HBVdb

Dataset for protein SHBs of genotype F

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     *                  :   *  *:    *   *     *  **  ** **     ** **  **       
MdNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGlPGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRF
 est              fss ir rkm rn  l     s  eet x                                 
                  s                      ap e                                 
                  x                        x                                    

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
** * **   * *** * * .*  .***       * ** *.  *  *  . *.***** .* : .* *******   * 
IIFLFILLLCLIFLLVLLDYQGMLPVCPLlPGSTTTSTGPCKTCTTLAQGTSMFPSCCCSKPSDGNCTCIPIPSSWALGK
                 v           i         q r           l     t                    
                                                                                
                                                                                

       170       180       190       200       210       220      
....:....|....:....|....:....|....:....|....:....|....:....|....:.
 **   *  *     :: :*.     ** *      * *:*                         
YLWEWASARFSWLSLLVQFVQWCVGLSPTVWLLVIWMIWYWGPNLCSILSPFIPLLPIFCYLWVSI
           n              i     m           nt                y 
                                                                  
                                                                  
© 1998-2022Legal notice