HBVdb

Dataset for protein HBe of genotype F

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
     ***:    * *.** ***** *  **** :****** **:***. **:*. ***: **:.*:*::* *.***:  
MQLFHLCLIIFCSCPTVQASKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTPN
          s                xd            a       x     a   i                 s h
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***:**    * *:   *:  *  *: .         **  :*:*:   * **:*.: *    *:: *  :**** **  
HTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVWIRTPPA
   i   v     v if        d       x      h      r         m   dv             lp
                                                             q                  

       170       180       190       200       210  
....:....|....:....|....:....|....:....|....:....|..
*   ** *** *** :::*   *:   ***:     ** ** . *:** . *
YRPPNAPILSTLPETTVVRRRGRSPRRRTPSPRRRRSQSPRRRRSQSPASQC
   q           a i     t                  k     s r 
                                                    
© 1998-2020Legal notice