586805_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ586807_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ638656_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ638657_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ638659_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ638660_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ638662_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ638664_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ676694_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ843163_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVRFVQWCVGLSPTVWLLVIWMIWY
KJ843167_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ843168_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ843185_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ843202_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVELSPTVWLLVIWMIWY
KJ843203_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ843207_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ843220_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ843223_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ843225_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KJ843226_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KM998715_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP718106_SHBs_P-F      PIPSSWALGKYLWEWASAXFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP718107_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP718110_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995085_SHBs_P-F      PIPSSWALGKYLWDWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
KP995087_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
KP995089_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995097_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995101_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995104_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995105_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995106_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995107_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995110_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995111_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995113_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995114_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPIVWLLAIWMIWY
KP995115_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995117_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVHFVQWCVGLSPTVWLLVIWMIWY
KP995118_SHBs_P-F      PIPSSWALGKFLWGWASARFSWLSLLVQFVQWCVELSPTVWLLVILMIWY
KP995119_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP995124_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KP997611_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KT630622_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMXWY
KT630623_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KT630633_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847477_SHBs_P-F      PIPSSWALGKXLWEWVSXRFSWLSLLVQFVQWCVGLSPXVWLLVIWMIWY
KU847479_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGXSPTVWLLVIWMIWY
KU847480_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847485_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847492_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847498_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847502_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847516_SHBs_P-F      PIPSSWALGKYLWEWASAPFSWSSLLVQIVQWCVGLSPTVWLLVIWMIWY
KU847522_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847524_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847525_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847528_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCAGLSPTVWLLVIWMIWY
KU847536_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847549_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847562_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847566_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847569_SHBs_P-F      PIPSSWALGKYLWEWVSARFSWLSLLVQFVQWCVGLSPIVWLLVIWMIWY
KU847576_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847586_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847590_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847600_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLXXIWMXWY
KU847606_SHBs_P-F      PIPSSWAXGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847608_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847612_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLNLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847613_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847616_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847627_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847628_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847653_SHBs_P-F      PIPSSWALGKYLWEWASARFSXLSLLVQFVRWCVGLSPTVWLLVIWMIWY
KU847686_SHBs_P-F      PIPSSWAFGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847694_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KU847728_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCAGLSPTVWLLVIWMIWY
KX264660_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KX264661_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KX264662_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KX757665_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVMWMIWY
KY382415_SHBs_P-F      PIPSSWALGKYLWEWASXRFSWLXLLVQFVQWCVGLSPTVWLLVIWMIWY
KY476323_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY476324_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY476325_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY476326_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY476327_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY476328_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY476329_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY476330_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY809938_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY809940_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY809942_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY809943_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY809945_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
KY809946_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
LT935661_SHBs_P-F      PIPSSWALGKYLWEWGSARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
LT935663_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
LT935666_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
LT935667_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MF150693_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MG098564_SHBs_P-F      PIPSSRALGKYLWECASARFSWLILLVQFVQWCVGFSPTVWLLVIWMIWY
MG098565_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQCCVGLSPTVWLLVIWMIWY
MG098566_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MG098569_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MG098574_SHBs_P-F      PIPSSWXLGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MG098575_SHBs_P-F      PIPSSWALGKYLWEWASXRFSWLNLLVQFVQWCEGLSPIVWLLVIWMIWY
MG098578_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MG098579_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMXWY
MG098582_SHBs_P-F      PIPSSWALGKYLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWY
MG098583_SHBs_P-F      PIPSSWALGXYLWEWASARFSWLSLLVQ