HBVdb

Dataset for protein HBSP of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
   :   :   *:**  :. ::: ** : :  *  .* .:**     : .         :.  :   *  *:  .*.   
MPLSYQHFRRiLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLQLPNDHQPPVRDPAEPARLLLKEPLCFPHVAVQNLRT
     p  l l         d   h             fhv d p   a                      k
                                              t                               

        90       100       110 
....:....|....:....|....:....|.
: . : .*.*  :  *:** **  ** .*: 
EIALVFPSHHHGLSENSYGSGPQPVSPGSVY
                   g      l    
                               
© 1998-2022Legal notice