HBVdb

Dataset for protein HBe of genotype F

[Download (right click)] [Edit] [Sequences] [Repertoires]

364 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


JQ272888_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB116550_HBe_P-F      SKLCLGWLWGMDIDPFKEFGASEELLSFLPLDFFPNVRDLLDTASALYRD
KC494399_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFYPSVRDLIDTASALYRD
MG098574_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995113_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPPDFFPSVRDLIDTASALYRD
KP995115_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995114_HBe_P-F      SKLCLGWLWDMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALHRD
KP995097_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSARDLFDTASALYRD
JN792919_HBe_P-F      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MG098583_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ586805_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494396_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN792918_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRD
JN792916_HBe_P-F      SKLCLGWLWDMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRD
FJ589067_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EU185743_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EU185742_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ899146_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLFDTASALYRD
DQ823087_HBe_P-F      SKLCLGCLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY254498_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY090459_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585194_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRD
HM622135_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRD
JN792914_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRD
KP995111_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPIDFFPSVRDLLDTATALYRD
HM627320_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB365446_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTASALYRD
KJ638660_HBe_P-F      SKLCLGWLXGMDIDPYKEFGASLELLSFLPXDFFPSXRDLIDTASALYRD
KJ586808_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494400_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494394_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX899376_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASAELLSFLPPDFFPSVRDLLDTASALYRD
AB036905_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036906_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036907_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036908_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036909_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036910_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036911_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036912_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036913_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036914_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036915_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036916_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036917_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036919_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB036920_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB116549_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB116551_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB116552_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AF223962_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AF223963_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AF223964_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AF223965_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY090455_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY090458_HBe_C-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY090461_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY179735_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY254507_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY311369_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY311370_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ776247_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ823086_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ823088_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ823089_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ823090_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ823091_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ823092_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ823093_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ823094_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ823095_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ899142_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ899143_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ899144_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ899145_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ899147_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ899148_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ899149_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
DQ899150_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EF576812_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EU185744_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EU366116_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EU366118_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EU366133_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EU620070_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EU670261_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ589065_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ657519_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ657522_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ657528_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ657529_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ709457_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ709458_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ709459_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ709460_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ709462_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ709463_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ709464_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ709465_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
FJ709494_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HE981181_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HE981182_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HE981186_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214722_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214724_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214725_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214729_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214738_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214739_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214740_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214741_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214742_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASXLYRD
HM214744_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214745_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214746_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM214747_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585186_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585187_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585188_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585189_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585190_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585191_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585192_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585193_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585195_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585196_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585197_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585198_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585199_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM585200_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM590471_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM590472_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM590473_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM590474_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HQ378247_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN688703_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN688699_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN688691_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JF439885_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JF439884_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HQ420166_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HQ420165_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ586807_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ586806_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KF779236_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KF199901_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999458_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999456_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999455_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999453_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999450_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999446_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999440_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999439_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999436_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999435_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999432_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999431_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999429_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999426_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999423_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999419_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC999418_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885545_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885532_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885508_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885471_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885468_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885459_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885458_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885448_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885446_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885444_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885433_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885414_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885374_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885372_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885362_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885358_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885341_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885321_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885214_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC885193_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494405_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494404_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494403_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494402_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494401_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494398_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494397_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC494395_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX079937_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX079936_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN811656_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN811655_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN811654_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JN792921_HBe_P-F      SKLCLGWLXGMDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALYRD
JN792922_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HQ420164_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995101_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRD
KJ843195_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASLELLSFLPSDFFPSVRDLLDTASALYRD
KT896494_HBe_P-F      SKLCLGWLXGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRD
KP995095_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995105_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRQ
JN792920_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MG098578_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALYRD
X75658_HBe_C-F        SKLCLGWLWGMDIDPYKEFGASVELFSFLPSDFFPSIRDLLDTASALYRD
MK183644_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183638_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183637_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183633_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995119_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRD
KP995117_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRD
KP995109_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP243583_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843174_HBe_P-F      SKLCLGGLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843168_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRD
KJ843167_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810874_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTASALYRE
KJ810871_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ638659_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843191_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810881_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ647337_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810848_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995096_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
X75663_HBe_P-F        SKLCLGWLWGMDIDPYKEFGASVELFSFLASDFFPSVRDLLDTASALYRD
X69798_HBe_P-F        SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
OK106257_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558390_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558388_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558386_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558383_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558381_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558380_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558378_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558376_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558375_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558373_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558372_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558371_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558369_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558368_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558367_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK558366_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183647_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183643_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183641_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183640_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183639_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183636_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183635_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK183630_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MK058437_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MH051987_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MH051986_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
MG098564_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLXTASALYRD
KY476332_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KY476331_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KY476322_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KY458062_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KY458061_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KY382411_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KX757665_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KX264499_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KX264498_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KX264497_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KX264496_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KU212170_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KU212162_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KU212161_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KU212160_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995126_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995125_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995124_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995123_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995120_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995118_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995116_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995110_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995106_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995104_HBe_P-F      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995098_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995094_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP995091_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP718113_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP718112_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP718111_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP718109_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP718104_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP718103_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP243579_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP243493_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP243458_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP243315_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP243309_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KP243291_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KM998715_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KM233681_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843226_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843225_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843224_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843223_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843222_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843221_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843220_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843219_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843213_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843212_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843211_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843210_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843209_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843208_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843207_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843206_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843205_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843204_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843203_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843201_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843200_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843199_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843198_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASPLYRD
KJ843197_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843196_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843194_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843193_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843190_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843189_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843185_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843181_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843180_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843179_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843178_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843177_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843176_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843175_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843171_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843170_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843169_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843164_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ843163_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810906_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810890_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810888_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810886_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810884_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810882_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810880_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810879_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810876_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810875_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810872_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810868_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810867_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810864_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810850_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810840_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ810838_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ647336_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ647335_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KY382417_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KY382416_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KJ638657_HBe_P-F      SKLCLGWLWXMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KY382415_HBe_P-F      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
                      ****** *  *****:****** **:***. **:*. ***: **: *:*:

JQ272888_HBe_P-F      ALESPEHCTPHHTAIRQAILCWGELMVFASWVGNNLQDAAARDLVVDYVN
AB116550_HBe_P-F      ALESSEHCTPHHTALRQAILCWGELMIFAAWVGNNLEDPAARDLVVNYVN
KC494399_HBe_P-F      ALESPEHCSPHHTALRQAVGCWGEVSTLASWVGNNLEDPAARDLVVNYVN
MG098574_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMILASWGGNILENPAAGDLLVNSVN
KP995113_HBe_P-F      ALESPEHCTPNHTAIRQVLLCWNELMTFASWVGENLDDPAARNSVVNYVN
KP995115_HBe_P-F      ALESPEHCSPHHTALRQAILCWDELMIFASWVGNNLDDPASRDLVVNYVN
KP995114_HBe_P-F      ALESPEHCSPHHTAIRQAVSCWGELITLASWVGNNLDDPAARDLVVNYVN
KP995097_HBe_P-F      ALESPEHCTPHHTALRQAILCWGELTTLASWVGNNLDDAAARDLVVNYVN
JN792919_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMIFASWVGNNLEDPAARDLVVNYVN
MG098583_HBe_P-F      SLESPEHCSPHHTALRQAISCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ586805_HBe_P-F      ALESPEHCTPNHTAFRQAILCWGELMTLASWGGNNLEDPAARDLVVNYVN
KC494396_HBe_P-F      ALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLDDPGARDLVVNYVN
JN792918_HBe_P-F      ALESPEHCTHHHTALRQAILCWGELMTLASWVGNNLDDPAARDLVVNYVN
JN792916_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ589067_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
EU185743_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASLVGNNLEDPAARDLVVNYVN
EU185742_HBe_P-F      ALESPXHCTPNHTALRQAILCWGELMTLASWVGNNLEBPAARDLVVNYVN
DQ899146_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ823087_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY254498_HBe_P-F      ALESPEHCSPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY090459_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPADRDLVVNYVN
HM585194_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM622135_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JN792914_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995111_HBe_P-F      ALESPEHCTPHHTALRQTVLCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM627320_HBe_P-F      ALESPEHCTPHHTALRQXILCWGELMTLASWVGNNLDDPAARDLVVNYVN
AB365446_HBe_P-F      ALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ638660_HBe_P-F      ALESPEHCTPNHTALRQAIVCWGEVMTLAAWVGHNLEDPAARDLVVNYVN
KJ586808_HBe_P-F      ALKSPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC494400_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVKYVN
KC494394_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX899376_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036905_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036906_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036907_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036908_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036909_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036910_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036911_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036912_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036913_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036914_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036915_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036916_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036917_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036919_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB036920_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB116549_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB116551_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB116552_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AF223962_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AF223963_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AF223964_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AF223965_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY090455_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY090458_HBe_C-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY090461_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY179735_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY254507_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY311369_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY311370_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ776247_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ823086_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ823088_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ823089_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ823090_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ823091_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ823092_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ823093_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ823094_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ823095_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ899142_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ899143_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ899144_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ899145_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ899147_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ899148_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ899149_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
DQ899150_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
EF576812_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
EU185744_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
EU366116_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
EU366118_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
EU366133_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
EU620070_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
EU670261_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ589065_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ657519_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ657522_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ657528_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ657529_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ709457_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ709458_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ709459_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ709460_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ709462_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ709463_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ709464_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ709465_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ709494_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HE981181_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HE981182_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HE981186_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214722_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214724_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214725_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214729_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214738_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214739_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214740_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214741_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214742_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214744_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214745_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214746_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM214747_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585186_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585187_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585188_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585189_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585190_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585191_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585192_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585193_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585195_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585196_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585197_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585198_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585199_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM585200_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM590471_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM590472_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM590473_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM590474_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HQ378247_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JN688703_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JN688699_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JN688691_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JF439885_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JF439884_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HQ420166_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HQ420165_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ586807_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ586806_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KF779236_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KF199901_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999458_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999456_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999455_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999453_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999450_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999446_HBe_P-F      ALESPEHCTPNQTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999440_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999439_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999436_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999435_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999432_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999431_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999429_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999426_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999423_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999419_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC999418_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885545_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885532_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885508_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885471_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885468_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885459_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885458_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885448_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885446_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885444_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885433_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885414_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885374_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885372_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885362_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885358_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885341_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885321_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885214_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC885193_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC494405_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC494404_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC494403_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC494402_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC494401_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC494398_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC494397_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC494395_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX079937_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX079936_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JN811656_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JN811655_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JN811654_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JN792921_HBe_P-F      ALESPEHCTPNHTALRQAXLCWGELMTLASWVGNNLEDPXARDLVVNYVN
JN792922_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HQ420164_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995101_HBe_P-F      ALESPEHCSPHHTAIRQIILCWGELMSLASWVGNNLEDPAARDLVVNYVN
KJ843195_HBe_P-F      ALESPEHCTPNHTALRQAILCWSEVMTLASWVGNNLEDPAARDLVVNYVN
KT896494_HBe_P-F      ALESPEHCTPHHTALRQAILCWVELMTLASWVGNNLEDPAARDLVVNYVN
KP995095_HBe_P-F      ALESPEHCTPNHTALRQAIVCWGEVMTLASWVGNHLEDPAARDLVVNYVN
KP995105_HBe_P-F      ALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JN792920_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPGARDLVVNYVN
MG098578_HBe_P-F      ALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
X75658_HBe_C-F        ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183644_HBe_P-F      ALKSPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183638_HBe_P-F      ALKSPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183637_HBe_P-F      ALESPEHCTPHHTAVRQAILCWGELMTLAAWVGNNLEDPAARDLVVNYVN
MK183633_HBe_P-F      ALKSPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995119_HBe_P-F      ALESPEHCTPHHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995117_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995109_HBe_P-F      ALESPEHCTPNHTALRQAIVCWGEVMTLASWVGHNLEDPAARDLVVNYVN
KP243583_HBe_P-F      ALESQEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843174_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843168_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843167_HBe_P-F      ALESPEHCTPNHTALRQAILGWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810874_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810871_HBe_P-F      ALESPEHCTPNHTALRQAILGWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ638659_HBe_P-F      ALESPEHCTPNHTALRQAILCWTEVMTLASWVGNNLEDPAARDLVVNYVN
KJ843191_HBe_P-F      ALXSPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810881_HBe_P-F      ALXSPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ647337_HBe_P-F      ALXSPEHCTPNHTALRQAILCWGELMTLASWVGNNLXDPAARDLXVNYVN
KJ810848_HBe_P-F      ALXSPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995096_HBe_P-F      ALESPEHCTPNHTAFRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
X75663_HBe_P-F        ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
X69798_HBe_P-F        ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
OK106257_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLAVNYVN
MK558390_HBe_P-F      ALESPEHCTPNHTALRQAILCWGDLMTLASWVGNNLEDPAARDLVVNYVN
MK558388_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK558386_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK558383_HBe_P-F      ALESPEHCTPNHTALRQAILCWGDLMTLASWVGNNLEDPAARDLVVNYVN
MK558381_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK558380_HBe_P-F      ALESPEHCTPNHTALRQAILCWGDLMTLASWVGNNLEDPAARDLVVNYVN
MK558378_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK558376_HBe_P-F      ALESPEHCTPNHTALRQAILCWGDLMTLASWVGNNLEDPAARDLVVNYVN
MK558375_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK558373_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK558372_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK558371_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK558369_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK558368_HBe_P-F      ALESPEHCTPNHTALRQAILCWGDLMTLASWVGNNLEDPAARDLVVNYVN
MK558367_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK558366_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183647_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183643_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183641_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183640_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183639_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183636_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183635_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK183630_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MK058437_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MH051987_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MH051986_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
MG098564_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY476332_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY476331_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY476322_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY458062_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY458061_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY382411_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KX757665_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KX264499_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KX264498_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KX264497_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KX264496_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KU212170_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KU212162_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KU212161_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KU212160_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995126_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995125_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995124_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995123_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995120_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995118_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995116_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995110_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995106_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995104_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995098_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995094_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP995091_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP718113_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP718112_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP718111_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP718109_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP718104_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP718103_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP243579_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP243493_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP243458_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP243315_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP243309_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KP243291_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KM998715_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KM233681_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843226_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843225_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843224_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843223_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843222_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843221_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843220_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843219_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843213_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843212_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843211_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843210_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843209_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843208_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843207_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843206_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843205_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843204_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843203_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843201_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843200_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843199_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843198_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843197_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843196_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843194_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843193_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843190_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843189_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843185_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843181_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843180_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843179_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843178_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843177_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843176_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843175_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843171_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843170_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843169_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843164_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ843163_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810906_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810890_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810888_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810886_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810884_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810882_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810880_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810879_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810876_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810875_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810872_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810868_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810867_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810864_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810850_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810840_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ810838_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ647336_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KJ647335_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY382417_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLXVNYVN
KY382416_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLXVNYVN
KJ638657_HBe_P-F      ALESPEHCTPXHTALRQAILCWGELMTXASWVGNNLEDPXARBLVVBYVN
KY382415_HBe_P-F      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLXVNYVN
                      :* *  **:  :**.**    * ::   *:  *  *  .      *  **

JQ272888_HBe_P-F      THMGLKIRHLLWFHLSCLMFGRDTVLEYLVSFGVW
AB116550_HBe_P-F      TNMGLKIRRLLWFHISCLTFGRQVVLEYLVSFGVW
KC494399_HBe_P-F      TNMGLKLRQLLWFHISCLTFGRETVVEYLVSFGVW
MG098574_HBe_P-F      THVGLKMKQLLWFHISCLIFERKTVLEYLEYFGVW
KP995113_HBe_P-F      TNMGLKIRQLLWFHISCLTFGTQTVVEYLVSFGVW
KP995115_HBe_P-F      INMGLKIRRLLWFHISCIMFGRDLVLEYLVSFGVW
KP995114_HBe_P-F      THMGLKIRQLLWFHISCLTFGRQVVLEYLVSFGVW
KP995097_HBe_P-F      THMGLKIRQLLWFHISCLTFGRETVVQYLVSFGVW
JN792919_HBe_P-F      INMGLKIRRLLWFHISCLTFGRETVLEYLVSFGVW
MG098583_HBe_P-F      THMGVKMRQYLWFHVSCLMFGRDTVLEYLVSFGVW
KJ586805_HBe_P-F      TNMGLKIRQLLGFHISSLTFGRETVLEYLVFFGVW
KC494396_HBe_P-F      TNMGLKVRQLLWFHISCLTFGRETVLEYLVSFGVW
JN792918_HBe_P-F      THMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JN792916_HBe_P-F      TNMGLKIRQLLWFHLSCITFGRETVLEYLVSFGVW
FJ589067_HBe_P-F      THMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
EU185743_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
EU185742_HBe_P-F      TNMGLKIXQLLWFHISCLTFGXKTVLEYLVSFGVW
DQ899146_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ823087_HBe_P-F      THMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY254498_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY090459_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585194_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM622135_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JN792914_HBe_P-F      THMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995111_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM627320_HBe_P-F      TXMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVW
AB365446_HBe_P-F      THMGLKIRQLLWFHISCLXFGRETVLEYLVSFGVW
KJ638660_HBe_P-F      TNMGLKIRQLLWFHISCLTFGREVVLEXLVSFGVW
KJ586808_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC494400_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC494394_HBe_P-F      TNMGLKIRQLLWFHISSLTFGRETVLEYLVSFGVW
JX899376_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036905_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036906_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036907_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036908_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036909_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036910_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036911_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036912_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036913_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036914_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036915_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036916_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036917_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036919_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB036920_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB116549_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB116551_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB116552_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AF223962_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AF223963_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AF223964_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AF223965_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY090455_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY090458_HBe_C-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY090461_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY179735_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY254507_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY311369_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY311370_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ776247_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ823086_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ823088_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ823089_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ823090_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ823091_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ823092_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ823093_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ823094_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ823095_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ899142_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ899143_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ899144_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ899145_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ899147_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ899148_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ899149_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
DQ899150_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
EF576812_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
EU185744_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
EU366116_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
EU366118_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
EU366133_HBe_P-F      THMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
EU620070_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
EU670261_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ589065_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ657519_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ657522_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ657528_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ657529_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ709457_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ709458_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ709459_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ709460_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ709462_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ709463_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ709464_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ709465_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ709494_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HE981181_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HE981182_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HE981186_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214722_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214724_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214725_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214729_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214738_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214739_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214740_HBe_P-F      THMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214741_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214742_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214744_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214745_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214746_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM214747_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585186_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585187_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585188_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585189_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585190_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585191_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585192_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585193_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585195_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585196_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585197_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585198_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585199_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM585200_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM590471_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM590472_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM590473_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM590474_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HQ378247_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JN688703_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JN688699_HBe_P-F      TNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVW
JN688691_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JF439885_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JF439884_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HQ420166_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HQ420165_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ586807_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ586806_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KF779236_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KF199901_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999458_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999456_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999455_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999453_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999450_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999446_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999440_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999439_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999436_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999435_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999432_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999431_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999429_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999426_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999423_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999419_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC999418_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885545_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885532_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885508_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885471_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885468_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885459_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885458_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885448_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885446_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885444_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885433_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885414_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885374_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885372_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885362_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885358_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885341_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885321_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885214_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC885193_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC494405_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC494404_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC494403_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC494402_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC494401_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC494398_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC494397_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC494395_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JX079937_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JX079936_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JN811656_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JN811655_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JN811654_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JN792921_HBe_P-F      TNMGLKIRQLLWFHISCLTFGREXVLEYLVSFGVW
JN792922_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HQ420164_HBe_P-F      TNMGXKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995101_HBe_P-F      NNMGLKIRQMLWFHISCLTFGRETVLEYLVSFGVW
KJ843195_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KT896494_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995095_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995105_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
JN792920_HBe_P-F      XNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MG098578_HBe_P-F      THMGLKIRQLLWFHISCLTFGRPTVLEYLVSFGVW
X75658_HBe_C-F        TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK183644_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK183638_HBe_P-F      TNMGLKIKQLLWFHISCLTFGRETVLEYLVSFGVW
MK183637_HBe_P-F      THMGLKMRQILWFHISCLTFGRETVLEYLVSFGVW
MK183633_HBe_P-F      TNMGLKIKQLLWFHISCLTFGKETVLEYLVSFGVW
KP995119_HBe_P-F      NNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995117_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995109_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP243583_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843174_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843168_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843167_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSLGVW
KJ810874_HBe_P-F      TNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810871_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSLGVW
KJ638659_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843191_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810881_HBe_P-F      TNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVW
KJ647337_HBe_P-F      TNMGLKIXQLLWFHISCLTFGXXTVLEYLVSFGVW
KJ810848_HBe_P-F      TNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVW
KP995096_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
X75663_HBe_P-F        TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
X69798_HBe_P-F        TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
OK106257_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558390_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558388_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558386_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558383_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558381_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558380_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558378_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558376_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558375_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558373_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558372_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558371_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558369_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558368_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558367_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK558366_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK183647_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK183643_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK183641_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK183640_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK183639_HBe_P-F      TNMGLKIRQLLWFHISCLTFGKETVLEYLVSFGVW
MK183636_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK183635_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK183630_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MK058437_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MH051987_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MH051986_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
MG098564_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KY476332_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KY476331_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KY476322_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KY458062_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KY458061_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KY382411_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KX757665_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KX264499_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KX264498_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KX264497_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KX264496_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KU212170_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KU212162_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KU212161_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KU212160_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995126_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995125_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995124_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995123_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995120_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995118_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995116_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995110_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995106_HBe_P-F      TNMGLKIRQMLWFHISCLTFGRETVLEYLVSFGVW
KP995104_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995098_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995094_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP995091_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP718113_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP718112_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP718111_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP718109_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP718104_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP718103_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP243579_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP243493_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP243458_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP243315_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP243309_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KP243291_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KM998715_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KM233681_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843226_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843225_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843224_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843223_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843222_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843221_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843220_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843219_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843213_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843212_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843211_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843210_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843209_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843208_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843207_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843206_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843205_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843204_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843203_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843201_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843200_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843199_HBe_P-F      TNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843198_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843197_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843196_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843194_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843193_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843190_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843189_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843185_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843181_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843180_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843179_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843178_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843177_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843176_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843175_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843171_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843170_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843169_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843164_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ843163_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810906_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810890_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810888_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810886_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810884_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810882_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810880_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810879_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810876_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810875_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810872_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810868_HBe_P-F      TNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810867_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810864_HBe_P-F      TNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810850_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810840_HBe_P-F      TNMGLKIXQLLWFHISCLTFGRETVLEYLVSFGVW
KJ810838_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ647336_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ647335_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KY382417_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KY382416_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KJ638657_HBe_P-F      XNMGLKIRXLLWFHISCLTFGRETVLEYLVSFGVW
KY382415_HBe_P-F      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
                        :* *:   * **:*.: *    *:: *  :***

© 1998-2022Legal notice