HBVdb

Dataset for protein HBSP of genotype E

[Download (right click)] [Edit] [Sequences] [Repertoires]

452 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


GQ161822_HBSP_P-E      ---SYQQLRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161825_HBSP_P-E      MPLSYQHFRRLLLLD-QAGPIEEELPHLADEDLNRRVAEDLNLQLPNDHQ
GU563552_HBSP_P-E      MPLSYQHLQRILLLDEEAGPLKEELPRLADEDLNRRVAEDLNFQLPNDHQ
FN594758_HBSP_P-E      MPLSCQRFRRILLLDEEAGPLEEELPHLADADLNRRVAEDLNLQLPNDHQ
FN594759_HBSP_P-E      MPLSCQRFRRILLLDEEAGPLEEELPHLADADLNRRVAEDLNLQLPNDHQ
FN594760_HBSP_P-E      MPLSCQRFRRILLLDEEAGPLEEELPHLADADLNRRVAEDLNLQLPNDHQ
FN594761_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849720_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF170741_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNPNPPPDHQ
AB915180_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAKDLNLEVPNDHQ
AB106564_HBSP_C-E      MPLSYQHFRRILLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274985_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADADLNRRVAEDLNLQLPTDHQ
HM363607_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADADLNRRVAEDLNLHLPTDHQ
EU239219_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNDHQ
EU239223_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNDHQ
DQ060830_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADDDLNRRVAEDLNLQLPNDHQ
HQ700550_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADDDLNRRVAEDLNLQLPNDHQ
HQ700552_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADDDLNRRVAEDLNLQLPNDHQ
AB274984_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPDDHQ
HM363582_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736891_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736892_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736893_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADXDLNRRVAEDLNLQLPNDHQ
HM363605_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQVPNDPQ
HM363576_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQVPNDHQ
FN594753_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQVPNDHQ
HM363575_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQVPNDHQ
MH580638_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MF772359_HBSP_P-E      MPLSYQHFRRILLLDNEAGPLEEELPRLADEDLNRRVAEDLNLQLPTDHQ
KT192626_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPHDHQ
HM363602_HBSP_P-E      MPLSYQHFRRLLLLDEDAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363569_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363574_HBSP_P-E      MPLSYPHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363565_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPIDHQ
GQ161826_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161799_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNFQLPNDHQ
GQ161818_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNFQLPNDHQ
GQ161821_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNFQLPNDHQ
MT427110_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNFQLPNDHQ
MT427144_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNFQLPNDHQ
MT427145_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNFQLPNDHQ
MT427150_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNFQLPNDHQ
GQ161785_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDPQ
GQ161836_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDPQ
MF772362_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDPR
GQ161776_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161784_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161789_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161828_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161763_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161777_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161759_HBSP_P-E      MPLSYQHFLRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN594765_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPDDHQ
FN594749_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FJ349239_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN967526_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FJ349226_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736894_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494712_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849714_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849715_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494711_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494705_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494699_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB915177_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274970_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPHLADEDLNRRVAEDLNLQLPNDHQ
AB205190_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDQQ
AB091256_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494695_HBSP_P-E      MPLSYQHFRRLLLLDTEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDQQ
HM363600_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRHVAEDLNLQLPDDHQ
MF772361_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAKDLNLQLPNDPQ
HM363603_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPTDHQ
HM363597_HBSP_P-E      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161757_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MF772358_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
LT623847_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363578_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPTDHQ
MN507840_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADVDLNRRVAEDLNLQLPDDHQ
AB219534_HBSP_P-E      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEDLNRRVAEDLNLQLPDDHQ
MF772356_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLHLPNDPQ
LT623851_HBSP_P-E      MPLSYQHFRRLLLLDXEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580633_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
LT623843_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161775_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPDDHQ
MH580645_HBSP_P-E      MPLSYQHFRRLLLLDQEAGPLEEELPRLADEDLNRRVAEDLNLQLPDDHQ
KU736913_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPXDHQ
MF772357_HBSP_P-E      MPLSYPHFRKLLLLDEESGPLEEELPRLADEDLNRRVAEDLNLQLPDDHQ
AB201289_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB915175_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161768_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161796_HBSP_P-E      MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KM606739_HBSP_P-E      MPLSYQHFRRILLLDEEAGPIEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KM606738_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF922439_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPHDHQ
KF849728_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEGLNRRVAEDLNLQLPTDHQ
KF849724_HBSP_P-E      MPLSYQHFRRLLLLDEGAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849723_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849716_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
JQ000009_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161831_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161762_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN594766_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPHLADEDLNRRVAEDLNLQLPNDHQ
FN594748_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNDHQ
AY738144_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPLLADEDLNRRVAEDLNLQLPNDHQ
AY738145_HBSP_C-E      MPLSYQHFRRILLLDEEAGPLEEELPLLADEDLNRRVAEDLNLQLPNDHQ
AY738146_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPLLADEDLNRRVAEDLNLQLPNDHQ
AY738147_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPLLADEDLNRRVAEDLNLQLPNDHQ
AB274977_HBSP_P-E      MPLSYQHFRRLLFLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB219529_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB194947_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDHQ
HM363606_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNLRVAEDLNLQLPNDHQ
GQ161834_HBSP_P-E      MPLSYQLFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161833_HBSP_P-E      MPLSYQQLRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274979_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB205188_HBSP_P-E      MPLSYQHFPRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
EU239222_HBSP_P-E      MPLSYQHFLRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MF772355_HBSP_P-E      MPLSYQHFLKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB194948_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274976_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274978_HBSP_P-E      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274982_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLHNDHQ
AM494692_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494714_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLHLPNDHQ
EU239220_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHR
FJ349240_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN545822_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB091255_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB201287_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB201288_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB201290_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB205129_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB205189_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEGLPRLADEDLNRRVAEDLNLQLPNDHQ
AB205191_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB205192_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274969_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274971_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274972_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274973_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274974_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274975_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274980_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AB274981_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLHNDHQ
AB915176_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494689_HBSP_P-E      MPLSYLHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494690_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494693_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494694_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494696_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494697_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494698_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494700_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494701_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494702_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494704_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494706_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494707_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494708_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494709_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494710_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494713_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494715_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AM494717_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AY739674_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AY739675_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
AY935700_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
DQ060822_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
DQ060823_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
DQ060824_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
DQ060825_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
DQ060826_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
DQ060827_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
DQ060828_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
DQ060829_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
EU239217_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
EU239218_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
EU239221_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHR
EU239226_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FJ349237_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FJ349238_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN545821_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427198_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427170_HBSP_P-E      MPLSYQHFRRILLLDEEAAPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427157_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427156_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427152_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427142_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427126_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427114_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427113_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLNNDHQ
MN507842_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEDELPRLADEDLNRRVAEDLNLQLPNDHQ
LT623848_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVADDLNLQLPNDHQ
HM363590_HBSP_P-E      MPLSYQHFLRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363589_HBSP_P-E      MPLSYQHFLRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363588_HBSP_P-E      MPLSYQHFLRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161786_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEGLNRRVAEDLNLQLPNDHQ
MH580648_HBSP_P-E      MPLSYQHFLRLLLLDEEAGPLEEELPRLADEDLNRRVADDLNLHLPNDHQ
KX186584_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736912_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736911_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736910_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736909_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736908_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736907_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736906_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736905_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736904_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEELNRRVAEDLNLQLPNDHQ
KU736903_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736902_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736901_HBSP_P-E      MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736900_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736899_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736898_HBSP_P-E      MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736897_HBSP_P-E      MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736896_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KU736895_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KT749841_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF922438_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849727_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849726_HBSP_P-E      MPLSYHHFRSVLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849725_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849722_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849721_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849719_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849718_HBSP_P-E      MPLSYQHFRSVLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849717_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF849713_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
KF170742_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLHNDHQ
JQ000008_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HQ700551_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363611_HBSP_P-E      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLHLPNDHQ
HM363610_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363609_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363604_HBSP_P-E      MPLSYPHFRRMLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363601_HBSP_P-E      MPLSYQHFLRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363599_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363598_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363596_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363595_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363594_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363593_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363591_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363587_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363586_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363585_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363584_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363583_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363581_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363580_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363579_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363577_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363573_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363572_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363571_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363570_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363568_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363567_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
HM363566_HBSP_P-E      MPLSYPHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161835_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161832_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161830_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161829_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161827_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161824_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAENLNLQLPNDHQ
GQ161823_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161820_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161819_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161817_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161816_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161815_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161814_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLANEDLNRRVAEDLNLQLPNDHQ
GQ161812_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161811_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161810_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161808_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161807_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161805_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161804_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161803_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRHVAEDLNLQLPNDHQ
GQ161802_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161801_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161800_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161797_HBSP_P-E      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161795_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161794_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161793_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161792_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161791_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161790_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161787_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161783_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAENLNLQLPNDHQ
GQ161782_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161781_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161780_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEDLPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161779_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161778_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161774_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161773_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161772_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161771_HBSP_P-E      MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161770_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161769_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161766_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161765_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161764_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161761_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161760_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161758_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161756_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
GQ161755_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN594763_HBSP_P-E      MPLSYQHFRSILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN594762_HBSP_P-E      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN594756_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN594752_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN594751_HBSP_P-E      MPLSYQHFRSILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN594750_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN545842_HBSP_P-E      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN545841_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
FN545827_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
X75657_HBSP_P-E        MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MW082636_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427201_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427200_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427199_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427197_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427196_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427195_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427194_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427193_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427192_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427191_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427190_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427189_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427188_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427187_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427186_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427185_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427184_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427183_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427182_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427181_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427180_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427179_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427178_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427177_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427176_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427175_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNEHQ
MT427174_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427173_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427172_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427171_HBSP_P-E      MPLTYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427169_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427168_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427167_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427166_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427165_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427164_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427163_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427162_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427161_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427160_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427159_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427158_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427155_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427154_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427153_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427151_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427149_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427148_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427147_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427146_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427143_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427141_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427140_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427139_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427138_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRIADEDLNRRVAEDLNLQLPNDHQ
MT427137_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427136_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427135_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427134_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427133_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427132_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427131_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427130_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427129_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427128_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427127_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427125_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427124_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427123_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427122_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427121_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427120_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427119_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427118_HBSP_P-E      MPLSYQHFRRILLLDAEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427117_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427116_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427115_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427112_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MT427111_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN967529_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN967528_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN967527_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN507848_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN507847_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN507846_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN507845_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN507844_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN507843_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MN507841_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MK720632_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MK720631_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MK321264_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH918655_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580652_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580651_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580650_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580649_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580647_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580646_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580644_HBSP_P-E      MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580641_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580640_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580637_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580636_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580635_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580634_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580632_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580631_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580630_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580629_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580628_HBSP_P-E      MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580625_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580624_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580623_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580622_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580621_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580620_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580619_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580618_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580617_HBSP_P-E      MPLSYQHFRRILLLDDEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580616_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580615_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MH580614_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MF772360_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
MF772354_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
LT623850_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
LT623846_HBSP_P-E      MPLSYQHFRRILLLDEEAGHLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
LT623845_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
LT623844_HBSP_P-E      MPLSYQHFRRILLLDEEAGPLEEELPRLADEDLBRRVAEDLNLQLPNDHQ
LT623842_HBSP_P-E      MPLSYQXFRRXLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
LT623849_HBSP_P-E      MPLSYQHFRRXLLLDEEAGPLEEELPXLXDEDLNRRVXEDLNLXLPNDHQ
FN545823_HBSP_P-E      MPLSYQHFRRXLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQ
                          :   :   *:**  :. ::: ** : :  *  .* .:**     : .

GQ161822_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161825_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GU563552_HBSP_P-E      PPVQDPAEPARLLLKQPLCFPHVAVQNLQTEIALVFPSHHHGLSENSYGG
FN594758_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594759_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594760_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594761_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSKNSYGS
KF849720_HBSP_P-E      PPVRDPAEPARLLLTEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF170741_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB915180_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB106564_HBSP_C-E      PPVRDPAEPARLWLKEPLCFPHVAVQNLRTEIALVPPSHHHGLSENSYGS
AB274985_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363607_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
EU239219_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
EU239223_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGG
DQ060830_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HQ700550_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HQ700552_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274984_HBSP_P-E      TPVQDPAEPARLLLKEPLCFPHVAVQNLWTEIALVFPSHHHGLSENSYGS
HM363582_HBSP_P-E      PPVRDPVEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736891_HBSP_P-E      PPVRDPVEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736892_HBSP_P-E      PPVRDPVEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736893_HBSP_P-E      PPVRDPVEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363605_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363576_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594753_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363575_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580638_HBSP_P-E      PPVRDPAEPAQLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MF772359_HBSP_P-E      PPVRDPAEPARLLLTEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KT192626_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363602_HBSP_P-E      PPARDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363569_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLQTEIALVFPSHHHGLSENSYGS
HM363574_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLQTEIALVFPSHHHGLSENSYGS
HM363565_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRPEIALVLPSHHHGLSENTYGS
GQ161826_HBSP_P-E      PPERDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161799_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161818_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161821_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427110_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427144_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427145_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427150_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161785_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161836_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MF772362_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161776_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHAAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161784_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHAAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161789_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHAAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161828_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHAAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161763_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENTYGS
GQ161777_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENTYGS
GQ161759_HBSP_P-E      PPVRDPAEPARLLLKEPLYFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594765_HBSP_P-E      PPARDPAEPARLLLKEPLCVPHVAVQNLRTEIALVFPSHHHGLXENSYGS
FN594749_HBSP_P-E      PPVLASPEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FJ349239_HBSP_P-E      PPVRDPAEPARLLLKEPLRFPHVAVQNLRTEIALVFPSHHHGLSENSYGC
MN967526_HBSP_P-E      PPVRDPAEPARLLLKEPLRFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FJ349226_HBSP_P-E      PPVRDPAEPARLLLKEPLYFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736894_HBSP_P-E      PPVRDPAEPARLLLKEPLYFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494712_HBSP_P-E      PPARDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849714_HBSP_P-E      PPARDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849715_HBSP_P-E      PPARDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494711_HBSP_P-E      PPARDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494705_HBSP_P-E      QPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494699_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQSLRTEIALVFPSHHHGLSENSYGS
AB915177_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAAQNLRTEIALVFPSHHHGLSENSYGS
AB274970_HBSP_P-E      PQVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB205190_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGG
AB091256_HBSP_P-E      PPLRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494695_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGC
HM363600_HBSP_P-E      PPVRDPAEHARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MF772361_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363603_HBSP_P-E      PPVRDPAEPARLLLKEPLRFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363597_HBSP_P-E      PPVRDPAEPARLLLTEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161757_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSRHHGLSENSYGS
MF772358_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSRHHGLSENSYGS
LT623847_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTQIALVFPSHHHGLSENSYGS
HM363578_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN507840_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB219534_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MF772356_HBSP_P-E      PPVRDPAEPARLLLKEPLCXPHVAVQNLRKEIALVFPSHHHGLSENSYGS
LT623851_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHXGLSENSYGS
MH580633_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
LT623843_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161775_HBSP_P-E      PPVRDPAEPARLLLKXXLCFPHVXVQNLRTEIAXVFPSHHHGLSZNSYGS
MH580645_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736913_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MF772357_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB201289_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB915175_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161768_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161796_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KM606739_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KM606738_HBSP_P-E      PPVRDPAEPARLLLEEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF922439_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849728_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849724_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849723_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGV
KF849716_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLPTEIALVFPSHHHGLSENSYGS
JQ000009_HBSP_P-E      PPVRDPAELARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161831_HBSP_P-E      LPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161762_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHAAVQNLRTEIALVFPSHHHGLSENSYGS
FN594766_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594748_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AY738144_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AY738145_HBSP_C-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AY738146_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AY738147_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274977_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB219529_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB194947_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363606_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161834_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161833_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274979_HBSP_P-E      PPVRDPAEHARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB205188_HBSP_P-E      PPVRDPAEPARLLLKGPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
EU239222_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MF772355_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVVVQNLRTEIALVFPSHHHGLSENSYGS
AB194948_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274976_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274978_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274982_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGG
AM494692_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494714_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
EU239220_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVLPSHHHGLSENSYGS
FJ349240_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN545822_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB091255_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB201287_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB201288_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB201290_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB205129_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB205189_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB205191_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB205192_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274969_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274971_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274972_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274973_HBSP_P-E      PPVRDHAEPARLLLKEPLCFPHVAVQNLRAEIALVFPSHHHGLSENSYGS
AB274974_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274975_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB274980_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGR
AB274981_HBSP_P-E      PPVRDPAEPARPLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AB915176_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494689_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494690_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494693_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494694_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494696_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494697_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494698_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494700_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494701_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494702_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494704_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494706_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494707_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494708_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494709_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494710_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494713_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494715_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AM494717_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AY739674_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
AY739675_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGR
AY935700_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
DQ060822_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
DQ060823_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
DQ060824_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
DQ060825_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
DQ060826_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNPRTEIALVFPSHHHGLSENSYGS
DQ060827_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
DQ060828_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
DQ060829_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
EU239217_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
EU239218_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
EU239221_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
EU239226_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FJ349237_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FJ349238_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN545821_HBSP_P-E      PPVRDPAEPARLLLKGPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427198_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHPGLSENSYGS
MT427170_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427157_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSENSYGS
MT427156_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRKEIALVFPSHHPGLSENSYGS
MT427152_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHLWLSENSYGS
MT427142_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLSENSYGS
MT427126_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHPGLSENSYGS
MT427114_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGFSENSYGS
MT427113_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFSSHHHGLSENSYGS
MN507842_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
LT623848_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363590_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRKEIALVFPSHHHGLSENSYGS
HM363589_HBSP_P-E      PPVRDLAAPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363588_HBSP_P-E      PPVRDLAAPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161786_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580648_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVVVQNLRTEIALVFPSHHHGLSENSYGS
KX186584_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736912_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736911_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736910_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736909_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736908_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736907_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736906_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736905_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736904_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736903_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736902_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736901_HBSP_P-E      PPVRDPAEPARHLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736900_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736899_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736898_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736897_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736896_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KU736895_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KT749841_HBSP_P-E      PPVWDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF922438_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849727_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849726_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849725_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849722_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849721_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTETALVFPSHHHGLSENSYGS
KF849719_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849718_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849717_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF849713_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
KF170742_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
JQ000008_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRXEIALVFPSHHHGLSENSYGS
HQ700551_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363611_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363610_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363609_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363604_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363601_HBSP_P-E      PPVRDLAAPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363599_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363598_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363596_HBSP_P-E      PPVRDPAEPARLLLKKPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363595_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363594_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363593_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363591_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363587_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363586_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363585_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363584_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363583_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363581_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363580_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363579_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363577_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363573_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363572_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363571_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363570_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363568_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363567_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
HM363566_HBSP_P-E      PPVRDHAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161835_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161832_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161830_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161829_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161827_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161824_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161823_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161820_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161819_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161817_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161816_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161815_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161814_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161812_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161811_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161810_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGG
GQ161808_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161807_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161805_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161804_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161803_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161802_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161801_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161800_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161797_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161795_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161794_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161793_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161792_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161791_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161790_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161787_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161783_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161782_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161781_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161780_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161779_HBSP_P-E      PPVRDPAGPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHHGLSENSYGS
GQ161778_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGG
GQ161774_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161773_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161772_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161771_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161770_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161769_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHHGLSENSYGS
GQ161766_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161765_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIAXVFPSHHHGLSENSYGS
GQ161764_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTETALVFPSHHHGLSENSYGS
GQ161761_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161760_HBSP_P-E      PPVRDHAEPARLLLKEPLCFPYVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161758_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161756_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
GQ161755_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594763_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594762_HBSP_P-E      PPVRDPAEPARLLFKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594756_HBSP_P-E      PPVQDPAEPARLLLKEPLCFPHVAVQNLRKEIALVFPSHHHGLSENSYGS
FN594752_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594751_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN594750_HBSP_P-E      PPVRDPAEPARLLFKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN545842_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN545841_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN545827_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
X75657_HBSP_P-E        PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MW082636_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGG
MT427201_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427200_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427199_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427197_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427196_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427195_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427194_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427193_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427192_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427191_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427190_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427189_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427188_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427187_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427186_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427185_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427184_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427183_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427182_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427181_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427180_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427179_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427178_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427177_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427176_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427175_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427174_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427173_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427172_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427171_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427169_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427168_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427167_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427166_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427165_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427164_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427163_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427162_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427161_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427160_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427159_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427158_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427155_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427154_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427153_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427151_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427149_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427148_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427147_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427146_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427143_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427141_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427140_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427139_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427138_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427137_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427136_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427135_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427134_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427133_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427132_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427131_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427130_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427129_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427128_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427127_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427125_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427124_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427123_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427122_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427121_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427120_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427119_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427118_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427117_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427116_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427115_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427112_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MT427111_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN967529_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN967528_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN967527_HBSP_P-E      PPVRDPAEPARLLLKAPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN507848_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN507847_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN507846_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN507845_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN507844_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN507843_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MN507841_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MK720632_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MK720631_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MK321264_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH918655_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580652_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580651_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580650_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580649_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580647_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580646_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580644_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580641_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580640_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580637_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580636_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580635_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580634_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580632_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580631_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580630_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580629_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580628_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580625_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580624_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580623_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580622_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580621_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580620_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580619_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580618_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580617_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580616_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580615_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MH580614_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MF772360_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
MF772354_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
LT623850_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
LT623846_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
LT623845_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
LT623844_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
LT623842_HBSP_P-E      PPVRDPAEPARLLLKEPLCXPHVAVQNLRTEIALVFPSHHHGLSENSYGS
LT623849_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
FN545823_HBSP_P-E      PPVRDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLSENSYGS
                                *.  :   *  *:. .*.   : * * .*.*  :  *:** 

GQ161822_HBSP_P-E      GPQPVSPGSVY
GQ161825_HBSP_P-E      GPQPVSPGSVY
GU563552_HBSP_P-E      GPQPVSHGSVY
FN594758_HBSP_P-E      GPQPVSPGSVY
FN594759_HBSP_P-E      GPQPVSPGSVY
FN594760_HBSP_P-E      GPQPVSPGSVY
FN594761_HBSP_P-E      GPQPVSLGSVY
KF849720_HBSP_P-E      GPQPVSYGSVY
KF170741_HBSP_P-E      GPQPVSLGSVY
AB915180_HBSP_P-E      GPQPVSPGSVY
AB106564_HBSP_C-E      GPQPVSPGSVY
AB274985_HBSP_P-E      GPQPVSPGSVY
HM363607_HBSP_P-E      GPQPVSPGSVY
EU239219_HBSP_P-E      GPQPVSPGSVY
EU239223_HBSP_P-E      GPQPVSPGSIY
DQ060830_HBSP_P-E      GPQPVSPGSVY
HQ700550_HBSP_P-E      GPQPVSPGSVY
HQ700552_HBSP_P-E      GPQPVSPGSVY
AB274984_HBSP_P-E      GPQPVSPGSVY
HM363582_HBSP_P-E      GPQPVSPGSVY
KU736891_HBSP_P-E      GPQPVSPGSVY
KU736892_HBSP_P-E      GPQPVSPGSVY
KU736893_HBSP_P-E      GPQPVSPGSVY
HM363605_HBSP_P-E      GPQPVSPGSVY
HM363576_HBSP_P-E      GPQPVSPGSVY
FN594753_HBSP_P-E      GPQPVSPGSVX
HM363575_HBSP_P-E      GPQPVSPGSVY
MH580638_HBSP_P-E      GPQPVSLGSVY
MF772359_HBSP_P-E      GPQPVSPGSVH
KT192626_HBSP_P-E      GPQPVSLGSVY
HM363602_HBSP_P-E      GPQPVSPGSVY
HM363569_HBSP_P-E      GPQPVSPGSVY
HM363574_HBSP_P-E      GPQPVSPGSVY
HM363565_HBSP_P-E      GPQPVSPGSVY
GQ161826_HBSP_P-E      GPQPVSLGSVY
GQ161799_HBSP_P-E      GPQPVSPGSVY
GQ161818_HBSP_P-E      GPQPVSPGSVY
GQ161821_HBSP_P-E      GPQPVSPGSVY
MT427110_HBSP_P-E      GPQPVSPGSVY
MT427144_HBSP_P-E      GPQPVSPGSVY
MT427145_HBSP_P-E      GPQPVSPGSVY
MT427150_HBSP_P-E      GPQPVSPGSVY
GQ161785_HBSP_P-E      GPQPVSPGSVY
GQ161836_HBSP_P-E      GPQPVSPGSVY
MF772362_HBSP_P-E      GPQPVSPGSVY
GQ161776_HBSP_P-E      GPQPVSPGSVY
GQ161784_HBSP_P-E      GPQPVSPGSVY
GQ161789_HBSP_P-E      GPQPVSPGSVY
GQ161828_HBSP_P-E      GPQPVSPGSVY
GQ161763_HBSP_P-E      GPQPVSPGSVY
GQ161777_HBSP_P-E      GPQPVSPGSVY
GQ161759_HBSP_P-E      GPQPVSPGSVY
FN594765_HBSP_P-E      GPQPVSPGSVY
FN594749_HBSP_P-E      GPQPVSPGSVY
FJ349239_HBSP_P-E      GPQPVSPGSVY
MN967526_HBSP_P-E      GPQPVSPGSVY
FJ349226_HBSP_P-E      GPQPVSPGSVY
KU736894_HBSP_P-E      GPQPVSPGSVY
AM494712_HBSP_P-E      GPQPVSPGSVY
KF849714_HBSP_P-E      GPQPVSPGSVY
KF849715_HBSP_P-E      GPQPVSPGSVY
AM494711_HBSP_P-E      GPQPVSPGSVY
AM494705_HBSP_P-E      GPQPVSPGSVY
AM494699_HBSP_P-E      GPQPVSPGSVY
AB915177_HBSP_P-E      GPQPVSPGSVY
AB274970_HBSP_P-E      GPQPVSPGSVY
AB205190_HBSP_P-E      GPQPVSPGSVY
AB091256_HBSP_P-E      GPQPVSPGSVY
AM494695_HBSP_P-E      GPQPVSPGSVY
HM363600_HBSP_P-E      GPQPVSPGSVY
MF772361_HBSP_P-E      GPQPVSPGSVY
HM363603_HBSP_P-E      GPQPVSPGSVY
HM363597_HBSP_P-E      GPQPVSPGSVY
GQ161757_HBSP_P-E      GPQPVSPGSVY
MF772358_HBSP_P-E      GPQPVSPGSVY
LT623847_HBSP_P-E      GPQPVSPGSVY
HM363578_HBSP_P-E      GPQPVSPGSVY
MN507840_HBSP_P-E      GPQPVSPGSVY
AB219534_HBSP_P-E      GPQPVSPSSVY
MF772356_HBSP_P-E      GPQPVSPGSVY
LT623851_HBSP_P-E      GPQPVSPGSVY
MH580633_HBSP_P-E      GPQPVSPGSVY
LT623843_HBSP_P-E      GPQPVSPGSVY
GQ161775_HBSP_P-E      GPQXVSPGSVY
MH580645_HBSP_P-E      GPQPVSPGSVY
KU736913_HBSP_P-E      GPXPVSPGSVY
MF772357_HBSP_P-E      GPQPVSPGSVY
AB201289_HBSP_P-E      GPQPVSLGSVY
AB915175_HBSP_P-E      GPQPVSLGSVY
GQ161768_HBSP_P-E      GPQPVSLGSVY
GQ161796_HBSP_P-E      GPQPVSLGSVY
KM606739_HBSP_P-E      GPQPVSPGSVY
KM606738_HBSP_P-E      GPQPVSPGSVY
KF922439_HBSP_P-E      GPQPVSPGSVY
KF849728_HBSP_P-E      GPQPVSPGSVY
KF849724_HBSP_P-E      GPQPVSPGSVY
KF849723_HBSP_P-E      GPQPVSHGSVY
KF849716_HBSP_P-E      GPQPVSPGSVY
JQ000009_HBSP_P-E      GPQPVSPGSVY
GQ161831_HBSP_P-E      GPQPVSPGSVY
GQ161762_HBSP_P-E      GPQPVSPGSVY
FN594766_HBSP_P-E      GPQPVSPGSVY
FN594748_HBSP_P-E      GPQPVSPGSVY
AY738144_HBSP_P-E      GPQPVSPGSVY
AY738145_HBSP_C-E      GPQPVSPGSVY
AY738146_HBSP_P-E      GPQPVSPGSVY
AY738147_HBSP_P-E      GPQPVSPGSVY
AB274977_HBSP_P-E      GPQPVSPGSVY
AB219529_HBSP_P-E      GPQPVSLGSVY
AB194947_HBSP_P-E      GPQPVSPGSVY
HM363606_HBSP_P-E      GPQPVSPGSVY
GQ161834_HBSP_P-E      GPQPVSPGSVY
GQ161833_HBSP_P-E      GPQPVSPGSVY
AB274979_HBSP_P-E      GPQPVSPGSVY
AB205188_HBSP_P-E      GPQPVSPGSVY
EU239222_HBSP_P-E      GPQPVSLGSVY
MF772355_HBSP_P-E      GPQPVSLGSVY
AB194948_HBSP_P-E      GPQPVSPGSVY
AB274976_HBSP_P-E      GPQPVSPGSVY
AB274978_HBSP_P-E      GPQPVSPGSVY
AB274982_HBSP_P-E      GPQPVSPGSVY
AM494692_HBSP_P-E      GPQPVSPGSVY
AM494714_HBSP_P-E      GPQPVSPGSVY
EU239220_HBSP_P-E      GPQPVSPGSVY
FJ349240_HBSP_P-E      GPQPVSPGSVY
FN545822_HBSP_P-E      GPQPVSPGSVY
AB091255_HBSP_P-E      GPQPVSPGSVY
AB201287_HBSP_P-E      GPQPVSPGSVY
AB201288_HBSP_P-E      GPQPVSPGSVY
AB201290_HBSP_P-E      GPQPVSPGSVY
AB205129_HBSP_P-E      GPQPVSPGSVY
AB205189_HBSP_P-E      GPQPVSPGSVY
AB205191_HBSP_P-E      GPQPVSPGSVY
AB205192_HBSP_P-E      GPQPVSPGSVY
AB274969_HBSP_P-E      GPQPVSPGSVY
AB274971_HBSP_P-E      GPQPVSPGSVY
AB274972_HBSP_P-E      GPQPVSPGSVY
AB274973_HBSP_P-E      GPQPVSPGSVY
AB274974_HBSP_P-E      GPQPVSPGSVY
AB274975_HBSP_P-E      GPQPVSPGSVY
AB274980_HBSP_P-E      GPQPVSPGSVY
AB274981_HBSP_P-E      GPQPVSPGSVY
AB915176_HBSP_P-E      GPQPVSPGSVY
AM494689_HBSP_P-E      GPQPVSPGSVY
AM494690_HBSP_P-E      GPQPVSPGSVY
AM494693_HBSP_P-E      GPQPVSPGSVY
AM494694_HBSP_P-E      GPQPVSPGSVY
AM494696_HBSP_P-E      GPQPVSPGSVY
AM494697_HBSP_P-E      GPQPVSPGSVY
AM494698_HBSP_P-E      GPQPVSPGSVY
AM494700_HBSP_P-E      GPQPVSPGSVY
AM494701_HBSP_P-E      GPQPVSPGSVY
AM494702_HBSP_P-E      GPQPVSPGSVY
AM494704_HBSP_P-E      GPQPVSPGSVY
AM494706_HBSP_P-E      GPQPVSPGSVY
AM494707_HBSP_P-E      GPQPVSPGSVY
AM494708_HBSP_P-E      GPQPVSPGSVY
AM494709_HBSP_P-E      GPQPVSPGSVY
AM494710_HBSP_P-E      GPQPVSPGSVY
AM494713_HBSP_P-E      GPQPVSPGSVY
AM494715_HBSP_P-E      GPQPVSPGSVY
AM494717_HBSP_P-E      GPQPVSPGSVY
AY739674_HBSP_P-E      GPQPVSPGSVY
AY739675_HBSP_P-E      GPQPVSPGSVY
AY935700_HBSP_P-E      GPQPVSPGSVY
DQ060822_HBSP_P-E      GPQPVSPGSVY
DQ060823_HBSP_P-E      GPQPVSPGSVY
DQ060824_HBSP_P-E      GPQPVSPGSVY
DQ060825_HBSP_P-E      GPQPVSPGSVY
DQ060826_HBSP_P-E      GPQPVSPGSVY
DQ060827_HBSP_P-E      GPQPVSPGSVY
DQ060828_HBSP_P-E      GPQPVSPGSVY
DQ060829_HBSP_P-E      GPQPVSPGSVY
EU239217_HBSP_P-E      GPQPVSPGSVY
EU239218_HBSP_P-E      GPQPVSPGSVY
EU239221_HBSP_P-E      GPQPVSPGSVY
EU239226_HBSP_P-E      GPQPVSPGSVY
FJ349237_HBSP_P-E      GPQPVSPGSVY
FJ349238_HBSP_P-E      GPQPVSPGSVY
FN545821_HBSP_P-E      GPQPVSPGSVY
MT427198_HBSP_P-E      GPQPVSPGSVY
MT427170_HBSP_P-E      GPQPVSPGSVY
MT427157_HBSP_P-E      GPQPVSPGSVY
MT427156_HBSP_P-E      GPQPVSPGSVY
MT427152_HBSP_P-E      GPQPVSPGSVY
MT427142_HBSP_P-E      GPQPVSPGSVY
MT427126_HBSP_P-E      GPQPVSPGSVY
MT427114_HBSP_P-E      GPQPVSPGSVY
MT427113_HBSP_P-E      GPQPVSPGSVY
MN507842_HBSP_P-E      GPQPVSPGSVY
LT623848_HBSP_P-E      GPQPVSPGSVY
HM363590_HBSP_P-E      GPQPVSPGSVY
HM363589_HBSP_P-E      GPQPVSPGSVY
HM363588_HBSP_P-E      GPQPVSPGSVY
GQ161786_HBSP_P-E      GPQPVSPGSVH
MH580648_HBSP_P-E      GPQPVSPGSVY
KX186584_HBSP_P-E      GPQPVSPGSVY
KU736912_HBSP_P-E      GPQPVSPGSVY
KU736911_HBSP_P-E      GPQPVSPGSVY
KU736910_HBSP_P-E      GPQPVSPGSVY
KU736909_HBSP_P-E      GPQPVSPGSVY
KU736908_HBSP_P-E      GPQPVSPGSVY
KU736907_HBSP_P-E      GPQPVSPGSVY
KU736906_HBSP_P-E      GPQPVSPGSVY
KU736905_HBSP_P-E      GPQPVSPGSVY
KU736904_HBSP_P-E      GPQPVSPGSVY
KU736903_HBSP_P-E      GPQPVSPGSVY
KU736902_HBSP_P-E      GPQPVSPGSVY
KU736901_HBSP_P-E      GPQPVSPGSVY
KU736900_HBSP_P-E      GPQPVSPGSVY
KU736899_HBSP_P-E      GPQPVSPGSVY
KU736898_HBSP_P-E      GPQPVSPGSVY
KU736897_HBSP_P-E      GPQPVSPGSVY
KU736896_HBSP_P-E      GPQPVSPGSVY
KU736895_HBSP_P-E      GPQPVSPGSVY
KT749841_HBSP_P-E      GPQPVSPGSVY
KF922438_HBSP_P-E      GPQPVSPGSVY
KF849727_HBSP_P-E      GPQPVSPGSVY
KF849726_HBSP_P-E      GPQPVSPGSVY
KF849725_HBSP_P-E      GPQPVSPGSVY
KF849722_HBSP_P-E      GPQPVSPGSVY
KF849721_HBSP_P-E      GPQPVSPGSVY
KF849719_HBSP_P-E      GPQPVSPGSVY
KF849718_HBSP_P-E      GPQPVSPGSVY
KF849717_HBSP_P-E      GPQPVSPGSVY
KF849713_HBSP_P-E      GPQPVSPGSIY
KF170742_HBSP_P-E      GPQPVSPGSVY
JQ000008_HBSP_P-E      GPQPVSPGSVY
HQ700551_HBSP_P-E      GPQPVSPGSVY
HM363611_HBSP_P-E      GPQPVSPGSVY
HM363610_HBSP_P-E      GPQPVSPGSVY
HM363609_HBSP_P-E      GPQPVSPGSVY
HM363604_HBSP_P-E      GPQPVSPGSVY
HM363601_HBSP_P-E      GPQPVSPGSVY
HM363599_HBSP_P-E      GPQPVSPGSVY
HM363598_HBSP_P-E      GPQPVSPGSVY
HM363596_HBSP_P-E      GPQPVSPGSVY
HM363595_HBSP_P-E      GPQPVSPGSVY
HM363594_HBSP_P-E      GPQPVSPGSVY
HM363593_HBSP_P-E      GPQPVSPGSVY
HM363591_HBSP_P-E      GPQPVSPGSVY
HM363587_HBSP_P-E      GPQPVSPGSVY
HM363586_HBSP_P-E      GPQPVSPGSVY
HM363585_HBSP_P-E      GPQPVSPGSVY
HM363584_HBSP_P-E      GPQPVSPGSVY
HM363583_HBSP_P-E      GPQPVSPGSVY
HM363581_HBSP_P-E      GPQPVSPGSVY
HM363580_HBSP_P-E      GPQPVSPGSVY
HM363579_HBSP_P-E      GPQPVSPGSVY
HM363577_HBSP_P-E      GPQPVSPGSVY
HM363573_HBSP_P-E      GPQPVSPGSVY
HM363572_HBSP_P-E      GPQPVSPGSVY
HM363571_HBSP_P-E      GPQPVSPGSVY
HM363570_HBSP_P-E      GPQPVSPGSVY
HM363568_HBSP_P-E      GPQPVSPGSVY
HM363567_HBSP_P-E      GPQPVSPGSVY
HM363566_HBSP_P-E      GPQPVSPGSVY
GQ161835_HBSP_P-E      GPQPVSPGSVY
GQ161832_HBSP_P-E      GPQPVSPGSVY
GQ161830_HBSP_P-E      GPQPVSPGSVY
GQ161829_HBSP_P-E      GPQPVSPGSVY
GQ161827_HBSP_P-E      GPQPVSPGSVY
GQ161824_HBSP_P-E      GPQPVSPGSVY
GQ161823_HBSP_P-E      GPQPVSPGSVY
GQ161820_HBSP_P-E      GPQPVSPGSVY
GQ161819_HBSP_P-E      GPQPVSPGSVY
GQ161817_HBSP_P-E      GPQPVSPGSVY
GQ161816_HBSP_P-E      GPQPVSPGSVY
GQ161815_HBSP_P-E      GPQPVSPGSVY
GQ161814_HBSP_P-E      GPQPVSPGSVY
GQ161812_HBSP_P-E      GPQPVSPGSVY
GQ161811_HBSP_P-E      GPQPVSPGSVY
GQ161810_HBSP_P-E      GPQPVSPGSVY
GQ161808_HBSP_P-E      GPQPVSPGSVY
GQ161807_HBSP_P-E      GPQPVSPGSVY
GQ161805_HBSP_P-E      GPQPVSPGSVY
GQ161804_HBSP_P-E      GPQPVSPGSVY
GQ161803_HBSP_P-E      GPQPVSPGSVY
GQ161802_HBSP_P-E      GPQPVSPGSVY
GQ161801_HBSP_P-E      GPQPVSPGSVY
GQ161800_HBSP_P-E      GPQPVSPGSVY
GQ161797_HBSP_P-E      GPQPVSPGSVY
GQ161795_HBSP_P-E      GPQPVSPGSVY
GQ161794_HBSP_P-E      GPQPVSPGSVY
GQ161793_HBSP_P-E      GPQPVSPGSVY
GQ161792_HBSP_P-E      GPQPVSPGSVY
GQ161791_HBSP_P-E      GPQPVSPGSVY
GQ161790_HBSP_P-E      GPQPVSPGSVY
GQ161787_HBSP_P-E      GPQPVSPGSVY
GQ161783_HBSP_P-E      GPQPVSPGSVY
GQ161782_HBSP_P-E      GPQPVSPGSVY
GQ161781_HBSP_P-E      GPQPVSPGSVY
GQ161780_HBSP_P-E      GPQPVSPGSVY
GQ161779_HBSP_P-E      GPQPVSPGSVY
GQ161778_HBSP_P-E      GPQPVSPGSVY
GQ161774_HBSP_P-E      GPQPVSPGSVY
GQ161773_HBSP_P-E      GPQPVSPGSVY
GQ161772_HBSP_P-E      GPQPVSPGSVY
GQ161771_HBSP_P-E      GPQPVSPGSVY
GQ161770_HBSP_P-E      GPQPVSPGSVY
GQ161769_HBSP_P-E      GPQPVSPGSVY
GQ161766_HBSP_P-E      GPQPVSPGSVY
GQ161765_HBSP_P-E      GPQPVSPGSVY
GQ161764_HBSP_P-E      GPQPVSPGSVY
GQ161761_HBSP_P-E      GPQPVSPGSVY
GQ161760_HBSP_P-E      GPQPVSPGSVY
GQ161758_HBSP_P-E      GPQPVSPGSVY
GQ161756_HBSP_P-E      GPQPVSPGSVY
GQ161755_HBSP_P-E      GPQPVSPGSVY
FN594763_HBSP_P-E      GPQPVSPGSVY
FN594762_HBSP_P-E      GPQPVSPGSVY
FN594756_HBSP_P-E      GPQPVSPGSVY
FN594752_HBSP_P-E      GPQPVSPGSVY
FN594751_HBSP_P-E      GPQPVSPGSVY
FN594750_HBSP_P-E      GPQPVSPGSVY
FN545842_HBSP_P-E      GPQPVSPGSVY
FN545841_HBSP_P-E      GPQPVSPGSVY
FN545827_HBSP_P-E      GPQPVSPGSVY
X75657_HBSP_P-E        GPQPVSPGSVY
MW082636_HBSP_P-E      GPQPVSPGSVY
MT427201_HBSP_P-E      GPQPVSPGSVY
MT427200_HBSP_P-E      GPQPVSPGSVY
MT427199_HBSP_P-E      GPQPVSPGSVY
MT427197_HBSP_P-E      GPQPVSPGSVY
MT427196_HBSP_P-E      GPQPVSPGSVY
MT427195_HBSP_P-E      GPQPVSPGSVY
MT427194_HBSP_P-E      GPQPVSPGSVY
MT427193_HBSP_P-E      GPQPVSPGSVY
MT427192_HBSP_P-E      GPQPVSPGSVY
MT427191_HBSP_P-E      GPQPVSPGSVY
MT427190_HBSP_P-E      GPQPVSPGSVY
MT427189_HBSP_P-E      GPQPVSPGSVY
MT427188_HBSP_P-E      GPQPVSPGSVY
MT427187_HBSP_P-E      GPQPVSPGSVY
MT427186_HBSP_P-E      GPQPVSPGSVY
MT427185_HBSP_P-E      GPQPVSPGSVY
MT427184_HBSP_P-E      GPQPVSPGSVY
MT427183_HBSP_P-E      GPQPVSPGSVY
MT427182_HBSP_P-E      GPQPVSPGSVY
MT427181_HBSP_P-E      GPQPVSPGSVY
MT427180_HBSP_P-E      GPQPVSPGSVY
MT427179_HBSP_P-E      GPQPVSPGSVY
MT427178_HBSP_P-E      GPQPVSPGSVY
MT427177_HBSP_P-E      GPQPVSPGSVY
MT427176_HBSP_P-E      GPQPVSPGSVY
MT427175_HBSP_P-E      GPQPVSPGSVY
MT427174_HBSP_P-E      GPQPVSPGSVY
MT427173_HBSP_P-E      GPQPVSPGSVY
MT427172_HBSP_P-E      GPQPVSPGSVY
MT427171_HBSP_P-E      GPQPVSPGSVY
MT427169_HBSP_P-E      GPQPVSPGSVY
MT427168_HBSP_P-E      GPQPVSPGSVY
MT427167_HBSP_P-E      GPQPVSPGSVY
MT427166_HBSP_P-E      GPQPVSPGSVY
MT427165_HBSP_P-E      GPQPVSPGSVY
MT427164_HBSP_P-E      GPQPVSPGSVY
MT427163_HBSP_P-E      GPQPVSPGSVY
MT427162_HBSP_P-E      GPQPVSPGSVY
MT427161_HBSP_P-E      GPQPVSPGSVY
MT427160_HBSP_P-E      GPQPVSPGSVY
MT427159_HBSP_P-E      GPQPVSPGSVY
MT427158_HBSP_P-E      GPQPVSPGSVY
MT427155_HBSP_P-E      GPQPVSPGSIY
MT427154_HBSP_P-E      GPQPVSPGSVY
MT427153_HBSP_P-E      GPQPVSPGSVY
MT427151_HBSP_P-E      GPQPVSPGSVY
MT427149_HBSP_P-E      GPQPVSPGSVY
MT427148_HBSP_P-E      GPQPVSPGSVY
MT427147_HBSP_P-E      GPQPVSPGSVY
MT427146_HBSP_P-E      GPQPVSPGSVY
MT427143_HBSP_P-E      GPQPVSPGSVY
MT427141_HBSP_P-E      GPQPVSPGSVY
MT427140_HBSP_P-E      GPQPVSPGSVY
MT427139_HBSP_P-E      GPQPVSPGSVY
MT427138_HBSP_P-E      GPQPVSPGSVY
MT427137_HBSP_P-E      GPQPVSPGSVY
MT427136_HBSP_P-E      GPQPVSPGSVY
MT427135_HBSP_P-E      GPQPVSPGSVY
MT427134_HBSP_P-E      GPQPVSPGSVY
MT427133_HBSP_P-E      GPQPVSPGSVY
MT427132_HBSP_P-E      GPQPVSPGSVY
MT427131_HBSP_P-E      GPQPVSPGSVY
MT427130_HBSP_P-E      GPQPVSPGSVY
MT427129_HBSP_P-E      GPQPVSPGSVY
MT427128_HBSP_P-E      GPQPVSPGSVY
MT427127_HBSP_P-E      GPQPVSPGSVY
MT427125_HBSP_P-E      GPQPVSPGSVY
MT427124_HBSP_P-E      GPQPVSPGSVY
MT427123_HBSP_P-E      GPQPVSPGSVY
MT427122_HBSP_P-E      GPQPVSPGSVY
MT427121_HBSP_P-E      GPQPVSPGSVY
MT427120_HBSP_P-E      GPQPVSPGSVY
MT427119_HBSP_P-E      GPQPVSPGSVY
MT427118_HBSP_P-E      GPQPVSPGSVY
MT427117_HBSP_P-E      GPQPVSPGSVY
MT427116_HBSP_P-E      GPQPVSPGSVY
MT427115_HBSP_P-E      GPQPVSPGSVY
MT427112_HBSP_P-E      GPQPVSPGSVY
MT427111_HBSP_P-E      GPQPVSPGSVY
MN967529_HBSP_P-E      GPQPVSPGSVY
MN967528_HBSP_P-E      GPQPVSPGSVY
MN967527_HBSP_P-E      GPQPVSPGSVY
MN507848_HBSP_P-E      GPQPVSPGSVY
MN507847_HBSP_P-E      GPQPVSPGSVY
MN507846_HBSP_P-E      GPQPVSPGSVY
MN507845_HBSP_P-E      GPQPVSPGSVY
MN507844_HBSP_P-E      GPQPVSPGSVY
MN507843_HBSP_P-E      GPQPVSPGSVY
MN507841_HBSP_P-E      GPQPVSPGSVY
MK720632_HBSP_P-E      GPQPVSPGSVY
MK720631_HBSP_P-E      GPQPVSPGSVY
MK321264_HBSP_P-E      GPQPVSPGSVY
MH918655_HBSP_P-E      GPQPVSPGSVY
MH580652_HBSP_P-E      GPQPVSPGSVY
MH580651_HBSP_P-E      GPQPVSPGSVY
MH580650_HBSP_P-E      GPQPVSPGSVY
MH580649_HBSP_P-E      GPQPVSPGSVY
MH580647_HBSP_P-E      GPQPVSPGSVY
MH580646_HBSP_P-E      GPQPVSPGSVY
MH580644_HBSP_P-E      GPQPVSPGSVY
MH580641_HBSP_P-E      GPQPVSPGSVY
MH580640_HBSP_P-E      GPQPVSPGSVY
MH580637_HBSP_P-E      GPQPVSPGSVY
MH580636_HBSP_P-E      GPQPVSPGSVY
MH580635_HBSP_P-E      GPQPVSPGSVY
MH580634_HBSP_P-E      GPQPVSPGSVY
MH580632_HBSP_P-E      GPQPVSPGSVY
MH580631_HBSP_P-E      GPQPVSPGSVY
MH580630_HBSP_P-E      GPQPVSPGSVY
MH580629_HBSP_P-E      GPQPVSPGSVY
MH580628_HBSP_P-E      GPQPVSPGSVY
MH580625_HBSP_P-E      GPQPVSPGSVY
MH580624_HBSP_P-E      GPQPVSPGSVY
MH580623_HBSP_P-E      GPQPVSPGSVY
MH580622_HBSP_P-E      GPQPVSPGSVY
MH580621_HBSP_P-E      GPQPVSPGSVY
MH580620_HBSP_P-E      GPQPVSPGSVY
MH580619_HBSP_P-E      GPQPVSPGSVY
MH580618_HBSP_P-E      GPQPVSPGSVY
MH580617_HBSP_P-E      GPQPVSPGSVY
MH580616_HBSP_P-E      GPQPVSPGSVY
MH580615_HBSP_P-E      GPQPVSPGSVY
MH580614_HBSP_P-E      GPQPVSPGSVY
MF772360_HBSP_P-E      GPQPVSPGSVY
MF772354_HBSP_P-E      GPQPVSPGSVY
LT623850_HBSP_P-E      GPQPVSPGSVY
LT623846_HBSP_P-E      GPQPVSPGSVY
LT623845_HBSP_P-E      GPQPVSPGSVY
LT623844_HBSP_P-E      GPQPVSPGSVY
LT623842_HBSP_P-E      GPQPVSPGSVY
LT623849_HBSP_P-E      GPQPVSPGSVY
FN545823_HBSP_P-E      GPQPVSPGSVY
                       **  ** .*: 

© 1998-2021Legal notice