HBVdb

Dataset for protein HBe of genotype F

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****** *  *****:****** **:***. **:*. ***: **: *:*::* *  **:  :**.**    * ::   *:
SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPNHTALRQAILCWGELMTLAS
         d            a                             x     s h   i        dv if  
                                                    k                           

        90       100       110       120       130     
....:....|....:....|....:....|....:....|....:....|....:
  *  *  .      *  **  :* *:   * **:*.: *    *:: *  :***
WVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
            x      h     x              d            
                                                       
© 1998-2022Legal notice