HBVdb

Dataset for protein Pol of genotype F

[Download (right click)] [Sequences] [Repertoires]

319 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


AY090459_Pol_P-F      MPLSYPHFRKLLLLDD--EAGLLEEELPRLADEGLNRRVAEDLNLQLPHV
KC494400_Pol_P-F      MPLSYPHFRKLLLLDD--EAGLLEEELPRLADEVLNRRVAEDLNLQLPNV
LT935665_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB064316_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
LT935662_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995110_Pol_P-F      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
MG098564_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAKDLNLQLPNV
KC494399_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KP718107_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLQLPNV
KP995118_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KC494396_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KJ843226_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476327_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843174_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
LT935660_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843177_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ586807_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792922_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM590474_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999663_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLSRRVAEDLNLQLPNV
FJ709462_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JX079936_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLHLPTV
HM585200_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MK183631_Pol_P-F      MPLSYPHFRKLLLLDD--EAGXXXXXXXXLADEGLNRRVAEDLNLQLPNV
LT935661_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP718104_Pol_P-F      MPLSYPHFRKLLLLDD--EAGLLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ638656_Pol_P-F      MPLSYPHFRKRLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585194_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KF199901_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ899145_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
EU366132_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB086397_Pol_P-F      MPLSYPHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLHLPNV
EU366116_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476323_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ638657_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ638663_Pol_P-F      MPLSYPHFRKLLLLDD--ESGPLEEELPRLADEGLNRRVAEDLNLQIPDV
KY476332_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476322_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995116_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843197_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AF223963_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ657522_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476330_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQVPDV
JN792921_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLRLPDV
KP995109_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ899147_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ586808_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843191_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLABEDLNRRVAABLNLQLPNV
OK106257_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AF223964_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY458062_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476324_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
KY382415_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
OL907123_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
LT935667_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KF779236_Pol_P-F      MPLSYPHFRKLLLLDDGTEAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995114_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
MG098582_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLGNEGLNRRVAKDLNLQLPNV
DQ899150_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNCRVAEDLNLQLPNV
LT935666_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLQLPNV
AY090458_Pol_C-F      MPLSYPHFRKLLLLDE--EAGLLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476325_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KM233681_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY382416_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843167_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476328_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MK183640_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AY090461_Pol_P-F      MPLSYPHFRKLLLLDD--EAGLLEEELPRLADEGLNRRVAEDLNLQLPNV
MG098579_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLQLPTV
KJ843193_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843205_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB116654_Pol_P-F      MPLSYPHFRRLLLLED--DAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
KP718110_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ638662_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995097_Pol_P-F      MPLSYQCFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
JN688709_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLHLPNV
KJ843178_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476331_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM627320_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ899144_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MW999668_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP718113_Pol_P-F      MPLSYPHFRKLLLLDD--EAGLLEEELPRLADEGLNRRVAEDLNLQLPNV
KT896494_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLHLPNV
KC494404_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLQLPNV
MG877700_Pol_P-F      MPLSYPHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
LT935659_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995105_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
HM585195_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KX757665_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB036905_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036910_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB036911_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036913_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036915_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036919_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036920_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB116549_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB116551_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB116552_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB166850_Pol_P-F      MPLSYPYFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB214516_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB365446_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPTV
AB365449_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB365450_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB365453_Pol_P-F      MPLSYPHFLKLLLLDH--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AF223962_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AF223965_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AY090455_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQVPNV
AY179735_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AY311369_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
AY311370_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRVADEGLNRRVAEDLNLQLPNV
DQ776247_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823086_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823087_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
DQ823088_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ823089_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823090_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823091_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ823092_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823094_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823095_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ899142_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
DQ899143_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
DQ899146_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
DQ899148_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ899149_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNGRVAEDLNLQLPNV
EF576808_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLRLPNV
EF576812_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
EU366133_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ589066_Pol_P-F      MPLSYPHFRKLLLLDH--EAGPLEEELPRLADEDLNRRVAEDLNLHLPNV
FJ589067_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDV
FJ657519_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLQLPNV
FJ657525_Pol_P-F      MPLSYPHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
FJ657528_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
FJ709457_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709458_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709459_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709460_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709463_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709464_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709465_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ709494_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HE981181_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HE981183_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585186_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585192_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585196_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585197_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN688691_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN688701_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
JN688720_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792917_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792918_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792919_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN792920_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN811655_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
JN811656_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
JQ272888_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLHLPDV
JX079937_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPXEEELPRLADEGLNRRVAEDLNLQLPNV
KC494394_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAADLNLQLPNV
KC494395_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLQLPNV
KC494397_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAADLNLQLPNV
KC494401_Pol_P-F      MPLSYPHFRKLLLLDD--QAGPLEKELPRLADEDLNRRVAADLNLQLPNV
KC494402_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KC494403_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAADLNLQLPNV
KC494405_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAADLNLQLPNV
KJ638659_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ638660_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEVELPRLADEGLNRRVAEDLNLQLPNV
KJ676694_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
KJ843163_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843164_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843169_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843170_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843175_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843179_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843180_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843181_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843185_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843189_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843190_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843194_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843202_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843204_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843207_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843209_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843211_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843212_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843213_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843220_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843223_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843225_Pol_P-F      MPLSYPHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLHLPNV
KM998715_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP718103_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP718106_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPBV
KP718109_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP718111_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP718112_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995098_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995101_Pol_P-F      MPLSYPHFRKLLLLED--EAGPLEEELPRLADEDLNRRVAEDLNLRLPDV
KP995104_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KP995106_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KP995107_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KP995111_Pol_P-F      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPDV
KP995113_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KP995115_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLHLPDV
KP995117_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995119_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995120_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KP995123_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KP995124_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KP995125_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KP995126_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KX264497_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
KX264499_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476326_Pol_P-F      MPLSYPHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY476329_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
LT935664_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
LT935668_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MG098565_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLANEGLNRRVAEDLNLQLPNV
MG098566_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLAHEGLNRRVAEDLNLQLPDV
MG098569_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLHLPDV
MG098570_Pol_P-F      MPLSYPHFRKLLVLDD--EAGPLEEELPRLADEGLNRRVAKDLNLQLPTV
MG098573_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLEDEGLNRRVAEDLNLQLPNV
MG098574_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLANEGLNRRVAKDLNLQLPNV
MG098575_Pol_P-F      MPLSYPHFRKLLLLDI--EAGPLEEELPRLANEGLNRRVSKDLNLQLPNV
MG098578_Pol_P-F      MPLSYPHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MG098580_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MG098583_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLANEGLNRRVAEDLNLQLPDV
MG098584_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLKQELPRLABEGLNRRAAKDLNLQLPTV
MG877703_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPTV
MG877704_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPTV
MG877706_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MG877708_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEXXLPRLADEGLNRRVAEDLNLQLPNV
MG877715_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDV
MG877716_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDV
MG877717_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDV
MG877721_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLHLPNV
MG877722_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLHLPNV
MH051986_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MK183630_Pol_P-F      MPLSYPHFRKLLLLDD--EAGXXXXXXXRLADEGLNRRVAEDLNLQLPNV
MK183632_Pol_P-F      MPLSYPHFRKLLLLDD--EAGXXXXXXXRLADEGLNRRVAEDLNLQLPNV
MK183633_Pol_P-F      MPLSYPHFRKLLLLDD--EAGXXXXXXXXXADEGLNRRVAEDLNLQLPNV
MK183636_Pol_P-F      MPLSYPHFRKLLLLDD--EAGXXXXXXXXXADEGLNRRVAEDLNLQLPNV
MK183637_Pol_P-F      MPLSYPHFRKLLLLDN--EAGPXXXXXXXXADEGLNRRVAEDLNLQLPNV
MK183638_Pol_P-F      MPLSYPHFRKLLLLDD--KAGXXXXXXXXLADEGLNRRVAEDLNLQLPNV
MK183639_Pol_P-F      MPLSYPHFRKLLLLDD--EAGXXXXXXXXXADEGLNRRVAEDLNLQLPNV
MK183641_Pol_P-F      MPLSYPHFRKLLLLDD--EAGXXXXXXXRLADEDLNRRVAEDLNLQLPNV
MK183643_Pol_P-F      MPLSYPHFRKLLLLDH--KAGPLXXXXXXXADEGLNRRVAEDLNLQLPNV
MK183644_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEQKLXXXADEGLNRRVAEDLNLQLPNV
MK183645_Pol_P-F      MPLSYPHFRKLLLLNH--EAGPLQKKLPRLADEGLNRRVAEDLNLQLPNV
MW999662_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999664_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999665_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999673_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
ON585699_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNXRVAADLNLQLPNV
ON585701_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
X69798_Pol_P-F        MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAADLNLQLPNV
X75658_Pol_C-F        MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
X75663_Pol_P-F        MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
AB036909_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036912_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036914_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036916_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036917_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
AB036918_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KX264498_Pol_P-F      MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843195_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843196_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843199_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843200_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MK058437_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843208_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843210_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
DQ823093_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
EU366118_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
FJ657529_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843176_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843198_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843201_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843203_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843206_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HE981182_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585187_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585188_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585189_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585191_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585198_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM590473_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843171_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM622135_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HQ378247_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585190_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585199_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM590471_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM590472_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
HM585193_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN688699_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
JN688703_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KX264496_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KJ843219_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843221_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843222_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KJ843224_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KY382411_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
MK183647_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNV
KY458061_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
KY382417_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MG877705_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPTV
MG877707_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MH051987_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999666_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999667_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999669_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999670_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999671_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999672_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999674_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999675_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
MW999676_Pol_P-F      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPNV
                      *****  * : *:*:   .:*           * *. *.:  ***::* *

AY090459_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWLTPSFPDIHLHQDLIHKCEQFVGP
KC494400_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
LT935665_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AB064316_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHEDLIHKCEQFVGP
LT935662_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP995110_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
MG098564_Pol_P-F      SIPWTHKGGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KC494399_Pol_P-F      SIPWTHKVGNFTGLYSSTVPVFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KP718107_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNSDWVTPSFPDIHLHEDLIHKCEQFVGP
KP995118_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KC494396_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KJ843226_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KY476327_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843174_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
LT935660_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843177_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ586807_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN792922_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM590474_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999663_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709462_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHZDLIHKCEQFVGP
JX079936_Pol_P-F      SIPWTHKEGXFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585200_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MK183631_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
LT935661_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPNIHLHQDLIHKCEQFVGP
KP718104_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDCLTPSFPDIHLHQDLIHKCEQFVGP
KJ638656_Pol_P-F      SIPRTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585194_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KF199901_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ899145_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
EU366132_Pol_P-F      SIPWTHKVGNFTGLYSSTVPSFNPHWLTPHFPDIHLHQDLISKCEQFVGP
AB086397_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
EU366116_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KY476323_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ638657_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNSDWLTPSFPDIHLHZDLIHKCEQFVGP
KJ638663_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNSDWLTPSFPDIHLHEDLIHKCEQFVGP
KY476332_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476322_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP995116_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843197_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AF223963_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ657522_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCERFVGP
KY476330_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN792921_Pol_P-F      SIPWTHXVGNFTGLYSSTVPXFNPBWXTPSFPDIHLHQDLXXKCEQFVGP
KP995109_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLIAKCEQFVGP
DQ899147_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ586808_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843191_Pol_P-F      SIPWTHKXGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
OK106257_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AF223964_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY458062_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476324_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPEWLTPSFPDIHLHQDLIHKCEQFVGP
KY382415_Pol_P-F      SIPWTHKXGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
OL907123_Pol_P-F      SIPWTHKXGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
LT935667_Pol_P-F      SIPWTHKVGNFKGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KF779236_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP995114_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWATPSFPDIHLHQNLISKCEQFVGP
MG098582_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
DQ899150_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPNIHLHQDLISKCEQLVGP
LT935666_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AY090458_Pol_C-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPNIHLHQDLINKCEQFVGP
KY476325_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KM233681_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY382416_Pol_P-F      SIPWTHKXGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843167_Pol_P-F      SIPWTHKXGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476328_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MK183640_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AY090461_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MG098579_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843193_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843205_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AB116654_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP718110_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNSDWLTPSFPDIHLHEDLIQKCEQFVGP
KJ638662_Pol_P-F      SIPWTHKVGNFTGLYSATVPTFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995097_Pol_P-F      SIPWTHKVGSFTGLYSSTVPAFNPDWSIPSFPNIHLHQNLISKCEQFVGP
JN688709_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWETPSFPDIHLHQDLISKCEQFVGP
KJ843178_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY476331_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM627320_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ899144_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
MW999668_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP718113_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KT896494_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KC494404_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQNLIQKCEQFVGP
MG877700_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
LT935659_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP995105_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWVTPSFPDIHLHQDLISKCEQFVGP
HM585195_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KX757665_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AB036905_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036910_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036911_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036913_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036915_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036919_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036920_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB116549_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB116551_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB116552_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AB166850_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AB214516_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AB365446_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AB365449_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AB365450_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AB365453_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AF223962_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AF223965_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
AY090455_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
AY179735_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
AY311369_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
AY311370_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
DQ776247_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
DQ823086_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
DQ823087_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAYNPHWLTPSFPDIHLHQDLISKCEQFVGP
DQ823088_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
DQ823089_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCERFVGP
DQ823090_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
DQ823091_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ823092_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ823094_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ823095_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
DQ899142_Pol_P-F      SIPWTHKVGNFTGLYSSTGPAFNPNWSTPSFPDIHWHQNLISKCEQFVGP
DQ899143_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
DQ899146_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
DQ899148_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISRCEQFVGP
DQ899149_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
EF576808_Pol_P-F      SIPWTHRVGNFTGLYSSTVPTFNPHWLTPSFPDIHLHQDLISKCEQFVGP
EF576812_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
EU366133_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ589066_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWLTPSFPDIHLHQDLISKCEQFVGP
FJ589067_Pol_P-F      SIPYPXLMGXCTGLYSSTVPAFNPNWLTPSFPDIHLHQDMISKCEQFVGP
FJ657519_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
FJ657525_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ657528_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
FJ709457_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709458_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709459_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709460_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWVTPSFPDIHLHQDLIHKCEQFVGP
FJ709463_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709464_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709465_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ709494_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWLTPSFPDIHLHQDLIHKCEQFVGP
HE981181_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
HE981183_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585186_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585192_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585196_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585197_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN688691_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
JN688701_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
JN688720_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
JN792917_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHEDLIHKCEQFVGP
JN792918_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHEDLIHKCEQFVGP
JN792919_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN792920_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN811655_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
JN811656_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
JQ272888_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
JX079937_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPNIHLHQDLISKCEQFVGP
KC494394_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPFFPDIHLHQDLISNCEQFVGP
KC494395_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KC494397_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KC494401_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KC494402_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KC494403_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KC494405_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KJ638659_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ638660_Pol_P-F      SIPWTHKVGNFTGLYSATVPTFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ676694_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ843163_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843164_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPAFPDIHLHQDLIHKCEQFVGP
KJ843169_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843170_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
KJ843175_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ843179_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843180_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843181_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843185_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ843189_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ843190_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843194_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
KJ843202_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843204_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843207_Pol_P-F      SIPWTHKXGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCERFVGP
KJ843209_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
KJ843211_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843212_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843213_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCERFVGP
KJ843220_Pol_P-F      SIPWTHKXGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843223_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843225_Pol_P-F      SIPWTHKVGDFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KM998715_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP718103_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP718106_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQELISKCEQFVGP
KP718109_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP718111_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP718112_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995098_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KP995101_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWVTPSFPDIHLHQDLISKCEQFVGP
KP995104_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KP995106_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995107_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWSTPSFPDIHLHQNLISKCEQFVGP
KP995111_Pol_P-F      NIPWTHKVGNFTGLYSSTVPVFNPNWVTPCFPNIHLHQDLISKCEQFVGP
KP995113_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
KP995115_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
KP995117_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995119_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995120_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQNLISKCEQFVGP
KP995123_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPNIHLHQDLISKCEQFVGP
KP995124_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KP995125_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPNIHLHQDLISKCEQFVGP
KP995126_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KX264497_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
KX264499_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KY476326_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KY476329_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPEWLTPSFPDIHLHEDLIHKCEQFVGP
LT935664_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
LT935668_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MG098565_Pol_P-F      SIPWTHKGGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG098566_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHEDLISKCEQFVGP
MG098569_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG098570_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG098573_Pol_P-F      SIPWTHKGGNFTGLYSSTVPAFNPDWLTPSFPDIHLHQDLISKCEQFVGP
MG098574_Pol_P-F      SIPWTHKGGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG098575_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG098578_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
MG098580_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG098583_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG098584_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
MG877703_Pol_P-F      SIPWTHKVGNFTGLYSSTVPXFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG877704_Pol_P-F      SIPWTHKVGNFTGLYSSTVPXFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG877706_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG877708_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG877715_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
MG877716_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
MG877717_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
MG877721_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG877722_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MH051986_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
MK183630_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
MK183632_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPNIHLHQDLISKCEQFVGP
MK183633_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
MK183636_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWXTPSFPBIHLHQDLISKCEQFVGP
MK183637_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MK183638_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
MK183639_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
MK183641_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MK183643_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
MK183644_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWVTPSFPDIHLHQDLISKCEQFVGP
MK183645_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MW999662_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999664_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999665_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999673_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
ON585699_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
ON585701_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
X69798_Pol_P-F        SIPWTHKVGNFTGLYSSTVPAFNPNWSTPSFPDIHLHQDLISKCEQFVGP
X75658_Pol_C-F        SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
X75663_Pol_P-F        SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDMISKCEQFVGP
AB036909_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036912_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036914_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036916_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036917_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
AB036918_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KX264498_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
KJ843195_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843196_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843199_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843200_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MK058437_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843208_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843210_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
DQ823093_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
EU366118_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
FJ657529_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843176_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843198_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843201_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843203_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843206_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HE981182_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585187_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585188_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585189_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585191_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585198_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM590473_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843171_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM622135_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HQ378247_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585190_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWLTPSFPDIHLHQDLIHKCEQFVGP
HM585199_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPNWLTPSFPDIHLHQDLIHKCEQFVGP
HM590471_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM590472_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
HM585193_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
JN688699_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
JN688703_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIQKCEQFVGP
KX264496_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KJ843219_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843221_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843222_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KJ843224_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KY382411_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MK183647_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPHWLTPSFPDIHLHQDLISKCEQFVGP
KY458061_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
KY382417_Pol_P-F      SIPWTHKXGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MG877705_Pol_P-F      SIPWTHKVGNFTGLYSSTVPXFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MG877707_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPHWLTPSFPDIHLHQDLISKCEQFVGP
MH051987_Pol_P-F      SIPWTHKVGNFTGLYSSTVPAFNPNWLTPSFPDIHLHQDLISKCEQFVGP
MW999666_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999667_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999669_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999670_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999671_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999672_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999674_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999675_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
MW999676_Pol_P-F      SIPWTHKVGNFTGLYSSTVPTFNPDWLTPSFPDIHLHQDLIHKCEQFVGP
                      .** .   *  .****:* * :*.    * ** ** * ::  .**::***

AY090459_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KC494400_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
LT935665_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AB064316_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
LT935662_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP995110_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
MG098564_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KC494399_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP718107_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP995118_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KC494396_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KJ843226_Pol_P-F      LTKNEFRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KY476327_Pol_P-F      LTKNELRRLKLVMPSRFFPKATKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843174_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
LT935660_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843177_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPIEKGIKPYYPDNVVNHYFKTRHYL
KJ586807_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN792922_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM590474_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999663_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ709462_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JX079936_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPIEKGIKPYYPDNVVNHYFKTRHYL
HM585200_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MK183631_Pol_P-F      LTKNELRRFKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
LT935661_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP718104_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ638656_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPLEKGIKPYYPDNVVNHYFKTRHYL
HM585194_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KF199901_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ899145_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
EU366132_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB086397_Pol_P-F      LTKHELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
EU366116_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KY476323_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ638657_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ638663_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPLEKGIKPYYPDNVVNHYFKTRHYL
KY476332_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476322_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP995116_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843197_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AF223963_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ657522_Pol_P-F      LTKNELRRLKLIMPPKFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KY476330_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPLEKGIKPYYPDNVVNHYFKTRHYL
JN792921_Pol_P-F      LTKNELRRLKLVMPXRFXPKVTKYFPMXKGIKPYYPXXXVNHYFKTRHYL
KP995109_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
DQ899147_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KJ586808_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843191_Pol_P-F      LTKNELRXLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
OK106257_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AF223964_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY458062_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476324_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY382415_Pol_P-F      LTKNELXXLKLVMPSXFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTXHYL
OL907123_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPIEKGIKPYYPDNVVNHYFKTRHYL
LT935667_Pol_P-F      LTTNELRRLKLVMPSRFFPKVTKYFPMKKGIKPYYPDNVVNHYFKTRHYL
KF779236_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP995114_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
MG098582_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ899150_Pol_P-F      FTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYLEHAVNHYFKTRHYL
LT935666_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AY090458_Pol_C-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476325_Pol_P-F      LTKNEMRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KM233681_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY382416_Pol_P-F      LTKNELRRLKLVMPSXFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTXHYL
KJ843167_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY476328_Pol_P-F      LTKXELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MK183640_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AY090461_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MG098579_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHVVNHYFKTRHYL
KJ843193_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843205_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AB116654_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP718110_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ638662_Pol_P-F      LTXNELRRLKLVMPARFFPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
KP995097_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPIDKGIKPYYPEHAVNHYFKTRHYL
JN688709_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843178_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPIEKGIKPYYPDNVVNHYFKTRHYL
KY476331_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM627320_Pol_P-F      LTKNELRRLKLVMPSRFXPKXTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ899144_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYREHAVNHYFKTRHYL
MW999668_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP718113_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KT896494_Pol_P-F      LTKNELRRLKLVMPSRFYPKVTKYFPLDKGIKPYYPEHAVNHYFKTRHYL
KC494404_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MG877700_Pol_P-F      LTKNELRRLKLVMPSRFFPXVTKYFPLEKGIKPYYPDNVVNHYFKTRHYL
LT935659_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP995105_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPHYPEHVVNHYFKTRHYL
HM585195_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
KX757665_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AB036905_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036910_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
AB036911_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036913_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036915_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPIEKGIKPYYPEHSVNHYFKTRHYL
AB036919_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036920_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB116549_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
AB116551_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
AB116552_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AB166850_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB214516_Pol_P-F      LTKNELRRLKLIMPARIFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB365446_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB365449_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB365450_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AB365453_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AF223962_Pol_P-F      LTKNELRRLKLIMPSRFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AF223965_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
AY090455_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
AY179735_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
AY311369_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
AY311370_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ776247_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ823086_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ823087_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ823088_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ823089_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ823090_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ823091_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ823092_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ823094_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ823095_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
DQ899142_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPTDKGIKPYYPEHAVNHYFKTRHYL
DQ899143_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPTDKGIKPYYPEHAVNHYFKTRHYL
DQ899146_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
DQ899148_Pol_P-F      LTKNELRRLKLIMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
DQ899149_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
EF576808_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
EF576812_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
EU366133_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ589066_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHVVNHYFKTRHYL
FJ589067_Pol_P-F      LTKNELRRLKLVMPARFYPKLTKYFLLEKGIKPYYPEQAVNHYFKTRHYL
FJ657519_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
FJ657525_Pol_P-F      LTKNELRRLKLVMPSRFFPRVTKYFPLEKGIKPYYPDNVVNHYFKTRHYL
FJ657528_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
FJ709457_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ709458_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
FJ709459_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
FJ709460_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ709463_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ709464_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ709465_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
FJ709494_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HE981181_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
HE981183_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585186_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM585192_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM585196_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585197_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN688691_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN688701_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
JN688720_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFQTRHYL
JN792917_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN792918_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN792919_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN792920_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN811655_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
JN811656_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
JQ272888_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPHYPEHAVNHYFKTRHYL
JX079937_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KC494394_Pol_P-F      LTKNELQRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494395_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494397_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494401_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494402_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494403_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KC494405_Pol_P-F      LTKNEVRRLKLVMPARLYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KJ638659_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KJ638660_Pol_P-F      LTKNELRRLKLVMPARFFPKVTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ676694_Pol_P-F      LTKNELRRLKLVMPARFFPKHTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843163_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843164_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843169_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843170_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843175_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843179_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843180_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843181_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843185_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843189_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843190_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843194_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843202_Pol_P-F      LTKNELRRLKLIMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843204_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843207_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843209_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843211_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843212_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843213_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843220_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843223_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843225_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KM998715_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP718103_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP718106_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP718109_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP718111_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP718112_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995098_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KP995101_Pol_P-F      LTKNELRKFKLIMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKARHYL
KP995104_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP995106_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995107_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP995111_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEQAVNHYFKTRHYL
KP995113_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP995115_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP995117_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995119_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KP995120_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KP995123_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995124_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KP995125_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
KP995126_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KX264497_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
KX264499_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KY476326_Pol_P-F      LTKNELRRLKLXMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KY476329_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
LT935664_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
LT935668_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MG098565_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG098566_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYX
MG098569_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG098570_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG098573_Pol_P-F      LTKHELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG098574_Pol_P-F      LTKHELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG098575_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG098578_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG098580_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG098583_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG098584_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG877703_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG877704_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG877706_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG877708_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG877715_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG877716_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG877717_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG877721_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG877722_Pol_P-F      LTKNELRRLKLIMPARFFPKHTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MH051986_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
MK183630_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183632_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183633_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183636_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183637_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183638_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183639_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183641_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183643_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183644_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183645_Pol_P-F      LTKNELRKLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MW999662_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999664_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999665_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999673_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNAVNHYFKTRHYL
ON585699_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKARHYL
ON585701_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
X69798_Pol_P-F        LTKNELRRLKLVMPARFYPKVTKYFPMDKGIKPYYPEHAVNHYFKTRHYL
X75658_Pol_C-F        LTKNELRRLKLIMPARFFPKLTKYFPLEKDIKPYYPEHAVNHYFQTRHYL
X75663_Pol_P-F        LTKNELRRLKLVMPARFYPKHTKYFLLEKGIKPYYPDQAVNHYFQTRHYL
AB036909_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036912_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036914_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036916_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036917_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
AB036918_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
KX264498_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHSVNHYFKTRHYL
KJ843195_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843196_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843199_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843200_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MK058437_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843208_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843210_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
DQ823093_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
EU366118_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
FJ657529_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843176_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843198_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843201_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843203_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843206_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HE981182_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585187_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585188_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585189_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585191_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585198_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM590473_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
KJ843171_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM622135_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HQ378247_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM585190_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM585199_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMDKGIKPYYPDNVVNHYFKTRHYL
HM590471_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM590472_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
HM585193_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN688699_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
JN688703_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KX264496_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KJ843219_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843221_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843222_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KJ843224_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KY382411_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MK183647_Pol_P-F      LTKNELRRLKLVMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
KY458061_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
KY382417_Pol_P-F      LTKNELXXLKLVMPSXFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTXHYL
MG877705_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MG877707_Pol_P-F      LTKNELRRLKLIMPARFFPKLTKYFPLEKGIKPYYPEHAVNHYFKTRHYL
MH051987_Pol_P-F      LTKNELRRLKLVMPARFYPKVTKYFPMEKGIKPYYPEHAVNHYFKTRHYL
MW999666_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999667_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999669_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999670_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999671_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999672_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999674_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999675_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
MW999676_Pol_P-F      LTKNELRRLKLVMPSRFFPKVTKYFPMEKGIKPYYPDNVVNHYFKTRHYL
                      :*  *.  :** **  : *  ****   *.***:*    *****:: ** 

AY090459_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGTESLC
KC494400_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
LT935665_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AB064316_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
LT935662_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP995110_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYTWEQELQHGSTSLNDTKRHGTESLC
MG098564_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KC494399_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KP718107_Pol_P-F      HTLWKSGILYKRESTRSASFCGSPYSWEQKLQHGSTSIHDSKGHGTESLC
KP995118_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDSKGHGTESFC
KC494396_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KJ843226_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KY476327_Pol_P-F      HTLWKAGILYKRESTHSASFCGSPYSWEQEPQHGSTSINDSKGHGTESLC
KJ843174_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
LT935660_Pol_P-F      HTLWQAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843177_Pol_P-F      HTLWKAGILYERESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ586807_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN792922_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM590474_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHVTESLC
MW999663_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709462_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JX079936_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585200_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MK183631_Pol_P-F      HTLWKAGILYQRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
LT935661_Pol_P-F      RTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP718104_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGAESLC
KJ638656_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585194_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KF199901_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ899145_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKRHGTESLC
EU366132_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AB086397_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
EU366116_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KY476323_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ638657_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ638663_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476332_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476322_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP995116_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843197_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AF223963_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ657522_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KY476330_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQKLQHGSTSINDSKGHGTESLC
JN792921_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSXNDXKXHGTESLC
KP995109_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFR
DQ899147_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKRHGTESLC
KJ586808_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843191_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
OK106257_Pol_P-F      HTLWKAGILYKXXSTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AF223964_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY458062_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476324_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY382415_Pol_P-F      HTLWKAGILYKXXSTRXASFXGSPYSWEQELQHGSTSINDSKGHGTESLC
OL907123_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
LT935667_Pol_P-F      HTLWKAGILYKRESTRNATFCGSQYSWEQELQHGSTSINDSKGHGTESLC
KF779236_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP995114_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQKLQHGSTSLNDTKRQGTKSLC
MG098582_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNGKKGHGTESLC
DQ899150_Pol_P-F      HTLWKAGILYKRESTGSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
LT935666_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AY090458_Pol_C-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGTESLC
KY476325_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KM233681_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY382416_Pol_P-F      HTLWKAGILYKXXSTRXASFXGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843167_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476328_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MK183640_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
AY090461_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGTESLC
MG098579_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTXSLC
KJ843193_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843205_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AB116654_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKRHGTESLC
KP718110_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ638662_Pol_P-F      HTLWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNDKKRHGTESFC
KP995097_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
JN688709_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843178_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY476331_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM627320_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ899144_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQEVQHGSTSLNDKKRHGTESLC
MW999668_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP718113_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGTESLC
KT896494_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESXC
KC494404_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MG877700_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQKLQHGSTSINDSKGHGTESLC
LT935659_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP995105_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESFC
HM585195_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KX757665_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDTKGHGTESLC
AB036905_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036910_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036911_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036913_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036915_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036919_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036920_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB116549_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB116551_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB116552_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AB166850_Pol_P-F      HTLWKAGILYKRESSRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AB214516_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AB365446_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AB365449_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGYGTESLC
AB365450_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AB365453_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AF223962_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AF223965_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
AY090455_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYTWEQELQHGSTSLNDTKRHGTESLC
AY179735_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
AY311369_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYTWEQELQHGSTSLNDTKRHGTESLC
AY311370_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
DQ776247_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
DQ823086_Pol_P-F      HTLWKAGILYKRESTRSESFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
DQ823087_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
DQ823088_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
DQ823089_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
DQ823090_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
DQ823091_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ823092_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ823094_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ823095_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
DQ899142_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
DQ899143_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
DQ899146_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKRHGTESLC
DQ899148_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
DQ899149_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNHKKGHGTESFC
EF576808_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
EF576812_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
EU366133_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ589066_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
FJ589067_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
FJ657519_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
FJ657525_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ657528_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
FJ709457_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709458_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709459_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSIYDSKGHGTESLC
FJ709460_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709463_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709464_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709465_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ709494_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HE981181_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
HE981183_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585186_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585192_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585196_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585197_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN688691_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN688701_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
JN688720_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
JN792917_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN792918_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN792919_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN792920_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN811655_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
JN811656_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
JQ272888_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
JX079937_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KC494394_Pol_P-F      HTLWKAGILYKRDNTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494395_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494397_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494401_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494402_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494403_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KC494405_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KJ638659_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KJ638660_Pol_P-F      HTLWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNDKKRHGTESFC
KJ676694_Pol_P-F      HTLWKAGILYKRESTLSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843163_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843164_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843169_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843170_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843175_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESHC
KJ843179_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843180_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843181_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843185_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESHC
KJ843189_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843190_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843194_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843202_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843204_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843207_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843209_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
KJ843211_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843212_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843213_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843220_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843223_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843225_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KM998715_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP718103_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLHDKKGHGTESFC
KP718106_Pol_P-F      HTLWKXGILYKXESTRXASFCGSPYSWEQKLQHGSTSLNDKKGHGTESFC
KP718109_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP718111_Pol_P-F      HTLWKAGILYKRDSTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP718112_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995098_Pol_P-F      HTLWKAGILYKRESARSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KP995101_Pol_P-F      HTLWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995104_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KP995106_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQEIQHGSTSLNDKKGHGTESFC
KP995107_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KP995111_Pol_P-F      HTLWKAGVLYKRESTRSASFCGSPYSWEQKLQHGSTSLNDKKGHGTESFC
KP995113_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KP995115_Pol_P-F      HTLWKAGILYKRESTHSASFCGSPYSWEQELQHGSTSLNETKRHGTESLC
KP995117_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995119_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995120_Pol_P-F      HTLWKAGILYRRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KP995123_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995124_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995125_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KP995126_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KX264497_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
KX264499_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KY476326_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KY476329_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
LT935664_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
LT935668_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MG098565_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MG098566_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTXSLC
MG098569_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MG098570_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLG
MG098573_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDKKGHGTESLC
MG098574_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MG098575_Pol_P-F      HTLWEAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MG098578_Pol_P-F      HTLWEAGILYKRESTXSASFCGSPYSWEQELQHGSTTLNGKKGHGTESLC
MG098580_Pol_P-F      HTLWKAGILYKRESTPSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MG098583_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MG098584_Pol_P-F      HTLWKAGILYKXXSTRSASFCGSPYSWEZELQHGSTSINDEKGHGTESLC
MG877703_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MG877704_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDXKGHGTESLC
MG877706_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MG877708_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MG877715_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQDLQHGSTSLNDKKGHGTESLC
MG877716_Pol_P-F      HTLWKAGILYKRESTXSASFCGSPYSWEQDLQHGSTSLNDKKGHGTESLC
MG877717_Pol_P-F      HTLWKAGILYKRESTXSASFCGSPYSWEQDLQHGSTSLNDKKGHGTESLC
MG877721_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
MG877722_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
MH051986_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
MK183630_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
MK183632_Pol_P-F      HTLWKAGVLYKRESTRSASFCGSPYSWEQELQHGSTSLXDKKGHGTESLC
MK183633_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
MK183636_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MK183637_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MK183638_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
MK183639_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
MK183641_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MK183643_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
MK183644_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDEKGHGTESLC
MK183645_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MW999662_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999664_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999665_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999673_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
ON585699_Pol_P-F      HTLWKAGILYKRETTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
ON585701_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
X69798_Pol_P-F        HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDTKRHGTESLC
X75658_Pol_C-F        HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
X75663_Pol_P-F        HTLWKAGILYKRETTRSASFCGSQYSWEQELQHGSTSLNDKKGHGTESFC
AB036909_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036912_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036914_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036916_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036917_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
AB036918_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KX264498_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
KJ843195_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843196_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843199_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843200_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MK058437_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843208_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843210_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
DQ823093_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
EU366118_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
FJ657529_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843176_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843198_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843201_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843203_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843206_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HE981182_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585187_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585188_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585189_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585191_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585198_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM590473_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843171_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM622135_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HQ378247_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585190_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585199_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM590471_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM590472_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
HM585193_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN688699_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
JN688703_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KX264496_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KJ843219_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843221_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843222_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KJ843224_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KY382411_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MK183647_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
KY458061_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
KY382417_Pol_P-F      HTLWKAGILYKXXSTRXASFXGSPYSWEQELQHGSTSINDSKGHGTESLC
MG877705_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDXKGHGTESLC
MG877707_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESLC
MH051987_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSLNDKKGHGTESFC
MW999666_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999667_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999669_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999670_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999671_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999672_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999674_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999675_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
MW999676_Pol_P-F      HTLWKAGILYKRESTRSASFCGSPYSWEQELQHGSTSINDSKGHGTESLC
                      :***: *:**.  .:   :* ** *:** . *****:    *   : *  

AY090459_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KC494400_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
LT935665_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
AB064316_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
LT935662_Pol_P-F      SQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KP995110_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
MG098564_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
KC494399_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHQQGQLANGKQGR-SGRLRSRV
KP718107_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGEQGR-SGRIRSWV
KP995118_Pol_P-F      AQSSGLLARPSAGSVIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KC494396_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KJ843226_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGKLRSRV
KY476327_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843174_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
LT935660_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843177_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ586807_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JN792922_Pol_P-F      TQSSGILSRPSAGSSXQGKFQQSRLGLQQKQGQLANGKQGR-SGSIRSWV
HM590474_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999663_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
FJ709462_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JX079936_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585200_Pol_P-F      TQSSGILSRPSAGSSIQSKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MK183631_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGGLRSRV
LT935661_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KP718104_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ638656_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585194_Pol_P-F      TQSSGILSRPSAGSSIQSKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KF199901_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
DQ899145_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRIRSRV
EU366132_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
AB086397_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSRV
EU366116_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KY476323_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ638657_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ638663_Pol_P-F      TQSAGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGQQGR-SGRIRSWV
KY476332_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KY476322_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KP995116_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGK-SGRLRSWV
KJ843197_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
AF223963_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
FJ657522_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KY476330_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JN792921_Pol_P-F      XQSSGILSRPSAGSXXQXKFQQSRLGLQXKQGQLANGKQGR-SGXXRSXV
KP995109_Pol_P-F      AQSPGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
DQ899147_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRIRSRV
KJ586808_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843191_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
OK106257_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
AF223964_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KY458062_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
KY476324_Pol_P-F      TQSSGILSRPSTGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KY382415_Pol_P-F      TQSSGILSXPSAGSSIQGKFQQSRLGLQQXQGHLANGKQGR-SGRIRSWV
OL907123_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
LT935667_Pol_P-F      AQSSGILSRPSTGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KF779236_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGPLANSKQGR-SGRIRSWV
KP995114_Pol_P-F      AQSSGILSGPSAGSAIQSKFQQSRLGLQHEQGQLANGKQGR-SGRLRSRV
MG098582_Pol_P-F      AQSSGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
DQ899150_Pol_P-F      AQSSGLLSRPSGGSDIQSKFQQFRVGLQHKQGQLANGKQGR-SGRLRSRV
LT935666_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
AY090458_Pol_C-F      TQSSGILARPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWF
KY476325_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIWSRV
KM233681_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KY382416_Pol_P-F      TQSSGILSXPSAGSSIQGKFQQSRLGLQQXQGHLANGKQGR-SGRIRSWV
KJ843167_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KY476328_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIWSRV
MK183640_Pol_P-F      AQSTGILARTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
AY090461_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MG098579_Pol_P-F      AQSTGILSRPSAGSSFXSKFQQSRLGLQQKQGHLANGKQGR-SGKLRSRV
KJ843193_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843205_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
AB116654_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KP718110_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ638662_Pol_P-F      AQSSGILSRXSAGSSIQGKFQQSRLGLQQKQGQLANGKQGMDRGRLRSRV
KP995097_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
JN688709_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KJ843178_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KY476331_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM627320_Pol_P-F      TQSSGILSRPSAGSSIQSKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
DQ899144_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRIRSRV
MW999668_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KP718113_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KT896494_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KC494404_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MG877700_Pol_P-F      AQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
LT935659_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KP995105_Pol_P-F      AQSSGLLTRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
HM585195_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KX757665_Pol_P-F      TQSSGILSRPSAGSSIQGRFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
AB036905_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB036910_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
AB036911_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB036913_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB036915_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB036919_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB036920_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB116549_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
AB116551_Pol_P-F      AQSPGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
AB116552_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
AB166850_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGSIRSRV
AB214516_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGSIRSRV
AB365446_Pol_P-F      AQSAGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
AB365449_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
AB365450_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
AB365453_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
AF223962_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
AF223965_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
AY090455_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
AY179735_Pol_P-F      TQSSGILSRPSAGSSFQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
AY311369_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
AY311370_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
DQ776247_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
DQ823086_Pol_P-F      AQSTGILSRXSAGSSFQSKFQQSRLGPQQKQGHLANGKQGR-SGRLRSRV
DQ823087_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
DQ823088_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
DQ823089_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
DQ823090_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
DQ823091_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
DQ823092_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
DQ823094_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
DQ823095_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
DQ899142_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
DQ899143_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
DQ899146_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRIRSRV
DQ899148_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
DQ899149_Pol_P-F      AQSSGLLARPSAGSGIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
EF576808_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLWSRV
EF576812_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
EU366133_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
FJ589066_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
FJ589067_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGHLANGKQGR-SGRLRSRV
FJ657519_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
FJ657525_Pol_P-F      AQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
FJ657528_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
FJ709457_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
FJ709458_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
FJ709459_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
FJ709460_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
FJ709463_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
FJ709464_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
FJ709465_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
FJ709494_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HE981181_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
HE981183_Pol_P-F      TQSSGILSRPSVGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585186_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585192_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585196_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585197_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JN688691_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JN688701_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
JN688720_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
JN792917_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JN792918_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JN792919_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JN792920_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JN811655_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
JN811656_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
JQ272888_Pol_P-F      AQSAGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
JX079937_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KC494394_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KC494395_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KC494397_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KC494401_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KC494402_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KC494403_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KC494405_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KJ638659_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KJ638660_Pol_P-F      AQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRLRSRV
KJ676694_Pol_P-F      TQSSGILSRPSAGSSIQSKFQQSRLGLQQKQGQLANGKQGR-SGGLRSRV
KJ843163_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843164_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
KJ843169_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843170_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843175_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KJ843179_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843180_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
KJ843181_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
KJ843185_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KJ843189_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KJ843190_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843194_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
KJ843202_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843204_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843207_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KJ843209_Pol_P-F      AQSTGILARTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KJ843211_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
KJ843212_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
KJ843213_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KJ843220_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KJ843223_Pol_P-F      AQSTGILSRPSAGSAFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KJ843225_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQPRLGLQQKQGHLANGKQGR-SGRLRSRV
KM998715_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
KP718103_Pol_P-F      AQSSGLLARPSAGSAVQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP718106_Pol_P-F      AQSSGLPARPSAGSAIQSKFQQSRLGLQHKQGZLANGKQGR-SGRLRSRV
KP718109_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP718111_Pol_P-F      AQSSGLLARPSAGSFIQSKYQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP718112_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995098_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KP995101_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995104_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995106_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRARV
KP995107_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGSLRSRV
KP995111_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995113_Pol_P-F      AQPSGILSRPSAGSAIQNKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995115_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995117_Pol_P-F      AQSSGLLARPSVGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995119_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995120_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995123_Pol_P-F      AQSSGLLARPSAGSTIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995124_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGKLRSRV
KP995125_Pol_P-F      AQSSGLLARPSAGSTIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KP995126_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KX264497_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
KX264499_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KY476326_Pol_P-F      AQSSGIPSRPSAGSSFQSKFQQSRLGLQQQQGHLANGKQGR-SGRLRSRV
KY476329_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
LT935664_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
LT935668_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MG098565_Pol_P-F      AQSTGILSXTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG098566_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG098569_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG098570_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG098573_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG098574_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG098575_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG098578_Pol_P-F      AQSSGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG098580_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG098583_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG098584_Pol_P-F      TQSPGILSRPSAGSSIQSKFQQSRLGLQQKQGQLANGKQGR-SGGLRSRV
MG877703_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG877704_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG877706_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG877708_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGFQQKQGHLANGKQGR-SGRLRSRV
MG877715_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
MG877716_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
MG877717_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
MG877721_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG877722_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MH051986_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
MK183630_Pol_P-F      AQSTGILARTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MK183632_Pol_P-F      AQSXGILSRPSAGSSFQSKFQQSXLGLQQKQGHLANGKQGR-SGRLRSRV
MK183633_Pol_P-F      AQSTGILARTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MK183636_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANDKQSR-SGRLQSKV
MK183637_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MK183638_Pol_P-F      AQSTGILARTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MK183639_Pol_P-F      AQSTGILARTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MK183641_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
MK183643_Pol_P-F      AQSTGILARTSAGSSFQSKFQQSXLGLQQKQGHLANGKQGR-SGRLRSRV
MK183644_Pol_P-F      AQSTGILARTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MK183645_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGGLRSRV
MW999662_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
MW999664_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999665_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999673_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
ON585699_Pol_P-F      AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGSLRSRV
ON585701_Pol_P-F      TQSSGILSRPSAGSSIQSKFQQSRLGLQQKQGQLANGKQGR-SGRLRSRV
X69798_Pol_P-F        AQSSGILSRPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
X75658_Pol_C-F        AQSTGILSRPSTGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
X75663_Pol_P-F        AQSTGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
AB036909_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB036912_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB036914_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB036916_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB036917_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
AB036918_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
KX264498_Pol_P-F      AQSSGLPARPSAGSAIQGKFQQSRLGLQHKQGQLANGKQGR-SGRLRPRV
KJ843195_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843196_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843199_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843200_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MK058437_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843208_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
KJ843210_Pol_P-F      AQSTGILSRPSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
DQ823093_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
EU366118_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
FJ657529_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843176_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843198_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843201_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843203_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843206_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HE981182_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585187_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585188_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585189_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585191_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585198_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM590473_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843171_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM622135_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
HQ378247_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
HM585190_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585199_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM590471_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM590472_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
HM585193_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JN688699_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
JN688703_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KX264496_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
KJ843219_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
KJ843221_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
KJ843222_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
KJ843224_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
KY382411_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
MK183647_Pol_P-F      AQSAGILSRPSAGSSFQSKFQQSRLGLQQNQGHLANGKQGR-SGRLRSRV
KY458061_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQRQGQLANGKQGR-SGRIRSWV
KY382417_Pol_P-F      TQSSGILSXPSAGSSIQGKFQQSRLGLQQXQGHLANGKQGR-SGRIRSWV
MG877705_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MG877707_Pol_P-F      AQSTGILSRTSAGSSFQSKFQQSRLGLQQKQGHLANGKQGR-SGRLRSRV
MH051987_Pol_P-F      AQSSGLLARPSAGSAIQSKFQQSRLGLQHKQGQLANGKQGR-SGRLRSRV
MW999666_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999667_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999669_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999670_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999671_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999672_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999674_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999675_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
MW999676_Pol_P-F      TQSSGILSRPSAGSSIQGKFQQSRLGLQQKQGQLANGKQGR-SGRIRSWV
                       *. *: :  * **    ::**  :* *  ** ***.:*.   *   . .

AY090459_Pol_P-F      HTPTRWPAGVEPTGTGCAYNIASRSASCFHQSAVREKTNPSLSTSKRHSS
KC494400_Pol_P-F      HTPSRWPVGVESTGTGCAYNIASKSASCFHQSAVREKTNPSLSTSKRHSS
LT935665_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCSHQSAVREKTNPSLSTSKRHSS
AB064316_Pol_P-F      HTPTRWPVGVESTGTGCAYNSASRSASCFHQSAVREKTNPSLSTSKRHSS
LT935662_Pol_P-F      HTPTRWPVGVEPTGTGCAYNIASRSASCSHQSAVREKTNPSLSTSKRHSS
KP995110_Pol_P-F      HTPTRWPAGVEPSSTRCVNNLASRSASCFHQSAVREKANPSLSTSKRHTS
MG098564_Pol_P-F      HTPTRWPVGVEPSGTRCSNNLASRSASCFHQSAVREEA