HBVdb

Dataset for protein SHBs of genotype D

[Download (right click)] [Sequences] [Repertoires]

5546 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


GU938313_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU155895_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILRIPQSLDSWWTSLNFQGGTTVCLG
AB048701_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
AB078031_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB090268_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
AB090269_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB090270_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
AB104709_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB104710_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB104711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB104712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109478_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109479_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
AB109480_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
AB109481_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109482_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
AB109483_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109487_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AB119252_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
AB126581_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB188241_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB188242_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB188244_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AB205127_SHBs_P-D      MENITSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB205128_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRIFTIPQSLDSWWTSLNFLGGSTVCLG
AB210820_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB222710_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB222712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB222782_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB246347_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB246348_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270539_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270540_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270541_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270542_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270543_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270546_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270547_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270548_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270550_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AB330367_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB330369_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB330370_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB555496_SHBs_P-D      MENITSGFLGALLMIQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB555500_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB555501_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561826_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561827_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561828_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCRG
AB561829_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561830_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AB561832_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561834_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561835_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561836_SHBs_P-D      MENITSRLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561837_SHBs_P-D      MENITSGFLGPLLVXQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLG
AB561838_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLG
AB561839_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561840_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561842_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AB561844_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
AB561846_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561848_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
AB561849_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
AB561851_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561852_SHBs_P-D      MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561853_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561854_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
AB561855_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLXFLGGTTVCLG
AB561856_SHBs_P-D      MENITSGLLGPLLVLQAGYFLXTRILTIPQSLDSWWTSLNFLGGAPVCLG
AB674403_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674405_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674406_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGATVCRG
AB674408_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AB674409_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674411_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674413_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674414_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674415_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674416_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674417_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674418_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AB674419_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGTTVCLG
AB674420_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674422_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674423_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674424_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AB674425_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCRG
AB674426_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674427_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674428_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674429_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674431_SHBs_P-D      MENITSRFLGPLLGLLAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB786650_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF041251_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRG
AF043593_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF043594_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF061523_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
AF061524_SHBs_P-D      MENITSGLLAPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
AF061528_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF065110_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF065112_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
AF065117_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF065118_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
AF065119_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF083640_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF083641_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF121239_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF121242_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLG
AF134135_SHBs_P-D      MENITSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF134136_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF134140_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCRG
AF134141_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
AF134142_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
AF151735_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF208870_SHBs_P-D      MENITSDFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF208872_SHBs_P-D      MENITSGFLGPQLVLQAGFFLLTRILTIPLSLDSWWTSLNFLGGTTVCFG
AF208874_SHBs_P-D      MENITSDFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF208877_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF209391_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AF209394_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF209396_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF209401_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF214659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF229158_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF280817_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF369534_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSLVCLG
AF372622_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF372623_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ297861_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ297864_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ297865_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ297869_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ297871_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ297883_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ344116_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ517792_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGNTVCLG
AJ627215_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
AJ627216_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
AJ627218_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
AJ627219_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ627220_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ627222_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AM494749_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGETTVCLG
AM494750_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGETTVCLG
AM991999_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY090452_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AY090453_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122552_SHBs_P-D      METITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122555_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122559_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122560_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122561_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AY122563_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122564_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122565_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122566_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
AY122567_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
AY122571_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122572_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122574_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122575_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122576_SHBs_P-D      MENTTSGFLGPLLVLQGVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122587_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122590_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
AY122591_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122592_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCLG
AY122593_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY161150_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY161153_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY161157_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY161159_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY230116_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLDFLGGTTVCLG
AY233291_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY233292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGTTVCLG
AY233294_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGTTVCLG
AY233296_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY236160_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
AY236162_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
AY236164_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWRTSLSFLGGNTVCLG
AY254524_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY254525_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
AY653804_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653806_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
AY653807_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653808_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653809_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653810_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653811_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653812_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653819_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653821_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653823_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILRIPQSLDSWWTSLNFLGGTTVCLG
AY653824_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653826_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653830_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653838_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
AY653839_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653840_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653841_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653842_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AY653843_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AY653845_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLG
AY653849_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653850_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653859_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653862_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653868_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653870_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653871_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653872_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653873_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653874_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653876_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653880_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653881_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653886_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
AY653887_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738848_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGTTVCLG
AY738849_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738850_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738851_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738852_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLRRILTIPKSLDSWWTSLNFLGGTTVCLG
AY738853_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738854_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGESTVCLG
AY738855_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDTWWTSLNFLGGSTVCLG
AY738856_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTSVCLG
AY738860_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738863_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
AY738864_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738866_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738867_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738868_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738870_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738871_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738872_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738873_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738877_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738878_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738879_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738883_SHBs_P-D      MENITSRFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738884_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738887_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738891_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738892_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738893_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738896_SHBs_P-D      MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738897_SHBs_P-D      MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738898_SHBs_P-D      MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738899_SHBs_P-D      MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738900_SHBs_P-D      MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738901_SHBs_P-D      MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738902_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738903_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738905_SHBs_P-D      MENITSGFLGPLLVLQSGFFLLPRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738906_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLPRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738907_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738908_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738909_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIQQSLDSWWTSLNFLGGTTVCLG
AY738912_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY741794_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY741796_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY741797_SHBs_P-D      MENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY741798_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGDTTVCLG
AY796031_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
AY945307_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY999088_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ111986_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLG
DQ131123_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ236128_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
DQ299408_SHBs_P-D      MESITSGFLGSLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ299409_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ304547_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACRG
DQ304548_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTTILTIPQSLDSWWTSLNFLGGTTVCLG
DQ304549_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTTILTIPQSLDSWWTSLNFLGGTTVCRG
DQ315778_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ329356_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGTPVCLG
DQ336674_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ336675_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ336676_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ336678_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ336679_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ336680_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ336681_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ336682_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ336685_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ336686_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLG
DQ336689_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ336690_SHBs_P-D      MENITSRLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ336691_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ412277_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412278_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412279_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412280_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412282_SHBs_P-D      METITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412283_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
DQ412284_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
DQ412285_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
DQ412286_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
DQ412288_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412289_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
DQ412290_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
DQ412291_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTIACLG
DQ412292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412293_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGETTVCLG
DQ412294_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412295_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412297_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ412298_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
DQ412300_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412302_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412303_SHBs_P-D      MENITSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412304_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412306_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412307_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412308_SHBs_P-D      MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412309_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLG
DQ412310_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412313_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
DQ412314_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412315_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412316_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412321_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412323_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
DQ412324_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412325_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412326_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412327_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
DQ412329_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEATVCRG
DQ412330_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412331_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412332_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
DQ412335_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412336_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412337_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412340_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
DQ412341_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLG
DQ412342_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412344_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
DQ412345_SHBs_P-D      MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412346_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412347_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
DQ412348_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412349_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLG
DQ412352_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412355_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
DQ412356_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
DQ412357_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412359_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412360_SHBs_P-D      MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412361_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412362_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
DQ412363_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
DQ412365_SHBs_P-D      MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412366_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412367_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412368_SHBs_P-D      MENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412369_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412370_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412371_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412372_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412373_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412374_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412375_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412380_SHBs_P-D      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412381_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412383_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412384_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTPVCLG
DQ412387_SHBs_P-D      MENITSGXXGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412388_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCLG
DQ412390_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412391_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412393_SHBs_P-D      MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412395_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412396_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
DQ412397_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
DQ412399_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412401_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLG
DQ412403_SHBs_P-D      MENITSGXLGPLLVLQAXFFLXTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412404_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
DQ412405_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
DQ412407_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412412_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412414_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLSFLGGTTVCLG
DQ412415_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412416_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412419_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412421_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412422_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
DQ412423_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412424_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLXGTTVCLG
DQ412425_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412426_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412427_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTMPQSLDSWWTSLNFLGETTVCLG
DQ412430_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412433_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412436_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412438_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412439_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412440_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412441_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412442_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLG
DQ459085_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ464168_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ464169_SHBs_P-D      MENITSGILGPLLVLQAGFFLLTRILTIRQSLDSWWTSLNFLGGTTVCLG
DQ464170_SHBs_P-D      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ464172_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ464174_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLG
DQ464175_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ464176_SHBs_P-D      MENITSGLLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ464177_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ464178_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLG
DQ464181_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ464182_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ486021_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQCLDSWRTSLSFLGGNTVCLG
DQ486023_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ486025_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGTTVCRG
DQ871265_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
DQ871266_SHBs_P-D      ----TSGFLGPLLVXQAVFFLXTRILTIPQSLDSWWTSLSFLGGTTVCLG
DQ991752_SHBs_P-D      MGNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995809_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995810_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGXTVCLG
DQ995811_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995812_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995814_SHBs_P-D      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
DQ995815_SHBs_P-D      MENITSGLLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995817_SHBs_P-D      MENIISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995819_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995820_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995821_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGXTTVCLG
DQ995823_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
DQ995824_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
DQ995825_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995828_SHBs_P-D      MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGTTVCLG
DQ995830_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
DQ995831_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995832_SHBs_P-D      MENITSGXLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995835_SHBs_P-D      MENITSGLLGPLLVLQAGFXLLTKILTIPQSLDSWWXSLNFLGXTTVCLG
DQ995837_SHBs_P-D      MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995838_SHBs_P-D      MENITSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGTTVCRG
DQ995839_SHBs_P-D      MENITSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995840_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995841_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
DQ995842_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995845_SHBs_P-D      MENIISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
DQ995852_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995853_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGTTVCLG
DQ995854_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
DQ995856_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995857_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
DQ995858_SHBs_P-D      MENITSGLLGPLLVLXAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
EF103276_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF103277_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF103279_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF103280_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF398036_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGTTVCLG
EF547858_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690477_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
EF690481_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690482_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690483_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEPTVCRG
EU155893_SHBs_P-D      MGNITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU346890_SHBs_P-D      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
EU414105_SHBs_P-D      MENITSGXLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414111_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414114_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGENAVCLG
EU414115_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414118_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLG
EU414119_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414120_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414121_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414127_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
EU414128_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414130_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414140_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTXVCLG
EU414142_SHBs_P-D      MENITSGXLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594398_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594404_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
EU594405_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRTLTIPQSLDSWWTSLNFLGGTTVCLG
EU594407_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594408_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594422_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594425_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594426_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594433_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594434_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787437_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787438_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787441_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787447_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVSLG
EU919197_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU921418_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLSFLGGTTVCLG
EU921419_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
EU939680_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349206_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349211_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349213_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
FJ349215_SHBs_P-D      MENITSGFLGPLLVIQAGFFLLIRILTITHSLDSWWTSLNFLGGTTVCVV
FJ349218_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349219_SHBs_P-D      MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349231_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349232_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349233_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349235_SHBs_P-D      MENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
FJ562338_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ621799_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTXVCLG
FJ622444_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ622867_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ622869_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692514_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692515_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692517_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692525_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692529_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692530_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692531_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692541_SHBs_P-D      MEXITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGXXVCLG
FJ709467_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ709474_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLG
FJ899792_SHBs_P-D      MENVTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904395_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGTTVCLG
FJ904402_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904410_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904419_SHBs_P-D      MENITSGFLGPLLVFQAGCFLLTRILTMPQSLDSWWTSLNFLGGTTVCLG
FJ904422_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904426_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904427_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904429_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTMPQSLDSWWTSLSFLGGTTVCLG
FJ904431_SHBs_P-D      MENITSGFLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904432_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904433_SHBs_C-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904438_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
FJ904445_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
FM200192_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSPNFLGGTTVCLG
FM200194_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FM200212_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FM200213_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
FN295500_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
FN295501_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295504_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295506_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295512_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295513_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295514_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTIECLG
FN295517_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295519_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295523_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295524_SHBs_P-D      MESTTSGFLGPLLALQAGFFLLTKILTIPQNLDSWWTSLNFLGGTTVCLG
FN295525_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN821457_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGGTTVCLG
FN821500_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ167301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GQ167302_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACRG
GQ183448_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183449_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183456_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183459_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183460_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183467_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183471_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183473_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183474_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183475_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183479_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183480_SHBs_P-D      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183481_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ184322_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GQ205382_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ205384_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ205385_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ205389_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ325778_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ353298_SHBs_P-D      MENITLGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLG
GQ353303_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ477452_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ477453_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ477455_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
GQ477456_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ477457_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ477458_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKIIKIPQSLDSWWTSLNFLGGTTVCLG
GQ486036_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCXG
GQ486037_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486039_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486040_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486041_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
GQ486042_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486043_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486045_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486046_SHBs_P-D      MENITSGLLGPLLVXQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486047_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGXXTVCLG
GQ486049_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486051_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486052_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486053_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486054_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486055_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486056_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486058_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486059_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
GQ486060_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486064_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
GQ486065_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486067_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486068_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486069_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486070_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486072_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486073_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLXFLGGTTVCLG
GQ486074_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGXTVCLG
GQ486075_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486078_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486080_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486085_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486086_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GQ486087_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486088_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
GQ486094_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486097_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486098_SHBs_P-D      MENXTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486099_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486100_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRIXTIPQSLDSWWTSLNFLGGTTVCLG
GQ486102_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGSTVCLG
GQ486105_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486108_SHBs_P-D      MENITSGXLXPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486109_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486110_SHBs_P-D      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486111_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486113_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486117_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGTTVCLG
GQ486118_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486124_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCXG
GQ486125_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486127_SHBs_P-D      MXNXTSXFLGPLLGLQAGFFLLTRILTILQSLDLWWTSLNFLGGTTVCLG
GQ486128_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGNIVCLG
GQ486132_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486133_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGNTVCLG
GQ486135_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486136_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486137_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486138_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
GQ486142_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486144_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486145_SHBs_P-D      MENITSGLLXPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486146_SHBs_P-D      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486147_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486152_SHBs_P-D      MENITSGFLGPLLXLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486154_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
GQ486157_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGXTVCLG
GQ486158_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486160_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486163_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEATVCRG
GQ486164_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486166_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
GQ486167_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
GQ486168_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GQ486169_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
GQ486170_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486171_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486173_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLXFLGGTTVCLG
GQ486175_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486177_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLG
GQ486178_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486179_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486180_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486181_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GQ486183_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLG
GQ486184_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486185_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486187_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486191_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GQ486193_SHBs_P-D      MENITSGXLXPLLXLQAGFFLLTXILTIPKSLDSWWTSLNFLGGXTVCLG
GQ486195_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GQ486199_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486200_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486201_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486202_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
GQ486206_SHBs_P-D      MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
GQ486207_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
GQ486210_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCRG
GQ486212_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486214_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
GQ486215_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486217_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486218_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486220_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486221_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486224_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486229_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486230_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
GQ486231_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486235_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
GQ486237_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486238_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486239_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GQ486243_SHBs_P-D      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
GQ486244_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GQ486247_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486248_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486250_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486251_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GQ486252_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486254_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486256_SHBs_P-D      MENITSGXLGPLLVLQAXFFLLTRILTIPQSLDSWWTSLNFLGGTTXCLG
GQ486257_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486259_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486260_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486261_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
GQ486263_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
GQ486265_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTGCLG
GQ486266_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
GQ486270_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486273_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486274_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GQ486275_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTAVCLG
GQ486276_SHBs_P-D      MENITSGFLXPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486278_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTXCLG
GQ486279_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486280_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486281_SHBs_P-D      -ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486282_SHBs_P-D      MENITSGLLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486283_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486284_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486285_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486286_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486289_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486290_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486293_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486294_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486296_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486297_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486298_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
GQ486299_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486302_SHBs_P-D      MENISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486303_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GQ486304_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486308_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
GQ486313_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRG
GQ486321_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGPTVCLG
GQ486322_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486323_SHBs_P-D      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486324_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCPG
GQ486325_SHBs_P-D      MENITSGXLXPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCRG
GQ486326_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILRIPQSLDSWWTSLNFLGGNTVCLG
GQ486328_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486329_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486330_SHBs_P-D      MENITSGFLGPLLXLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486332_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486336_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486339_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486340_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLG
GQ486341_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILXIPQSLDSWWTSLNFLGGTTVCRG
GQ486342_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486343_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486345_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486346_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486347_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSXWTSLNFLGGTTVCLG
GQ486352_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLG
GQ486354_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486355_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486356_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486358_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTACLG
GQ486361_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486362_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486363_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
GQ486374_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCXG
GQ486378_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLXFLGGXXVCLG
GQ486379_SHBs_P-D      MENITSGFLGPLLVLQAXFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486380_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486381_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486382_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486383_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486384_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
GQ486386_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCXG
GQ486392_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGXTVCXG
GQ486398_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLG
GQ486406_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486407_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486412_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486414_SHBs_P-D      MENITSGXLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
GQ486420_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486422_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486428_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486429_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486446_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486453_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGXTVCLG
GQ486465_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486467_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486471_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486472_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486473_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486476_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486481_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486483_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
GQ486484_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486487_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486488_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486489_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486496_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486504_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486506_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486507_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486517_SHBs_P-D      MENITSGXLGPLLVLXAGFFXLTRILTIPXSLDSWWTSLXFLGGTTVCLG
GQ486520_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
GQ486525_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486530_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
GQ486539_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486545_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486546_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486552_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486555_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486589_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486593_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486594_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
GQ486602_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486614_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486627_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486634_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486635_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486638_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486655_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486662_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486672_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486674_SHBs_P-D      METITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486675_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPXSLDSWWTSLNFLGGTTACLG
GQ486678_SHBs_P-D      MENITSGFLGPLLVLQARFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486681_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486698_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486699_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486700_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486705_SHBs_P-D      MENISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGXTTVCRG
GQ486706_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GQ486708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCRG
GQ486709_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486711_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486716_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486717_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486719_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGETTVCRG
GQ486730_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486731_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
GQ486735_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486738_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSXWTSLNFLGGTTVCLG
GQ486745_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486746_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTXVCLG
GQ486748_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486755_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486759_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486767_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486768_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLG
GQ486769_SHBs_P-D      MENITSGFLXPLLVLQAGFXLLTRILTIPQSLDSWWTSLXFLGGTTVCLG
GQ486771_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486773_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486774_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486781_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486785_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGTTVCLG
GQ486798_SHBs_P-D      MENITSGFLGLLLXLQAGFFLLTKILTIPQSLDSWWTSLSFLGGTTVCRG
GQ486806_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGTTVCLG
GQ486808_SHBs_P-D      MENITSGFLGPLLVLQAGFFSLTRILTILQSLDSWLTSLNFLGGTPVCLG
GQ486815_SHBs_P-D      MENITSGLLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486818_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEATVCRG
GQ486820_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486822_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486826_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GQ486827_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRG
GQ486842_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLXXLGGTTVCLG
GQ486844_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486845_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
GQ486846_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
GQ486848_SHBs_P-D      MENIXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486849_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ486851_SHBs_P-D      MENITSGXLXPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCXG
GQ486858_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486866_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486867_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ491108_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ491110_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLG
GQ922000_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ922004_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ922005_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLNFLGGTTVCLG
GQ995474_SHBs_P-D      MESISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU357846_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456636_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456637_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGTTVCLG
GU456639_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456641_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456642_SHBs_P-D      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFRGGTTVCLG
GU456643_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLG
GU456645_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGETTVCLG
GU456649_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDWWWTSLNFLGGTPVCLG
GU456650_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTMPKSLDSWWTSLNFLGGTTVCLG
GU456651_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GU456652_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456653_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456654_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456656_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456657_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456658_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLG
GU456659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456661_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456662_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456664_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456665_SHBs_P-D      MENITSGFLGPLVVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCLG
GU456666_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
GU456667_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456668_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456669_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPSSLDSWWTSLNFLGGTTVCLG
GU456673_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456674_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLSFLGGTTVCLG
GU456675_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456676_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GU456679_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
GU456682_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456683_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456684_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798967_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798969_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798971_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
GU798972_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
GU798980_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTGCLG
GU798985_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798988_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798995_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798997_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799000_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799003_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRG
GU799012_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799018_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799021_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799022_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799024_SHBs_P-D      MENITSGFLGPLLGLLAGFSSLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799028_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799029_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLG
GU799035_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
GU799036_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799041_SHBs_P-D      MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799042_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GU799045_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799049_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799053_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799056_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799058_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799059_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938308_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938309_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938310_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938311_SHBs_P-D      MENITSGLLGPVLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938312_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCRG
GU938316_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938317_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938318_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938319_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
GU938324_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938327_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938331_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GU938332_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938335_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938338_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938340_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GU938344_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938345_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938356_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGTTVCLG
GU938358_SHBs_P-D      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101101_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
HM101111_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101126_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229699_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229700_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
HM229701_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229702_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
HM229704_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229705_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229709_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229710_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
HM229714_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229715_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229717_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
HM229719_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229722_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229723_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
HM229729_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229739_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229740_SHBs_P-D      MENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229742_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229744_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229747_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229748_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
HM229750_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229751_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
HM229752_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229756_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229757_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229760_SHBs_P-D      MENITSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGTTVCLG
HM229767_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348621_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348622_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348628_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348629_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348632_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348634_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348635_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
HM348636_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348640_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348653_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348655_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348658_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348669_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348673_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348677_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348679_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
HM348681_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348683_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348685_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
HM348691_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
HM348692_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348693_SHBs_P-D      MENITSGFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348695_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGTTVCLG
HM348699_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348707_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358280_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
HM358282_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
HM358284_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
HM358288_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358289_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
HM358291_SHBs_P-D      MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358298_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
HM358307_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358308_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
HM358309_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358310_SHBs_P-D      MENITSGFLGPLLVLQAGFFLMTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358316_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
HM358317_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
HM358324_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358326_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCPG
HM358331_SHBs_P-D      MENITSRLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358336_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358337_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM439434_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
HM750153_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGTTVCLG
HM750154_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185213_SHBs_P-D      MESTASGFLGPLLVLQAGFFLSTRILTIPKSLDSWRTSLNFLGGTTVCLG
HQ185214_SHBs_P-D      MESTASGFLGPLLVLQAGFFLSTRILTIPKSLDSWWTSLNFLGGTTVCLG
HQ185215_SHBs_P-D      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
HQ185216_SHBs_P-D      MESTASGPQGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFPGGTTVCRG
HQ185217_SHBs_P-D      MESTASGPLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFPGGTTVCLG
HQ185218_SHBs_P-D      MESIPSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185219_SHBs_P-D      MESIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185220_SHBs_P-D      MENISSGFLGPLPVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGTTVCLG
HQ185221_SHBs_P-D      MESIPSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185223_SHBs_P-D      MESIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185224_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185225_SHBs_P-D      MESITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185226_SHBs_P-D      MENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185227_SHBs_P-D      MENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185228_SHBs_P-D      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185230_SHBs_P-D      MESISSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
HQ185231_SHBs_P-D      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGTTVCRG
HQ185232_SHBs_P-D      MESIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ236015_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGTTVCLG
HQ641712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ641713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700439_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNYLGGTTXXLG
HQ700444_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700448_SHBs_P-D      MENITSXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700449_SHBs_P-D      MEXXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
HQ700455_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700467_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700472_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
HQ700473_SHBs_P-D      MENTXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700474_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700478_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700480_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700481_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700483_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700487_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700489_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700553_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ833465_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ833467_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
JF298902_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF439692_SHBs_P-D      MENITSGLLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439693_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439694_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439696_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGGTTVCLG
JF439699_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439700_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439702_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439703_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILAIPQSLDSWWTSLNFLGGTTVCLG
JF439707_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVYLG
JF439708_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439712_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439713_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLEGTTVCLG
JF439717_SHBs_P-D      MENITSGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439718_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTTVCLG
JF439719_SHBs_P-D      MENITSGLLRPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF754588_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCIG
JF754590_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754599_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
JF754601_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754602_SHBs_P-D      MENITSGFLGPLIVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754605_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JF754606_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JF754609_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754611_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGXTVCLG
JF754612_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754614_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754617_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
JF754618_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754619_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
JF754623_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754625_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
JF754626_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754629_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754631_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTGCLG
JF754632_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF754633_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754634_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTXPKSLDSWWTSLNFLGGTTVCLG
JF754635_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTQVLTIPQSLDSWWTSLSFLGGTTVCLG
JF815668_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF815673_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF815674_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040750_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JN040751_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN040753_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040754_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTECLG
JN040755_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLG
JN040756_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040757_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040758_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDWWWTSLNFLGGTTVCRG
JN040762_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JN040766_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040767_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040768_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040769_SHBs_P-D      MENITSGLLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040771_SHBs_P-D      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040773_SHBs_P-D      MENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JN040774_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040775_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040777_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040779_SHBs_P-D      MENITSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040782_SHBs_P-D      MENNTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGETTVCLG
JN040784_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN040786_SHBs_P-D      MENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN040787_SHBs_P-D      MENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN040788_SHBs_P-D      MENITSGFLRPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN040790_SHBs_P-D      MENITSGFLGPLLELQAGFFLLTRILTIPQNLDSWWTSLNFLGGNTVCLG
JN040793_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCRG
JN040795_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040799_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
JN040800_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTTPKSLDSWWTSLNFLGGTTVCLG
JN040801_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTTPKSLDSWWTSLNFLGGTTVCLG
JN040802_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040804_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
JN040805_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040806_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040807_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040808_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
JN040810_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040811_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIQQSLDSWWTSLNFLGGTTVCLG
JN040812_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGTTVCLG
JN040813_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JN040814_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040815_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040816_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040817_SHBs_P-D      MENITSGLLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040818_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JN040819_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040820_SHBs_P-D      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040822_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JN040824_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JN040827_SHBs_P-D      MENITSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040828_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
JN040830_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
JN132118_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRG
JN132120_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN132122_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225964_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225965_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225966_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGGTTVCLG
JN225967_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225968_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225969_SHBs_P-D      MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLXSWWTSLNFLGGTTVCLG
JN225971_SHBs_P-D      MENITSGFLGPXLVLQXGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLG
JN225972_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225973_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTXLNFLGGTTVCLG
JN225975_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
JN225977_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
JN225978_SHBs_P-D      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTACLG
JN225979_SHBs_P-D      MGNITSGLLXPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
JN225982_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225983_SHBs_P-D      MENITSGFLXPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JN225984_SHBs_P-D      MESIISGXLRPLLVLQXGFFLLTXILXIPQSLDSWWTSLNFLGGPTVCLG
JN225986_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
JN225987_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225989_SHBs_P-D      MXNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225990_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN225991_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225993_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225994_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225995_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
JN225996_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225999_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
JN226000_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226001_SHBs_P-D      MENITSGFLGPLLVLQAGXFLLTRILTIPXSLDSWWTSLNFLEGTTVCLG
JN226002_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JN226003_SHBs_P-D      MENITSGFLAPLFVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226004_SHBs_P-D      MENITSGFLGPLLVLQXGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226005_SHBs_P-D      MENITSGXLGPLLVLQAGXFLLTRILTIPXSLDSWWTSLNFXGGTTVCLG
JN226006_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
JN226010_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226011_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226012_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCPG
JN226013_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSXDSWWTSLNFLGGTTVCLG
JN226015_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226016_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226017_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
JN226018_SHBs_P-D      MENITSGFLGPLLVLQAGXFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226019_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN226021_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN226022_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGNTVCLG
JN226023_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226024_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
JN226025_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGEKTVCLG
JN226026_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226029_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGXTVCLG
JN226030_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226031_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGETTVCLG
JN226032_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSXDSWWTSLNFLGGTTVCLG
JN226034_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQNLDSWWTSLNFLGGTTVCLG
JN226035_SHBs_P-D      MENITSGXLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLXXLGGTTVCLG
JN226036_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226037_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSXDSWWTSLNFLGGATVCLG
JN226038_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGXTTVCLG
JN226070_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226072_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
JN226075_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226076_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226077_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226079_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226080_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226082_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
JN226083_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN226088_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
JN226089_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLG
JN226090_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226094_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226095_SHBs_P-D      MENITSGFLGPLLVLXAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JN226096_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226097_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226098_SHBs_P-D      METITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226099_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257148_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
JN257149_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257150_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPXSLDSWWTSLNFLGGTTVCLG
JN257153_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257159_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257160_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257162_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
JN257163_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257165_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN257176_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257178_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257183_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLXFLGGTTVCLG
JN257186_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257187_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257190_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257196_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257200_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257201_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN257203_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257209_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257211_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257214_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN558565_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRG
JN558566_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604120_SHBs_P-D      MENISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604139_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
JN604152_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLXFLGGNTVCLG
JN604161_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604170_SHBs_P-D      MESITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604175_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604196_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
JN604238_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604239_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604250_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604259_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604275_SHBs_P-D      MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
JN604301_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604312_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604318_SHBs_P-D      MENITSGFLGPLLVLQAGYFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
JN642126_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVSLG
JN642129_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642131_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPASLDSWWTSLNFLGGTTVCLG
JN642132_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642133_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JN642134_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642135_SHBs_P-D      MENITSGFLGPLFVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642136_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642138_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFVGGTTVCLG
JN642140_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642142_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642143_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642144_SHBs_P-D      MENITSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642145_SHBs_P-D      MENITSGFLGPLVVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642148_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642149_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN642150_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFVGGTTVCLG
JN642151_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642153_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642154_SHBs_P-D      MEKIISEHLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642157_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642158_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642159_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642161_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642162_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JN642163_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
JN642164_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642165_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN642166_SHBs_P-D      MESVTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN664912_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664913_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664919_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664922_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTGCLG
JN664926_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664927_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664931_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664932_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
JN664937_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664941_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
JN664947_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN664948_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JN688685_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688695_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688710_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JN688711_SHBs_P-D      MENFQSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN792905_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN792906_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN792912_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
JN983913_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983914_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983916_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983918_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
JN983920_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKVLTIPQSLDSWWTSLNFLGGTTVCLG
JN983921_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983922_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN983923_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983924_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCXG
JN983927_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983929_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983931_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983934_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983938_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFRGGTTVCLG
JN983939_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ073848_SHBs_P-D      MESISGGFLGPLLVLQPGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514316_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
JQ514317_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514318_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514319_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514320_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTAVCLG
JQ514321_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514322_SHBs_P-D      MENITLGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JQ514323_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JQ514324_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCRG
JQ514326_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JQ514328_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCRG
JQ514329_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JQ514330_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514331_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514332_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514333_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514335_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514336_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JQ514339_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514344_SHBs_P-D      MENIISGFLRPLLALQAGFSLLTKIHTIPQSLDSWWTSLNFLGGTTVCLG
JQ514346_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JQ514347_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514348_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514349_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514350_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514351_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514352_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JQ514353_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514355_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514356_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514357_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514359_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514361_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514362_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514363_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514364_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514365_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514368_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
JQ514370_SHBs_P-D      MENIKSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JQ514372_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514373_SHBs_P-D      MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514375_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514377_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514378_SHBs_P-D      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514379_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514428_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
JQ514429_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
JQ514430_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514431_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514439_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514442_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514443_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514444_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514445_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514451_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514453_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514456_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514459_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
JQ514461_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514463_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514465_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCRG
JQ514467_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
JQ514471_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JQ514473_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JQ514474_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514476_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514478_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JQ514480_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514483_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514484_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
JQ514485_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514487_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514488_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
JQ514489_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFPGGPPVCRG
JQ514491_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514492_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514494_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTPVCLG
JQ514495_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514496_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514499_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JQ514518_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514522_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JQ514523_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
JQ514527_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JQ514549_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514552_SHBs_P-D      MENITSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514554_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JQ687530_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGTTVCLG
JQ687531_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707476_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707483_SHBs_P-D      MENIISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707486_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707493_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707497_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707512_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707513_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707529_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707682_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707683_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707689_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707693_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707703_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811868_SHBs_P-D      MVNITSGFQGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JQ811869_SHBs_P-D      MENITSGFQGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811870_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSLWTSLNFLGESTVCRG
JQ811871_SHBs_P-D      MYDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811874_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811876_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811878_SHBs_P-D      MENITSGFHGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811879_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811886_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JQ811887_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811889_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811890_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JQ811891_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
JQ811895_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811897_SHBs_P-D      MENITSGFHGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEATVCRG
JQ811901_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811902_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGTTLCLG
JX036331_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGTTVCLG
JX036356_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090605_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTGILTIPQSLDSWWTSLNFLGGTTVCLG
JX090606_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090607_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090609_SHBs_P-D      MENITSGFLGPLLVLLAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
JX090610_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090611_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGETTVCLG
JX090613_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JX090615_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JX090616_SHBs_P-D      MENITSGFLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090617_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090619_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090621_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090622_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTMPKSLDSWWTSLNFLGGTTVCLG
JX090623_SHBs_P-D      MENITSGFLGPLLVLQAGFFSLTRILTMPQSLDSWWTSLNFLGGSTVCLG
JX090624_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090625_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
JX090628_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLG
JX090629_SHBs_P-D      MENITSGFLGPLLVLEAGFFLLTRILTLPHSLDSWWTSLNFLGGTTVCLG
JX090634_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGTTVCLG
JX090635_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090636_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090637_SHBs_P-D      MENITSGFLGPLIVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090640_SHBs_P-D      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGSTVCLG
JX090641_SHBs_P-D      MENITSGFLGPLIVLQAAFFLLTRILTIPQSLDSWWNSLNFLGGTTVCLG
JX090644_SHBs_P-D      MENITSGFLGPLLVLLAAFFLLTRILTTPQSLDSWWTSLNFLGGTTACLG
JX090646_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGTTVCLG
JX090647_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPVCLG
JX090658_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090660_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JX090663_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090665_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090667_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090670_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090671_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTAVCLG
JX090672_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
JX090676_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090677_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090678_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090680_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JX090681_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090682_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090683_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090685_SHBs_P-D      MEYITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090686_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090689_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090690_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
JX090697_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JX090698_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090700_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090701_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090703_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDWWWTSLNFLGGTTVCLG
JX090706_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLNFLGGTTVCLG
JX090712_SHBs_P-D      MENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLIFLGGTTVCLG
JX090715_SHBs_P-D      MENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090719_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090720_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090721_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCFG
JX096955_SHBs_P-D      MENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX125384_SHBs_P-D      MENITSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX125385_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX310726_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX310727_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JX310728_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX310729_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX310733_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRIXTIPQSLDSWWTSLNFLGGTTVCLG
JX310734_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
JX310735_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX470760_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849322_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849627_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162164_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162165_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162192_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162194_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KC162195_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KC162196_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162197_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162198_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162200_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
KC162205_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176098_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176100_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176103_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176116_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176119_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176129_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176132_SHBs_P-D      MENNTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176135_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176136_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KC176137_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176138_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176139_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGENTVCLG
KC176140_SHBs_P-D      MENITLGFLGTLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176141_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KC176146_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KC176148_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176149_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCVG
KC176153_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KC176155_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KC176156_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176159_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176160_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176161_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176162_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176163_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCRG
KC176164_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176165_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176169_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLSFLGGKTVCLG
KC176171_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176172_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774437_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KC774440_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875276_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875279_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875280_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875282_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875287_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875288_SHBs_P-D      MENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875289_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875290_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875293_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875297_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875299_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875302_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875304_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875305_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875314_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875316_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875324_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVYLG
KC875332_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875336_SHBs_P-D      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875337_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
KF061167_SHBs_P-D      MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF061168_SHBs_P-D      MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF061169_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF061170_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170739_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KF170744_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KF170749_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTMPKSLDSWWTSLSFLGGTTVCLG
KF170755_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KF170756_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KF170757_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170760_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLG
KF170761_SHBs_P-D      MENITSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170764_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170768_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSSLGGTTACLG
KF170770_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGTTVCLG
KF170772_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170774_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170778_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KF192830_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF192834_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471640_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
KF471641_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471642_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471644_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471646_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471647_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471653_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471654_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471655_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471656_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471657_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471660_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF476029_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF476030_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF584160_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTGCLG
KF679990_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF679994_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF679998_SHBs_P-D      MENITSGFLGPLLVLQAGFFLQTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF771923_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF771945_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF771948_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF771951_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF771961_SHBs_P-D      MESITSGFLGPLLXLQAGFFLLTKILTIPQSLDSWWTSLNFLGGNTVCLG
KF771964_SHBs_P-D      MENITSGPLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
KF779212_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779217_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779219_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779222_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLQLLGGTTVCLG
KF779225_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779230_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779289_SHBs_P-D      MENITSEALGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779296_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779340_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862567_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862575_SHBs_P-D      MENITSGFLAPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KF862577_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862581_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
KF862582_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGTTVCLG
KF862583_SHBs_P-D      MENITSGLLGPLLVLQAGFFXLTRILTIPASLDSWWTSLNFLGGTTVCLG
KF862584_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862591_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862593_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
KF862596_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
KF862597_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862598_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862603_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLXGTTVCLG
KF862605_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGETTVCLG
KF862610_SHBs_P-D      MENITSGXLXPLLXLXAGFFSLTRILTIPQSLDSWWTSLNXLGXTTVCRG
KF862617_SHBs_P-D      MENITSGFLGPLLVLQAGXFLLTRILTIPQSLDSXWTSLNFLGGTTVCLG
KJ174166_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KJ174167_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416141_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416142_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416144_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416145_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416146_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KJ416148_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416152_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416158_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416162_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416164_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416170_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
KJ416178_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
KJ416181_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGKTTECLG
KJ416184_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KJ416189_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KJ416196_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416197_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416198_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KJ416204_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KJ416205_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KJ416207_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416210_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416211_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416213_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416217_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416220_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KJ416221_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGETTVCLG
KJ416224_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KJ416225_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNSVCLG
KJ416227_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416228_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KJ416230_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ470885_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470889_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470896_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
KJ647350_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCLG
KJ647352_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLG
KJ647353_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLIFLGGTPVCLG
KJ647355_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLG
KJ843187_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958441_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958442_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958445_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958452_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958460_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958462_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM035536_SHBs_P-D      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KM035537_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM035538_SHBs_P-D      MENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM035539_SHBs_P-D      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108592_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KM108593_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108594_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108595_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLG
KM108596_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108599_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVGLG
KM108608_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108609_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KM108621_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM455853_SHBs_P-D      MENITSGFLGPLLELQAGFFLLTRILTIPQSLYSWWTSLNFLGGTTVSLG
KM524338_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524340_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
KM524344_SHBs_P-D      MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524346_SHBs_P-D      MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524348_SHBs_P-D      MENMSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524350_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524356_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KM524358_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KM577669_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM577671_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM590904_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM590905_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM590912_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KM590914_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KM590918_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM590920_SHBs_P-D      MENITLGSLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFQGGTTVCLG
KM606711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KM606745_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606762_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606771_SHBs_P-D      MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606790_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KM606818_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606823_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606836_SHBs_P-D      -ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606839_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606842_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606855_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606861_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606929_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606932_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KM606935_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606946_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
KM606955_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606958_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP090179_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KP165725_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165746_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP168419_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676078_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676079_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676081_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676088_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712806_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KP712810_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712811_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712819_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712820_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCXG
KP712821_SHBs_P-D      ----TSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712823_SHBs_P-D      ----TSGXLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712825_SHBs_P-D      ----TSGFLGPLLVLQAXFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
KP712827_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712830_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712831_SHBs_P-D      ----TSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712832_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712836_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712837_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
KP712838_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGTTVCLG
KP712843_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
KP712844_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712846_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712847_SHBs_P-D      ----TSGFLGHLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCRG
KP712850_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KP712853_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712856_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712859_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KP712860_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712864_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712866_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP995083_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997363_SHBs_P-D      VENITSGLLEPLHVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KP997364_SHBs_P-D      VENITSGLLEPLHVLQAGFSLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KP997377_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KP997452_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997460_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997480_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KP997516_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997521_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997531_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997600_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997617_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997621_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KP997628_SHBs_P-D      ---ITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KP997630_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997631_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGKTACLG
KP997639_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETIVCLG
KP997640_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETTVCLG
KP997642_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KP997645_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KP997648_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997660_SHBs_P-D      MENITSGFLGPLLGFQAGFFLLTRILTILQNLDLWWTSLNFLGGNTVCLG
KP997662_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLKGPTVCLG
KP997663_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997668_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997674_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997678_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997681_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997686_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997701_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KP997708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997709_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KP997711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997714_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997725_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997731_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997732_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KP997736_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997742_SHBs_P-D      MENITSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KP997744_SHBs_P-D      MENIPSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997745_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGNTVCLG
KP997748_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997749_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997753_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997756_SHBs_P-D      LENITSRFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997801_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997873_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KP997913_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KR139748_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KT201173_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
KT201174_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201175_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201176_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRIXTIPQSLDSWWTSLNFLGGTTVCLG
KT201178_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT201180_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201181_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
KT201182_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
KT201185_SHBs_P-D      MENISSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KT201186_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201187_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201188_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGENTVCLG
KT201191_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201192_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201194_SHBs_P-D      MENITSGFLGPLLVLQAGXFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201203_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201211_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201218_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201225_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201228_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201229_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
KT201230_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201231_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201233_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
KT201234_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201236_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201238_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201240_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201241_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201242_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201244_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201245_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201246_SHBs_P-D      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201247_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201248_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201250_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
KT201251_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLG
KT201254_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201255_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201256_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
KT201257_SHBs_P-D      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201258_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201259_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201260_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGTXVCLG
KT201261_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
KT201262_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201264_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201265_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201268_SHBs_P-D      MEXITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTXCLG
KT201270_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201272_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGTTVCLG
KT201276_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201278_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201281_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201282_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201283_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201284_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201285_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201287_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGXTTVCLG
KT201288_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201289_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
KT201290_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCXG
KT201291_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201294_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTAVCRG
KT201295_SHBs_P-D      MENITSGFLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGTTVCLG
KT201296_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201297_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201298_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
KT201299_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201300_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201302_SHBs_P-D      MENITSGPLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
KT201303_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201305_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201308_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGXTVCLG
KT201309_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201310_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201311_SHBs_P-D      MENXXSXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201312_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT201316_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT201317_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
KT201318_SHBs_P-D      MENIXSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT201319_SHBs_P-D      MEXISSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201320_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201321_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201322_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
KT201324_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201325_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201327_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201330_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
KT201331_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201332_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201333_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
KT201338_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201340_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201341_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201344_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201345_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201346_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
KT235590_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGDPVCLG
KT235591_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235595_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235601_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235612_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT355695_SHBs_P-D      MENIISGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTAVCLG
KT355697_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT355699_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT355702_SHBs_P-D      MENIISGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366465_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366491_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366494_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLG
KT366499_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366508_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366510_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
KT366511_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366518_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366526_SHBs_P-D      MENITSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366530_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366531_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNSVCLG
KT366533_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366534_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366537_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366543_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366550_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366557_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTFVCLG
KT366583_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTSVCLG
KT366585_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366586_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366603_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366609_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLNFLGGTTVCLG
KT366623_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366626_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KT366632_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFRGGTTVCLG
KT366633_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366634_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366639_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KT366640_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366641_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366644_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGTTVCLG
KT366649_SHBs_P-D      MEDITSGFLGPLLVLQAGFFLSTRILTIPQSLDSWRTSLNFLGGTTVCLG
KT366653_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366654_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366656_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366660_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366661_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366666_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366667_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366675_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366676_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366677_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLDFLGGTTVCLG
KT366678_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTLCLG
KT366679_SHBs_P-D      MEIITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366680_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366684_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366685_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366688_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366689_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366694_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366697_SHBs_P-D      MENITSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366705_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366706_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366709_SHBs_P-D      MENITSGFLGPLLVLQTGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366714_SHBs_P-D      MGNIISGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366718_SHBs_P-D      MENITSGFLGPLLVLQEGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366719_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366720_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT630610_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT630613_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT630629_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT749821_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT749827_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT749828_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT749845_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT852373_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668441_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668449_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU736924_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU736926_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU736927_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847472_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847488_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847491_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847493_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KU847509_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847513_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847519_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGXXTVCRG
KU847535_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847552_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847561_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847571_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
KU847574_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847579_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847593_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847596_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847599_SHBs_P-D      MEBITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847602_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
KU847618_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847619_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KU847623_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847624_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KU847735_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KX196208_SHBs_P-D      MENITSGFLGPLLVLPAGFFLLTRILTIPQRLDSWWTSLNFLGGTTVCLG
KX196209_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNVLGGTTVCLG
KX196213_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLASWWTSLNFLGGTTVCLG
KX196215_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196216_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196218_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCLG
KX196222_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196224_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196226_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196227_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTALNFLGGTTVCLG
KX196229_SHBs_P-D      MENITSGFLGRLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196233_SHBs_P-D      MENITAGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX276856_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX276857_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX276998_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KX302087_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302088_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KX302090_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302093_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302096_SHBs_P-D      MENITSGFLGPLLVLQAGYFLLTRILTIPRNLDLWWTSLSSLGGTTVCLG
KX302097_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302099_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLG
KX302100_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302103_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302111_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302112_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KX302115_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302117_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302119_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KX302120_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KX302121_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302125_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302128_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302132_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGNLVCLG
KX372129_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
KX372131_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLG
KX372133_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372134_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGNTVCLG
KX372137_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372139_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
KX372141_SHBs_P-D      MENITSGLLGPLLVLXAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372142_SHBs_P-D      MENITSGXLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372143_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KX372144_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372146_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372147_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGTTVCIG
KX372148_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGTTVCLG
KX372150_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372151_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372152_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
KX372153_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372154_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372156_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCXG
KX372158_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
KX372160_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372162_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372163_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
KX372168_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
KX372170_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372172_SHBs_P-D      MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372173_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372174_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KX372175_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372176_SHBs_P-D      MENITSGFLXPLLXLQAGFFLXTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372177_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372178_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLSFLGEHTVCLG
KX372179_SHBs_P-D      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372180_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372181_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372182_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372183_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372184_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372185_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372186_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372188_SHBs_P-D      MENILLKLLGPLLALQAGFFLLTRILTIPQSLDSLWTSLNFLGGTTVCLG
KX372189_SHBs_P-D      MENIKSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372190_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372191_SHBs_P-D      MENITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
KX372192_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372193_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KX372195_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
KX372196_SHBs_P-D      MEISTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372197_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTXPXSLDSWWTSLNFLGGTTVCLG
KX372200_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372202_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372203_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLG
KX372204_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
KX372205_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372206_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KX372207_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGNTVCLG
KX372208_SHBs_P-D      MENITSGXLGPLLVLQAXFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372211_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KX372214_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX621073_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
KX827291_SHBs_P-D      MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925286_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGNTVCLG
KX925287_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925288_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KX925289_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925290_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925293_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925298_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KX925299_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925302_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925303_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY225828_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY225830_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
KY225831_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY225834_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGTTVCLG
KY225837_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY225840_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY225841_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353874_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353878_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KY353880_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGTTVCLG
KY353894_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353933_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY629630_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660196_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660198_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660199_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDLWWTSLNFLGGTTVCLG
KY660203_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660206_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KY660210_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660212_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660213_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KY660216_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCPG
KY660217_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660218_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCRG
KY660222_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGPTVCLG
KY660223_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660224_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY697832_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY697835_SHBs_P-D      MENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY697838_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLG
KY809948_SHBs_P-D      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809950_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCIG
KY809952_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809953_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809954_SHBs_P-D      MENITSGFLRPLLALQAGFFLLTRILTMPQSLDSWWTSLNFLGGTTVCLG
KY809955_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KY809959_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809960_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
KY809963_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809967_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
KY809968_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809970_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KY809971_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KY809972_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
KY809973_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809975_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KY809976_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPXSLDSWWTSLNFLGGTTVCLG
KY809978_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KY809980_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809984_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809985_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809986_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809987_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809988_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809989_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCPG
KY809991_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809993_SHBs_P-D      MGNIISEFLRPLLXLQXXFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809994_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809996_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGETTVCLG
KY809999_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810000_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810001_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEATVCRG
KY810002_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810003_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KY810004_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810007_SHBs_P-D      MENITSGFLGPLLVLQAGFFLWTKILTIPQSLDSWWTSLNFLGGTTVCLG
KY810009_SHBs_P-D      MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810014_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810016_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810017_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810018_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810019_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
KY810021_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KY810022_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810023_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KY810024_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810027_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KY810028_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KY810029_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810030_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLG
KY810031_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810032_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810033_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KY810034_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
KY810037_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810038_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
KY810039_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KY810040_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
KY810041_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810042_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810043_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810044_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810045_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
L27106_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
LC519802_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC519808_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC519809_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC519810_SHBs_P-D      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC519816_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
LC519824_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LT717703_SHBs_P-D      MXNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LT992438_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LT992444_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
M32138_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
MF150685_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF488704_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF618343_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF618348_SHBs_P-D      MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925363_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
MF925366_SHBs_P-D      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MF925379_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MF925390_SHBs_P-D      MENITSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979155_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979156_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979157_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979163_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979165_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979166_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979167_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979168_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979170_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979171_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLXSWWTSLNFLGGTTVCLG
MF979173_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979174_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979176_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG383595_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCLG
MG383596_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
MG383597_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MG383601_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG383603_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGTTVCXG
MG383608_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MG383609_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG383611_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
MG383614_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
MG383618_SHBs_P-D      MENITSGFLGPLLGLLAGFFSLTKILTIPKSLDSWWTSLNFLGGTTVCLG
MG383619_SHBs_P-D      MENITSGFLGPLLVLQAXFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG383621_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTXPQSLDSWWTSLNFLGGTTVCLG
MG383622_SHBs_P-D      MENITSGFLGPLLVLQAXFFLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
MG383623_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
MG383624_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG877709_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG877718_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGXNTVCLG
MG877719_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGXNTVCLG
MG877720_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGXNTVCLG
MG877726_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MG877728_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MH272528_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272529_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272531_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272533_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTIVCLG
MH272534_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTFVCLG
MH272538_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTIVCLG
MH272539_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272542_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272543_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272544_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272545_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTLVCLG
MH272551_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272553_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272554_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272558_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272560_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MH272561_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTIVCLG
MH272566_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272567_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272568_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MH272571_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272572_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272574_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTSCLG
MH272577_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272579_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTLCLG
MH272583_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272584_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272588_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272590_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MH272591_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MH272592_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MH272595_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272600_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272602_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272603_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTILCLG
MH272605_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
MH272606_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272609_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272610_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272612_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272613_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272614_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272615_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272616_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272618_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272620_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272622_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272624_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCRG
MH272626_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272627_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272628_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272632_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MH272634_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
MH272635_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272643_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSSLGGTILCLG
MH272645_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272648_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272649_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272650_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLVSTTVCLG
MH272654_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272655_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272658_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272661_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272662_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGTTVCPG
MH272663_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272664_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272666_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MH272669_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272670_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MH272676_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTLVCLG
MH272677_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272678_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCRG
MH272680_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272686_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272687_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272688_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272690_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272694_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272696_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTLVCLG
MH272699_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272702_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272704_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272706_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272714_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272725_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272726_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272727_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272728_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272729_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTSACLG
MH272735_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272736_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272738_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTILCLG
MH464833_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464834_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGTTVCLG
MH464836_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464838_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MH464840_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464849_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724216_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724235_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724236_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724238_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGTTVCLG
MH724241_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724242_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGTTVCLG
MH724245_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MH724251_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH932714_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981280_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981282_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTGCLG
MH981284_SHBs_P-D      MENITSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
MH981292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
MH981293_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
MH981298_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981299_SHBs_P-D      MENITLGSLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFQGGTTVCLG
MH981300_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981303_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981305_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981306_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052947_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MK052948_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052949_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MK052950_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052951_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052952_SHBs_P-D      MENITSGFLGPLLVLQAGFLLLTRILTVPQSLDSWWTSLSFLGGTTVCLG
MK052953_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MK052954_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MK052955_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052956_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052959_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052961_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MK052963_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052972_SHBs_P-D      MENITSGFLGLLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MK052973_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK170925_SHBs_P-D      MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213855_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTYLNFLGGIIVCLG
MK213858_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213859_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213865_SHBs_P-D      MENITSGFLGPLLVLLAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213866_SHBs_P-D      MENITSGFLGPLLVLLAGFFWWTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213874_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213875_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213876_SHBs_P-D      MENITSGFLGTLLVLRAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213877_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213879_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213880_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213882_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPHTLDSWWTSLNFLGGTTVCLG
MK213883_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLIFLGGTTVRLG
MK295789_SHBs_P-D      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295791_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MK295801_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGTTVCLG
MK295804_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
MK295806_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLIFLGGTTVCLG
MK355500_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK355501_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK484603_SHBs_P-D      -ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK507913_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598636_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598637_SHBs_P-D      MENFTSGFLGPLVVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598638_SHBs_P-D      MEYITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598640_SHBs_P-D      MENITSGFLGPLLVFQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598642_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598644_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598647_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598649_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLHSWWTSLNFLGGTTVCLG
MK598650_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598655_SHBs_P-D      MENIRSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MK598659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598662_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MK598663_SHBs_P-D      MENITSGFLGPLLVFQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598665_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598667_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MK598669_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598670_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598672_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLNFLGGTTVCLG
MK598674_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCVG
MK598676_SHBs_P-D      MENITPGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598677_SHBs_P-D      MENITPGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598679_SHBs_P-D      MENITPGFLGPLVVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618422_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618424_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618429_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618431_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618432_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618433_SHBs_P-D      MENIRSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618434_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618435_SHBs_P-D      MEKITSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLNFLGGTTVCLG
MK618436_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGTTVCLG
MK693107_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK693108_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK693109_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MK840525_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK840535_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK840536_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975842_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975844_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975846_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975847_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MK975852_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCHG
MK975853_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFQGGTTVCLG
MK975854_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTMPQSLDSWWTSLNFLGGTTVCLG
MK975856_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975859_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975860_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MK975861_SHBs_P-D      MENITSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975863_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCPG
MK975865_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MN310706_SHBs_P-D      MENITSGFLGPLPVLRAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN310711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN310712_SHBs_P-D      MENITSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN310714_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN310715_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN476100_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN507836_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGTTVCLG
MN507837_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN585095_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN651982_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN758686_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN758691_SHBs_P-D      MENITSGYLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN758693_SHBs_P-D      MENITSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MN758698_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN758715_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN758720_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN758722_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN758723_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN839643_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN844881_SHBs_P-D      MENTTLGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN844882_SHBs_P-D      MENITSGSLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGSNVCLG
MT003227_SHBs_P-D      -ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT114169_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT114172_SHBs_P-D      MENITSGFLGPLLVLLAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT114173_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPLSLDSWWTSLNFLGGTTVCRG
MT579898_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT579901_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT579903_SHBs_P-D      MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT591276_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT591277_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGTTVCLG
MT591279_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT591281_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603388_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603389_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILKIPQSLDSWWTSINFLGGTTVCLG
MT603390_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603393_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603394_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGTTVCLG
MT603395_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603396_SHBs_P-D      MXNITSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCXG
MT603404_SHBs_P-D      MKNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW082640_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW234352_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLNFLGETPVCLG
MW234354_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW234358_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPTCPG
MW404228_SHBs_P-D      ---ITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW404229_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW455166_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGTTVCLG
MW601228_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601229_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIQQSLDSWWTSLNFLGGTTVCLG
MW601231_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601233_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601234_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601236_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601237_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601238_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGNTVCLG
MW601243_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGTTECLG
MW601249_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601254_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601255_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601256_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601259_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
MW601263_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601265_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601268_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601270_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLG
MW601271_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601273_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601275_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601276_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601277_SHBs_P-D      MENITSGLLRPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601278_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601279_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601280_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601281_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
MW601285_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601287_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLG
MW601288_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601289_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
MW601294_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601298_SHBs_P-D      MENITSGFLGPLLALQAAFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLG
MW601299_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601303_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601306_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601307_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601316_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
MW601318_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
MW601320_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601321_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601323_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601324_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601328_SHBs_P-D      MENITSGFLGPLLVSQAVFFLLTRILTIPKSLDSWWTSLSFLGETTVCRG
MW601329_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601330_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601332_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601333_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATVCRG
MW601335_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGTTVCRG
MW601337_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601339_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW675843_SHBs_P-D      MGSIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW847931_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLG
MW999632_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MW999636_SHBs_P-D      MENITSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MW999642_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MW999649_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999650_SHBs_P-D      MENITSGFLGPLLVLQAGXFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999657_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999658_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065404_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065407_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097626_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097627_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTXCLG
MZ097629_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097630_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097631_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097632_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097633_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
MZ097635_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MZ097636_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097639_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
MZ097641_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097642_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097644_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097645_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLG
MZ097646_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097647_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MZ097651_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097653_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGNTVCLG
MZ097654_SHBs_P-D      MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097656_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097658_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097659_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097660_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097661_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGNTVCLG
MZ097663_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097664_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLG
MZ097665_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097668_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097669_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097670_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097672_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097673_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097674_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097675_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097676_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
MZ097677_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097678_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097682_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPESLDSWWTSLNFLGGTTVCLG
MZ097683_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097684_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097685_SHBs_P-D      MENITSGFLGPLLVLQAAFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097688_SHBs_P-D      MENITSGFLGPLPVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097689_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLG
MZ097692_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097693_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097694_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097696_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
MZ097698_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNSLGGTTVCLG
MZ097699_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEKTVCLG
MZ097700_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MZ097701_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLSFLGGTPVCLG
MZ097712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCPG
MZ097713_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNILGGTTVCPG
MZ097715_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097718_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIXQSLDSWWTSLNFLGGTTVCLG
MZ097720_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097730_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
MZ097734_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097744_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097754_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097755_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
MZ097765_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGTTVCLG
MZ097771_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097779_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097782_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
MZ097783_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097784_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLG
MZ097787_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097790_SHBs_P-D      MXNITSGFXGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097792_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
MZ097794_SHBs_P-D      MENITSGFLGPLLVSQAVFFLLTRILTIPKSLDSWWTSLSFLGETTVCRG
MZ097795_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILIIPKRLDSWWTSLNFLGGTTVCLG
MZ097797_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097799_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097800_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097802_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097803_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097804_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097807_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097809_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097812_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097815_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MZ097816_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MZ097817_SHBs_P-D      MENITSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097818_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097820_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097823_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097824_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCIG
MZ097825_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKXLDSWWTSLNFLGGTTVCLG
MZ097827_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MZ097828_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
MZ097830_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097835_SHBs_P-D      MGSGTSGFLGPLLALQAGFFSLTKILTIPQSLDSWWTSLSFLGGTTVCLG
MZ097836_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPVCLG
MZ097837_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097840_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097842_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSTVCLG
MZ097843_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097844_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097847_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097848_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097851_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097852_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097853_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTAVCPG
MZ097856_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097857_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097858_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097861_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097863_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTXPQSLDSWWTSLNFLGGTTECLG
MZ097864_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097865_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MZ097866_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097869_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLRGNTVCPG
MZ097870_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097871_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097872_SHBs_P-D      MENITSGFLGPLLVLQAXFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MZ097874_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MZ097875_SHBs_P-D      MENITSGFLGPLLVLQAGCFLXTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097876_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097877_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097878_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097879_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGXNTVCLG
MZ097883_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ268050_SHBs_P-D      -ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ958806_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCPG
MZ958810_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPVCLG
MZ958811_SHBs_P-D      MENITSGPLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
MZ958812_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143467_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143470_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143474_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
OK143476_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143490_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143496_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
OK998519_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK998522_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK998525_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK998527_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGGNTVCLG
OM025254_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTIVCLG
OM304312_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCPG
OM304313_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM304314_SHBs_P-D      MENIILEFLKPLLELQEGFFXLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM304315_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM304316_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
OM304317_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
OM304322_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM304323_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
OM304325_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
OM304327_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM333239_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM721311_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGTTVCLG
OM721316_SHBs_P-D      MENITSGFLRPLLVLQAGFSLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
ON529701_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
ON529704_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON529706_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTXCLG
ON585703_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
ON807001_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814656_SHBs_P-D      KENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814657_SHBs_P-D      KENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814661_SHBs_P-D      MDNITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814663_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLYSWWTSLNFLGGTTVCLG
ON814668_SHBs_P-D      MDNITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814673_SHBs_P-D      MENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153940_SHBs_P-D      MENITSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153941_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153943_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153947_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGTTVCLG
OP153954_SHBs_P-D      MENITSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153955_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153956_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPESLDSWWTSLNFLGGTTVCLG
OP153957_SHBs_P-D      MEDITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153964_SHBs_P-D      MENITSGFLGPLHVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
OP153966_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153967_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153968_SHBs_P-D      MENITSGFLGPLLVLQAGFLLLTRILTIPKGVDSWWTCLNVLGGTTACVG
OP153969_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153970_SHBs_P-D      MENITSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153971_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153973_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153978_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
OP153983_SHBs_P-D      MENITSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
OP153986_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153987_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153988_SHBs_P-D      MENFTSGFLGPLVVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153989_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGTTVCLG
OP153990_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGTTVCLG
OP153992_SHBs_P-D      MENITSGFLGPLLVLQAGCFLWTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153994_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153996_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP154000_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP154002_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP154003_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLNFLGGTTVCLG
OP255998_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
OP256000_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256001_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
OP256002_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256003_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDWWWTSLNFLGGTPVCLG
OP256004_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256006_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256010_SHBs_P-D      MXNIPSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGNTVCLG
OP256011_SHBs_P-D      MXNIPSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGNTVCLG
OP256012_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256014_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256017_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQCLDSWWTSLNFLGGTTVCLG
OP653502_SHBs_P-D      MKNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
OP687080_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR046671_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
OR123797_SHBs_P-D      MENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR123798_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR123799_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR123800_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
OR126893_SHBs_P-D      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR162375_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR188769_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR188771_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR467901_SHBs_P-D      MENIPPRVLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR487153_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR580950_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR737806_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR737807_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR769213_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR769214_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR905602_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR947659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR983337_SHBs_P-D      MENITPGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OY983051_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
U87737_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X59795_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X65258_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGTTVCLG
X75662_SHBs_P-D        MENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X80924_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X97848_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB078032_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB078033_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109475_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109476_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109477_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109484_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109485_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109486_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB109488_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB110075_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB116266_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB119251_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB119253_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB119254_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB205126_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB210821_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB210822_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB267090_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB471856_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB471857_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653878_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653879_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653882_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653884_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653885_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653889_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653892_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653894_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653895_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738894_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738895_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412382_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412408_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412437_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690471_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690472_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU159677_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414117_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414124_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594400_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594403_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594410_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594413_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594414_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594415_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594419_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594420_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594421_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594423_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594424_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594428_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295546_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295548_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295549_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183477_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ924652_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798974_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798989_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798991_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799001_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799002_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799006_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799008_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799013_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799016_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799017_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799023_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799026_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799034_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799037_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799044_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799051_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799054_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF815643_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664930_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514334_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514341_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514354_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514360_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514369_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514376_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514433_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514434_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514436_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514437_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514448_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514450_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514454_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514460_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514469_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514470_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514472_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514477_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514482_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514497_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514521_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514526_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514529_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514544_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514546_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514548_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514550_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514551_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090675_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090717_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX096956_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875310_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875312_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF679996_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF771938_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524347_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524352_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524353_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524354_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524355_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM590907_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KR905424_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT151620_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201328_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201329_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201336_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201337_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201339_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201342_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201343_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235596_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235597_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235607_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235610_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235613_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366495_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366496_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366506_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366509_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366637_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366638_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366683_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366686_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366687_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366691_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366702_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366703_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366704_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366707_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366710_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372187_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX827290_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX827301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353881_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC488706_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC519789_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC519793_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC519795_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925358_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925364_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925383_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925393_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG839212_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272556_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272707_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272718_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272722_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724217_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724223_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724231_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724244_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724246_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981285_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981286_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981287_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981288_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981290_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981291_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981295_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981296_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981297_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981302_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK295790_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK295805_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598666_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598671_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598673_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598675_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618418_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618419_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618420_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618421_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618426_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948375_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948388_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948392_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948393_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948400_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948401_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948402_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975841_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975843_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975845_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975848_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN507839_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN891830_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN905531_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT579900_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601274_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999652_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999653_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097750_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143489_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK998523_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814648_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814655_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814662_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153991_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP154001_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP154004_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256008_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256009_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256018_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP653501_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
Z35716_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB120308_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPVCLG
HM348652_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB222709_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB222711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB222713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB270537_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB493846_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB554016_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB554023_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB554024_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB555497_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561825_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561831_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561843_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB583680_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB786644_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF121240_SHBs_C-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF121241_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF214660_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF214661_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF229159_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ627224_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AM494742_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122553_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122554_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122557_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122558_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122568_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122589_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653814_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653815_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653816_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653818_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653825_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653827_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653828_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653829_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653831_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653832_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653833_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653834_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY661792_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY661793_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY721605_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY721606_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY721607_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY721608_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY721612_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738857_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738858_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738859_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738862_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738865_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738911_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738913_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738914_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738915_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738916_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738917_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY796030_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY796032_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412281_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412287_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412299_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412305_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412312_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412317_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412319_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412333_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412334_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412338_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412339_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412351_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412358_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412364_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412376_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412377_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412385_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412386_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412389_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412392_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412394_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412398_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412400_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412406_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412409_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412413_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412417_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412428_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412429_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412431_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412432_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412434_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412435_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF103275_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690474_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690475_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690476_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690478_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690479_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414106_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414107_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414108_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414109_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414110_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414112_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414113_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414135_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414141_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414143_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594382_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594396_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594397_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787436_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787440_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787442_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787446_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349220_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349228_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349229_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349230_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ622870_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692502_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692508_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692509_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692510_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692511_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692513_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692516_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692518_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692519_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692520_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692521_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692522_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692523_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692524_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692526_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692527_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692528_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692533_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692537_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692539_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ751383_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904399_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904412_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904415_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904418_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904420_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904421_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904424_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904435_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904439_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ904443_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FM200190_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FM200191_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FM200205_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295545_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295547_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN821456_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN821459_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN821474_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183470_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183478_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ353299_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ353300_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ353301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ353304_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ377589_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ477459_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486044_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486048_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486066_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486115_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486134_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486150_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486162_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486176_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486267_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486318_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486337_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486418_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486431_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486433_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486458_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486475_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486477_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486485_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486492_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486505_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486521_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486527_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486528_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486541_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486561_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486566_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486572_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486596_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486604_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486605_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486639_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486670_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486671_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486673_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486680_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486704_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486715_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486722_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486729_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ922001_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ922002_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ922003_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU079196_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456635_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456638_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456640_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456646_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456648_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456655_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456660_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456663_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456670_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456680_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456681_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798982_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798983_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799019_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799038_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938305_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938306_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938307_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938314_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938315_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938321_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938330_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938334_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938337_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938341_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938342_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938343_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938346_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938347_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938349_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938350_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938351_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938352_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938353_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938354_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938355_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938357_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938360_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938361_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938362_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938363_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938364_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101103_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101104_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101105_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101106_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101107_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101109_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101110_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229707_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229726_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229730_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229735_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229754_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229758_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229759_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229763_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229773_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229775_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348623_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348624_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348625_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348626_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348627_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348630_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348631_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348633_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348638_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348639_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348641_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348642_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348643_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348644_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348645_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348647_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348648_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348649_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348654_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348656_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348661_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348662_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348663_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348664_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348666_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348667_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348668_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348672_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348674_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348675_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348676_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348680_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348684_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348686_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348688_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348696_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348697_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348701_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348702_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348706_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348709_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348710_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348712_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348714_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358278_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358279_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358283_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358285_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358286_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358290_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358294_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358295_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358297_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358300_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358302_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358303_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358311_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358320_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358321_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358328_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358330_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358332_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358334_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358335_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358339_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750151_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750152_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750156_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ008866_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ008867_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ008868_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ236014_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ641711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700440_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700441_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700442_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700443_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700445_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700446_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700447_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700450_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700451_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700453_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700459_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700463_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700464_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700466_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700469_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700470_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700471_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700479_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700482_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700484_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700488_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700511_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ833468_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ833471_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754591_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754592_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754593_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754594_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754596_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754604_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754607_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754624_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754627_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754628_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF815676_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040752_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040761_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040765_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040778_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040783_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040785_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040792_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040794_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040826_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040829_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226071_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226086_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257151_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257155_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257169_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257171_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257179_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257182_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257185_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257193_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257194_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257205_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604174_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604206_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604263_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604265_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642130_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642147_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642167_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664920_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688683_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN792903_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN792904_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN792907_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN792908_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN792909_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN792910_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN792911_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983910_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983911_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983915_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983917_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983925_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983926_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983930_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983935_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983936_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983937_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514327_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514366_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514468_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514530_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514541_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090608_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090612_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090620_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090626_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090627_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090630_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090631_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090632_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090638_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090639_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090642_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090643_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090645_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090649_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090650_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090651_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090652_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090653_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090654_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090655_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090657_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090661_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090666_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090673_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090674_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090684_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090691_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090694_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090704_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090709_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090710_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090716_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090723_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX125386_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849582_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849594_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176083_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176088_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176092_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176099_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176102_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176118_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176126_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176128_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176133_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176134_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176144_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176145_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176147_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176150_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176151_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176167_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774436_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774460_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774462_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875277_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875283_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875286_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875295_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875330_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875331_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875340_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC885874_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170745_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170747_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170758_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170759_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170763_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170765_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170766_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170767_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170771_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170775_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170776_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471651_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471652_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471658_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF476028_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF584161_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF584162_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF584163_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF584164_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF584165_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF584166_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF679989_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779214_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862563_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862564_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862565_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF922432_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ174165_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416143_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416147_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416153_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416156_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416157_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416159_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416173_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416186_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416190_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416191_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416194_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416195_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416202_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416214_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416215_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416216_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416218_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416219_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416233_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416234_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958446_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108591_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108605_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108606_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108607_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108620_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM519455_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524339_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606744_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606753_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606754_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606756_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606758_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606760_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606761_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606764_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606767_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606776_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606796_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606848_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606867_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606892_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606897_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606898_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606902_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606967_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP090180_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP090181_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165622_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165686_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165689_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165743_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165787_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165792_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165798_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165816_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP322599_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP322600_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676076_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676077_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676080_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676084_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676086_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676092_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676096_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997657_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997995_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KR139747_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201189_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201190_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201193_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201195_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201201_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201202_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201204_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201205_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201207_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201208_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201209_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201210_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201214_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201215_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201217_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201220_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201227_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201235_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201237_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201243_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201266_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201269_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201273_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201274_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201279_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201280_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201304_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201313_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201315_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235589_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235594_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235605_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT347090_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT355694_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT355698_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366614_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366615_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366617_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366629_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366643_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366645_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366648_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366650_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366651_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366652_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366657_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366658_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366672_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366673_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366674_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366681_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366692_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366693_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366695_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366696_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366699_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847518_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847521_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847532_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847592_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX067174_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX067303_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX276999_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302086_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302091_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302092_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302094_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302098_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302101_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302102_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302104_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302107_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302110_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302114_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302116_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302122_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302126_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357622_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372130_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372132_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372136_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372138_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372155_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372157_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372161_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372164_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372166_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372167_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372171_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX827300_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925294_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY225832_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY225833_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY225835_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY225836_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353883_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353891_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353935_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY382412_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY382414_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY629634_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660211_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809947_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809956_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809957_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809962_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809964_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809965_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809974_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809979_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809981_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809982_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809990_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809995_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809997_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810005_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810008_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810011_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810015_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC365689_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LT992439_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LT992454_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
M12393_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG839211_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272535_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272536_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272540_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272541_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272557_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272559_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272569_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272570_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272573_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272575_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272585_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272617_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272625_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272630_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272646_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272647_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272657_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272671_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272672_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272682_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272695_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272703_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272721_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272730_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272731_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272733_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272737_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464831_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464832_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464837_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464839_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464843_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464845_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464847_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464853_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724214_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724215_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724220_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724221_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724224_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724225_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724227_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724228_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724229_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724230_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724234_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724237_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724248_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724252_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213857_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213860_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213861_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213862_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213870_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213893_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK295802_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK507910_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK507911_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK507912_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK507914_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK517520_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK517521_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK517522_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK517523_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598643_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598648_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598658_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618427_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618428_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK840526_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK840532_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK840534_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK840537_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN310705_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN310708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN310709_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN310710_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN310713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN507851_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN507852_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786340_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786341_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786344_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786348_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786350_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786356_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786360_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603391_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603392_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603397_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603399_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603401_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603402_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603403_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW234355_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW404223_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW404224_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW404225_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW404226_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601242_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601244_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601247_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601252_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601261_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601269_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601282_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601293_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601297_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601308_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601309_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601313_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601319_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601325_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601326_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601334_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW675897_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999631_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999637_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999638_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999639_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999640_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999641_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999643_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999645_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999647_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999651_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999655_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065397_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065398_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065399_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065400_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065405_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065406_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065409_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065421_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065422_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065423_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065424_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097625_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097634_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097640_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097648_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097650_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097657_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097666_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097671_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097679_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097686_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097695_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097705_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097707_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097709_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097725_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097727_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097731_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097736_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097741_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097756_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097764_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097768_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097776_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097785_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097786_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097788_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097789_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097796_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097805_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097821_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097833_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097841_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097860_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097868_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ958807_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK106296_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK106297_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK106299_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK998524_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM304306_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM304311_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM304318_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM721312_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM721313_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM721314_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON807007_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153942_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153944_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153946_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153950_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153951_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153953_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153959_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153961_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153962_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153974_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153998_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP154008_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP255999_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP687072_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP687073_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP687074_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP687079_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR176521_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR176522_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR983335_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR983336_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR983338_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OY983050_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
U87851_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X02496_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X65257_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
Y07587_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664918_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MK975857_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
AB119256_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
GU799043_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524341_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366522_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272636_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB119255_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MZ097867_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
AJ627223_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122594_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653855_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653856_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653858_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738888_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738889_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738890_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412320_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412322_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412378_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414122_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414123_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414125_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414126_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414129_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414139_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594399_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594418_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594430_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349205_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349208_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ709486_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ709492_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183485_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486071_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486262_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486503_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938333_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700512_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754597_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225980_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225981_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604295_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664939_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090618_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090679_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090688_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090693_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090696_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090699_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090718_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX096957_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849509_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849510_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF679995_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862568_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862569_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM577668_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM577670_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP322601_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KR905423_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU736925_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357638_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY697841_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK516278_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598660_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN905532_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601240_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601253_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999646_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097655_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097704_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097714_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097737_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097773_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097829_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097873_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM304307_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256007_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X72702_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X97849_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201293_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811867_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958465_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366498_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366500_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366501_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366502_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366512_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366513_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366514_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366515_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366520_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366523_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366535_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366536_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366538_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366539_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366540_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366541_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366542_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366544_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366545_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366546_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366547_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366548_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366549_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366551_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366552_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366553_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366554_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366555_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366556_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366558_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366559_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366560_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366561_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366562_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366563_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366564_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366565_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366566_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366567_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366569_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366570_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366571_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366572_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366573_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366574_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366575_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366576_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366577_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366578_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366579_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366580_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366581_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366582_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366584_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366587_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366588_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366590_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366592_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366593_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366604_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366605_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366606_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366607_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366608_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366610_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366611_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366612_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366613_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366630_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353871_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353872_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353893_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353899_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353936_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272684_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229721_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229731_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176095_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412311_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486129_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348670_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176168_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213867_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213889_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601331_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412410_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302124_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX520685_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979154_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979158_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979160_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979164_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272601_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065401_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OY983063_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122569_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122570_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653847_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349216_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799050_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348619_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348620_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348694_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754610_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257202_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090695_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090724_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201252_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372165_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY697830_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272660_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724232_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724233_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097681_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143479_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP687077_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB674407_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348665_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809977_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK541688_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW404230_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW404232_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486310_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561833_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561850_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AB561845_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
AB561847_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AF209398_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GQ486114_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GQ486186_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GQ486292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
HQ833470_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JX090633_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
JX090668_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KY629633_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KY810006_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KY810010_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MT821456_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MW601245_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MZ097728_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
ON585704_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
GU938328_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847510_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097849_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995818_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995826_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486565_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958456_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738869_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229762_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ236016_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257170_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176121_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201184_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302127_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809961_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809966_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097813_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412296_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040823_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372135_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358299_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983941_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416231_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY697836_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618441_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618443_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601322_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097743_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153960_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153999_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP154007_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412328_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412402_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358318_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358319_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ833469_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ927384_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606884_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810013_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999656_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122573_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349234_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486126_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486204_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486255_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486577_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799007_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229737_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229745_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229769_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229770_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348646_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176125_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606772_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606835_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606837_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606838_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272644_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601257_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601314_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999634_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097739_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ131956_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938320_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201213_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201216_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366655_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847633_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302131_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618437_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW404222_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601286_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097760_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP687071_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AM422939_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122551_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY122556_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738876_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738880_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738881_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738882_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ315776_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU686583_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349209_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ349214_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ205388_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486486_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799014_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101108_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101128_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225976_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257181_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604272_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604313_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664909_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664910_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664911_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664914_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664917_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664921_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664936_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN664938_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514325_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514340_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514342_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514440_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514441_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514481_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811872_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811877_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811892_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849504_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898697_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875275_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875278_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875281_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875284_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875285_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875291_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875298_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875300_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875313_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875317_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875318_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875319_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875320_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875321_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875333_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875334_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875335_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875342_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170746_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779224_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779228_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779229_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524345_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524349_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524361_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606703_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP090177_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP090178_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201172_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235604_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366519_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366594_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366595_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366596_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366597_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366598_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366599_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366600_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366601_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366602_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668433_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668434_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668435_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668436_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668437_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668438_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668439_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668442_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668445_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668446_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668447_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668448_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196210_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196217_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196221_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196230_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196234_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372199_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX827292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353900_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC595774_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC705462_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LR745788_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF618339_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF618340_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF618341_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF618342_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724218_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724219_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213856_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213888_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065427_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065428_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR580949_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
U91804_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
U91809_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
U91832_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
V01460_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
X75668_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738875_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811873_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898691_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898692_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AJ297881_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040809_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT963508_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272689_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601251_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097735_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486331_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW404227_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM721315_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP687075_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR819870_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ131122_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414116_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700513_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700514_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090702_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX096954_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875325_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875326_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862573_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201286_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT630618_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT630620_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372209_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598668_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786363_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK106300_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692512_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
HM229733_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KC176104_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416163_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416200_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416203_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416212_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416223_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416226_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416232_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT235586_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366616_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366662_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366663_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366664_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366665_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366668_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366669_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366671_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MK598651_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MK598657_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MW601267_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MW601291_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MZ097763_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MZ097832_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
OP153958_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
AY653817_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ991754_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ386590_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295515_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295516_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358338_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700454_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514543_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875292_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108597_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108598_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108604_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201219_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201253_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201314_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235606_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY225829_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999644_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412343_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412353_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412354_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF690480_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486434_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348700_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358304_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358305_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754595_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754600_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN225985_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642156_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983928_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849514_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416185_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416201_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470895_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847648_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372194_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX925300_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660209_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272576_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272578_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272581_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272607_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272611_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272621_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272633_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272652_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272656_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272673_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272681_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272683_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272685_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272692_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272693_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272700_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272710_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272717_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272732_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN758688_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601262_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601272_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601290_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097742_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097752_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486344_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601315_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097637_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097662_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097780_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097846_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR188768_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040770_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
GU456677_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
HM348687_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KF471649_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MW234350_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MW234351_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097690_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097702_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
OP153952_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
AY161155_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY161158_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY161160_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090656_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ304551_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
DQ486022_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWRTSLSFLGGNTVCLG
AY653822_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738885_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738886_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692505_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692506_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692507_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847598_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847611_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372213_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK840533_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295498_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700510_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660204_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809998_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG383616_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LT717702_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN891827_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN891828_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653866_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY653867_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594401_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594402_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594409_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594416_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594417_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594429_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594431_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594432_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX096958_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810026_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601266_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097747_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT579899_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814647_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814654_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875311_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594411_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU594412_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598664_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK998521_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353896_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183472_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
MH724247_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
EF690473_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738861_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229755_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898694_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676099_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT355703_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809949_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724226_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738874_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ131126_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ709475_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF771929_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779209_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
U91816_SHBs_P-D        MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514462_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF679997_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM590906_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM590913_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM590922_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235611_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
LC519814_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948374_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948379_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948386_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975866_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097859_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738904_SHBs_P-D      MENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
AY738910_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIQQSLDSWWTSLNFLGGTTVCLG
AY741795_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC113371_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC113375_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229743_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153993_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX898689_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ304550_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTTILTIPQSLDSWWTSLNFLGGTTVCRG
GQ486316_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486365_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229771_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229774_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348651_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358322_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358323_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM750155_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ700458_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF815665_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF815666_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF815670_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF815678_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF815679_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040780_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257172_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257173_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604278_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983933_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090707_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176166_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416188_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416209_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606709_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606812_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302118_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372149_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN507838_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN507853_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN758713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601232_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601239_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601302_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097723_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097774_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097810_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097819_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR188772_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ329357_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGTPVCLG
DQ336677_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ336683_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ336684_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
DQ336687_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLG
DQ336688_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLG
DQ336692_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLSFLGGNTVCLG
GQ486367_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU456647_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU798966_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229720_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229728_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229764_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229772_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348650_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358312_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358313_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090662_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090687_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090705_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176094_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176101_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176122_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176127_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416199_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108600_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108601_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606759_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201183_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809969_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272723_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK517524_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601295_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601305_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040821_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486172_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358293_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754608_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ205380_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938359_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524342_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464848_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997625_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176105_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052974_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU787443_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412411_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999648_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272598_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601283_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097757_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358329_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176158_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF414665_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601338_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201232_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ412420_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486404_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486405_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486499_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486554_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW675898_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ464173_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGNTVCLG
DQ871267_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
DQ871268_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
DQ995844_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514435_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514455_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514466_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514498_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995847_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995848_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995849_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995850_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995851_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995855_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995861_SHBs_P-D      MENITSGXLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995862_SHBs_P-D      MENITSGXLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938339_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358277_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040759_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997395_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN651985_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097839_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
DQ995846_SHBs_P-D      MENIISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
HM101127_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229734_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754615_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040797_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688678_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302108_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660205_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810036_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979162_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603398_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW234353_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601248_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065425_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065426_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097643_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097732_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM304324_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EF103281_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FM200197_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
HM348689_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KT201334_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
MH464854_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
EU414136_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357637_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097710_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU414138_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN891831_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601246_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MZ097624_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MZ097729_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
EU594427_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN891832_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201326_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514337_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779220_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810020_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981289_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH981304_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK295803_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975850_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975855_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097628_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN891829_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU799005_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN905528_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097855_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
EU939681_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183461_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486174_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229732_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348637_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348660_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358314_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358315_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040791_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040796_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983932_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX090708_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606702_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165636_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372159_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372212_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660219_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660220_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK840523_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999635_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097811_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP687078_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486513_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT821455_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN821458_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX357639_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FN295526_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK517518_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN688679_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464844_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692532_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692534_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
FJ692535_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF298901_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416208_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464841_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF170743_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601311_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486637_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183450_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183451_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183452_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183453_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183454_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183455_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183457_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183458_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183462_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183463_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183464_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183465_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183466_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183468_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
GQ183469_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486370_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201306_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097845_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183476_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183482_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ183483_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT235587_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514493_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514516_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811875_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811893_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN642146_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201323_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097717_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486112_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754622_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
GQ486208_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
OK143486_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603400_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486502_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097649_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514490_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486357_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN040781_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847741_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601327_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097793_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486376_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604189_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN604207_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG383606_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097772_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201275_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486586_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201263_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201267_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201277_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP165769_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GQ486547_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXTTVCLG
GQ486585_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257199_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416193_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108619_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676082_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676083_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676085_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676087_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676093_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676094_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676095_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786346_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786347_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786349_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786351_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786357_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786358_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786359_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226073_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849592_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097798_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348678_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416187_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ416192_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KY697850_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY697848_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPTVCLG
MZ097711_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353903_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF053178_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514343_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514515_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875315_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201226_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938322_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938325_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358287_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF618349_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348698_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226087_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849606_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF471650_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606801_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272587_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272720_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601300_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153945_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
GU938348_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176131_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660201_SHBs_P-D      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM101112_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065431_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065432_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601250_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176077_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
KC176078_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176079_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
HM229768_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176081_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774445_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774477_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT603387_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW234357_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176082_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176085_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176086_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176089_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176090_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302089_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
HM229725_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416229_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875328_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606840_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606851_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ958808_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229753_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176107_SHBs_P-D      MENITSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176123_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176110_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM229749_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KC176111_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
KC176113_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
HM229765_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176087_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176108_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176114_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176096_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KC176115_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097691_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176117_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF754603_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348659_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM348690_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358306_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN226009_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
JX849546_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
KF862566_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
KM606853_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACLG
HM358325_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HM358327_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTVCPG
HM358333_SHBs_P-D      MENITSRLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
HQ185222_SHBs_P-D      MESIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257152_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201197_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201198_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201199_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201200_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201249_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983912_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JF439695_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439715_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439716_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439704_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439705_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439706_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439709_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439710_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439711_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JF439701_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
KX067518_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809951_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097882_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM304310_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366700_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366701_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN983919_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN980199_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774444_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC774459_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF414660_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF679992_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF679993_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606752_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606859_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606868_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606931_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366497_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366507_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OM721310_SHBs_P-D      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN132123_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849508_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849521_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849522_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGGTTVCLG
JX849527_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849523_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849524_SHBs_P-D      MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLXSWWTSLNFLGGTTVCLG
JX849525_SHBs_P-D      MENITSGFLGPXLVLQXGFFLLTRILTIPQSLDSWWTSLXFLGGTTVCLG
JX849526_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849528_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTXLNFLGGTTVCLG
JX849529_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
JX849505_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
JX849506_SHBs_P-D      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTACLG
KF862592_SHBs_P-D      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTACLG
JX849507_SHBs_P-D      MGNITSGLLXPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
JX849511_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849512_SHBs_P-D      MENITSGFLXPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTTVCLG
JX849513_SHBs_P-D      MESIISGXLRPLLVLQXGFFLLTXILXIPQSLDSWWTSLNFLGGPTVCLG
JX849515_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCXG
JX849516_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862574_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849518_SHBs_P-D      MXNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849519_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JX849520_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849530_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862588_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849531_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849532_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
JX849533_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862602_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849536_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
KF862615_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
JX849537_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849538_SHBs_P-D      MENITSGFLGPLLVLQAGXFLLTRILTIPXSLDSWWTSLNFLEGTTVCLG
KF862589_SHBs_P-D      MENITSGFLGPLLVLQAGXFLLTRILTIPXSLDSWWTSLNFLEGTTVCLG
JX849539_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JX849540_SHBs_P-D      MENITSGFLAPLFVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849541_SHBs_P-D      MENITSGFLGPLLVLQXGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849542_SHBs_P-D      MENITSGXLGPLLVLQAGXFLLTRILTIPXSLDSWWTSLNFXGGTTVCLG
KF862606_SHBs_P-D      MENITSGXLGPLLVLQAGXFLLTRILTIPXSLDSWWTSLNFXGGTTVCLG
JX849543_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
KF862579_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCLG
JX849547_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849548_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862600_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849549_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCPG
JX849550_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSXDSWWTSLNFLGGTTVCLG
JX849552_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862578_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849553_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862607_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849554_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGTTVCLG
JX849555_SHBs_P-D      MENITSGFLGPLLVLQAGXFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862608_SHBs_P-D      MENITSGFLGPLLVLQAGXFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514553_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JX849556_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KF862570_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KP997734_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MH981281_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MK948395_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JX849558_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JX849559_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGNTVCLG
KF862601_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGGNTVCLG
JX849560_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849561_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
KF862604_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
JX849562_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGEKTVCLG
JX849563_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862587_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849566_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGXTVCLG
KF862586_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGXTVCLG
JX849567_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849568_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGETTVCLG
JX849569_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSXDSWWTSLNFLGGTTVCLG
KF862594_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPQSXDSWWTSLNFLGGTTVCLG
JX849571_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQNLDSWWTSLNFLGGTTVCLG
JX849572_SHBs_P-D      MENITSGXLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLXXLGGTTVCLG
KF862611_SHBs_P-D      MENITSGXLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLXXLGGTTVCLG
JX849573_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849574_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSXDSWWTSLNFLGGATVCLG
JX849575_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGXTTVCLG
JX849593_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
JX849591_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849590_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849587_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849586_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849597_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKTVCLG
JX849585_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KF862595_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JX849604_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGTTVCLG
JX849576_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLG
KF862576_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTECLG
JX849602_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849580_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862572_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849605_SHBs_P-D      MENITSGFLGPLLVLXAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
JX849578_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862571_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849579_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862580_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849584_SHBs_P-D      METITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862590_SHBs_P-D      METITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX849577_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF862585_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257195_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257161_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257166_SHBs_P-D      MENITSGXLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
JN257177_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257188_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JN257215_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC176084_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779382_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601336_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514519_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366642_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK295792_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ470894_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KJ470893_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097697_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065429_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFRGGTTVCLG
MZ065430_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFRGGTTVCLG
JN983940_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514374_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ811881_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514446_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
U87738_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514517_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514545_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
JQ514547_SHBs_P-D      MENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514452_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ514464_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958451_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958463_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810012_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707478_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707479_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707480_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707481_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707482_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707484_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707485_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707487_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707488_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707489_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707490_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707494_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707496_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707499_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707500_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707502_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707503_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707505_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707507_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707508_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256013_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707527_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707514_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707515_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707516_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707518_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707519_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707520_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707521_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707522_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707523_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707524_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707525_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707526_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707528_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707530_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153997_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707517_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707684_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707685_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707686_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707687_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707688_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707690_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707691_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707692_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707694_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707695_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707696_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707697_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707698_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707699_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707700_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707701_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707702_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707704_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707705_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JQ707706_SHBs_P-D      MENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598645_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGTTVCLG
KC012652_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162166_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162167_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162169_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162170_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162171_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162172_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162174_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162175_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162176_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162177_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162178_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162179_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162180_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162181_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162182_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162183_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162185_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162186_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162187_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162188_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162189_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162190_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162204_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162168_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162173_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162184_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY225842_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KC162201_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC162203_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272530_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097638_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM108603_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201307_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097880_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR188770_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196214_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875296_SHBs_P-D      MENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875329_SHBs_P-D      MENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196211_SHBs_P-D      MENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196228_SHBs_P-D      MENITSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875322_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875323_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196225_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196212_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875294_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875306_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875308_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875309_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196236_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KC875303_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196219_SHBs_P-D      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196231_SHBs_P-D      MDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX196220_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
KX196232_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTTVCLG
KF192831_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF192832_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK106256_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724249_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH724250_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779216_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779218_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779285_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779288_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779301_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779302_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779303_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779318_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779341_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779376_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KF779377_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606714_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606755_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606944_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606960_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606968_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372140_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272593_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW999654_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676098_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786362_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416149_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416150_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416151_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416161_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416165_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416166_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416167_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416169_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416171_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416172_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416176_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416177_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416180_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416182_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416222_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416154_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416155_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416168_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416174_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416175_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ416179_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353932_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958457_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KJ958469_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM524351_SHBs_P-D      MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948372_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948373_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948378_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
MK948380_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
MK948382_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948384_SHBs_P-D      MENITLGSLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFQGGTTVCLG
KM606852_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KM606862_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676090_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676091_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676097_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786342_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786354_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786355_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786361_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK106298_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786343_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786345_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP676089_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786352_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN786353_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP712824_SHBs_P-D      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP995100_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW601258_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KP997914_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201206_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201212_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT201222_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP687076_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143472_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366618_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366622_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366625_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366627_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366631_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366635_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366636_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY353873_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366524_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366525_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366527_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366528_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366529_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366532_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366568_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366589_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366591_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366713_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366715_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366716_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366717_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366646_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGTTVCLG
KT366647_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGTTVCLG
MW601312_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097778_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097884_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366670_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
KT366690_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KT366698_SHBs_P-D      MENITSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU668444_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KU847597_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598646_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX302123_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KX372145_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG383604_SHBs_P-D      MENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF925391_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213868_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213890_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097791_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY810035_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809983_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660195_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598661_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY660221_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGTTVCLG
KY660197_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
KY809992_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK998520_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP256019_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG839210_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGTTVCLG
MF979161_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MF979175_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MG877727_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTTVCLG
MH272642_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272653_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGNTVCLG
MH272665_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272716_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH272705_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MH464842_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097801_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948394_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948396_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGTTGCLG
MK948398_SHBs_P-D      MENITSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCRG
MK948389_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK948390_SHBs_P-D      MENITLGSLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFQGGTTVCLG
MK948391_SHBs_P-D      MENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK975849_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052958_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052960_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052966_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052971_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK052975_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK170926_SHBs_P-D      MENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213885_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTYLNFLGGIIVCLG
MK213878_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213887_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213886_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213892_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK213891_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT003226_SHBs_P-D      -ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ268048_SHBs_P-D      -ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ268049_SHBs_P-D      -ENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598639_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK598641_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618423_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLNFLGGTTVCLG
MK598678_SHBs_P-D      MENITPGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618425_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MK618430_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MN310707_SHBs_P-D      MENITSGFLGPLPVLRAGFSLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MT579902_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814646_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814650_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814652_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814653_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814658_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814664_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814665_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814667_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814669_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814671_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814649_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814670_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814651_SHBs_P-D      MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814666_SHBs_P-D      MEKITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR947660_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097722_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097726_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGTTECLG
MZ097733_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097738_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097746_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097748_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097749_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097753_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097759_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097761_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGNTVCLG
MZ097762_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
MZ097769_SHBs_P-D      MENITSGFLGPLLALQAAFFLLTRILTIPKNLDSWWTSLNFLGGTTVCLG
MZ097770_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097834_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097775_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097781_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETTVCRG
MZ097751_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ097808_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MW675844_SHBs_P-D      MGSIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
MZ065408_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OR176520_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXTVCLG
MZ097831_SHBs_P-D      MENITSGFLGPLLVLQAVFFLLTRILTXPQSLDSWWTSLNFLGGTTVCLG
MZ097881_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143468_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143473_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143480_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OK143488_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
ON814660_SHBs_P-D      KENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153965_SHBs_P-D      MENITSGFLGPLHVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGTTVCLG
OP153976_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153977_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP153985_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP154005_SHBs_P-D      MENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
OP154006_SHBs_P-D      MENITSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLNFLGGTTVCLG
X80926_SHBs_P-D        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
                                                                         

GU938313_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU155895_SHBs_P-D      QNSQSPTFNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLALLDY
AB048701_SHBs_P-D      QNSQSPTSNHSPTSCPPTCVGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB078031_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB090268_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB090269_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB090270_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB104709_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB104710_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB104711_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB104712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109478_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109479_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109480_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109481_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109482_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
AB109483_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILQLCLIFLLVLLDY
AB109487_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
AB119252_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB126581_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB188241_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB188242_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB188244_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205127_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205128_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFPFILLLCLIFLLVLLDY
AB210820_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB222710_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB222712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB222782_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB246347_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB246348_SHBs_P-D      QSSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270539_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270540_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270541_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270542_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270543_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270546_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270547_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270548_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270550_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB330367_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
AB330369_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB330370_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB555496_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB555500_SHBs_P-D      QNSQSPTSNHSPTCCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB555501_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561826_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561827_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561828_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
AB561829_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561830_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561832_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561834_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561835_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561836_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
AB561837_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561838_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561839_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561840_SHBs_P-D      QNSQSPTSNHSPTSCPXTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561842_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561844_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561846_SHBs_P-D      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561848_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561849_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
AB561851_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561852_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561853_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
AB561854_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
AB561855_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561856_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674403_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674405_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674406_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674408_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674409_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674411_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674413_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674414_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674415_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674416_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
AB674417_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674418_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674419_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674420_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674422_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674423_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
AB674424_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674425_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674426_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674427_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674428_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
AB674429_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB674431_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB786650_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF041251_SHBs_P-D      QNSQSPTSNHSPTSCLPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
AF043593_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF043594_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF061523_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF061524_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF061528_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
AF065110_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF065112_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFWLVLLDY
AF065117_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF065118_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF065119_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF083640_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF083641_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF121239_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
AF121242_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF134135_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF134136_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
AF134140_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF134141_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
AF134142_SHBs_P-D      QNSQSLTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF151735_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF208870_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF208872_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMSRRRFIIFLFILLLCLIFLLVLLDY
AF208874_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLPRFIIFLFILLLCLIFLLVLLDY
AF208877_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF209391_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF209394_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF209396_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF209401_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF214659_SHBs_P-D      QNSQSPTSNHSPTSCPPTRPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF229158_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF280817_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF369534_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF372622_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF372623_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ297861_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ297864_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ297865_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ297869_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ297871_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ297883_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ344116_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ517792_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ627215_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ627216_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ627218_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ627219_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ627220_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ627222_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494749_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCHIFLLVLLDY
AM494750_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM991999_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090452_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY090453_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
AY122552_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122555_SHBs_P-D      QNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122559_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122560_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122561_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122563_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122564_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122565_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122566_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122567_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122571_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122572_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122574_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122575_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122576_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122587_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122590_SHBs_P-D      QNSQSPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122591_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122592_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122593_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
AY161150_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY161153_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY161157_SHBs_P-D      QNSQSPASNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY161159_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY230116_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY233291_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY233292_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY233294_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY233296_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY236160_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY236162_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY236164_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY254524_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY254525_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653804_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653806_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653807_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653808_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653809_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFTIFLFILLLCLIFLLVLLDY
AY653810_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRSIIFLFILLLCLIFLLVLLDY
AY653811_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
AY653812_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653819_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653821_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653823_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653824_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653826_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653830_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653838_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653839_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
AY653840_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653841_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653842_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653843_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
AY653845_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
AY653849_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653850_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653859_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653862_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653868_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653870_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653871_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWTCLRRFIIFLFILLLCLIFLLVLLDY
AY653872_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653873_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653874_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653876_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653880_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653881_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653886_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653887_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738848_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
AY738849_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738850_SHBs_P-D      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738851_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
AY738852_SHBs_P-D      QNSQSPISNHSPTSCPSTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738853_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738854_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738855_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738856_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738860_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738863_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738864_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738866_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738867_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738868_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738870_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738871_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738872_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738873_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738877_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738878_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738879_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738883_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRCFIIFLFILLLCLIFLLVLLDY
AY738884_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738887_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRCFIIFLFILLLCLIFLLVLLDY
AY738891_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRCFIIFLFILLLCLIFLLVLLDY
AY738892_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738893_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738896_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738897_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738898_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738899_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738900_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738901_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738902_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738903_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLMVLLDY
AY738905_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738906_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738907_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738908_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738909_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738912_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY741794_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY741796_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY741797_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY741798_SHBs_P-D      QNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY796031_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY945307_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY999088_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ111986_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ131123_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ236128_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ299408_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFXLVLLDY
DQ299409_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ304547_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ304548_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ304549_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ315778_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ329356_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336674_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
DQ336675_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336676_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336678_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336679_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336680_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336681_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336682_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336685_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336686_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCSRRFIIFLFILLLCLIFLLGLLDY
DQ336689_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336690_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ336691_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412277_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLXILLLCLIFXLVLXDY
DQ412278_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412279_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412280_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412282_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412283_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412284_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
DQ412285_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412286_SHBs_P-D      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412288_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412289_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412290_SHBs_P-D      QDSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412291_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412292_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412293_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412294_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
DQ412295_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDF
DQ412297_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412298_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412300_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412302_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412303_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412304_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412306_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412307_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412308_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412309_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFHFILLLCLIFLLVLLDY
DQ412310_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412313_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
DQ412314_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
DQ412315_SHBs_P-D      QSSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412316_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412321_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412323_SHBs_P-D      QDSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412324_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412325_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412326_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412327_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDF
DQ412329_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412330_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412331_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412332_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412335_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412336_SHBs_P-D      QNSQSPTSNXSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412337_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412340_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412341_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412342_SHBs_P-D      QNSQSPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412344_SHBs_P-D      LNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412345_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412346_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412347_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412348_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412349_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
DQ412352_SHBs_P-D      QNXQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412355_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412356_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDF
DQ412357_SHBs_P-D      QNXQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412359_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412360_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412361_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412362_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412363_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412365_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412366_SHBs_P-D      QDSQSPTCSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412367_SHBs_P-D      QNSQSPTSNHSPTSCPPTCXGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412368_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412369_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
DQ412370_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412371_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412372_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412373_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
DQ412374_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412375_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412380_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412381_SHBs_P-D      QNSQSPTSNHSPTSCPXTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412383_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGFRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412384_SHBs_P-D      QNSQSPTSNHSPTSCPPTCXGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412387_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412388_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
DQ412390_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412391_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412393_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412395_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
DQ412396_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412397_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
DQ412399_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412401_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
DQ412403_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
DQ412404_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412405_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412407_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412412_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412414_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412415_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412416_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
DQ412419_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412421_SHBs_P-D      QNSQSPTSNHSPTXCPPTCPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
DQ412422_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
DQ412423_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412424_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412425_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412426_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412427_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
DQ412430_SHBs_P-D      QNSQSPTSXHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412433_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412436_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
DQ412438_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412439_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412440_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412441_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412442_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ459085_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464168_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGCRWVCLRRFVSFLFSLLLCLIFLLVLLDY
DQ464169_SHBs_P-D      ENSQSPTSNHSPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464170_SHBs_P-D      ENSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464172_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464174_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464175_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464176_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464177_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464178_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464181_SHBs_P-D      ENSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ464182_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ486021_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ486023_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILVLCLIFLLGLLDY
DQ486025_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ871265_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ871266_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ991752_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995809_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995810_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995811_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995812_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995814_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995815_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995817_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995819_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995820_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995821_SHBs_P-D      QNSQSPTSNHSPTXCPPTCXGYRWMCLRXFIIFLFILLLCLIFLLVLLDY
DQ995823_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995824_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIXLFILLLCLIFLLVLLDY
DQ995825_SHBs_P-D      QNSXSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995828_SHBs_P-D      QNAQSPTSNHSPTSCPPTGPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995830_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995831_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995832_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLXIXRLCLIFLLVLLDY
DQ995835_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
DQ995837_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
DQ995838_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
DQ995839_SHBs_P-D      RNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
DQ995840_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995841_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995842_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995845_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995852_SHBs_P-D      QNSXSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995853_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995854_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995856_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ995857_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
DQ995858_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF103276_SHBs_P-D      QQLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF103277_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCVRRLIIFLFILLLCLIFLLVLLDY
EF103279_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF103280_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF398036_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF547858_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690477_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690481_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690482_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690483_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU155893_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
EU346890_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414105_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414111_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414114_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414115_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414118_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414119_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414120_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414121_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414127_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414128_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414130_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414140_SHBs_P-D      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDX
EU414142_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594398_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594404_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594405_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594407_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594408_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594422_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594425_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPXYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594426_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594433_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594434_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787437_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787438_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787441_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787447_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU919197_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFTIFLFILLLCLIFLLVLLDY
EU921418_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU921419_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU939680_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349206_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349211_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349213_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
FJ349215_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349218_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349219_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349231_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349232_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349233_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349235_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ562338_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ621799_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ622444_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
FJ622867_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ622869_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692514_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692515_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692517_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692525_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692529_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692530_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692531_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692541_SHBs_P-D      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ709467_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDX
FJ709474_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ899792_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904395_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904402_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904410_SHBs_P-D      QNSQSPTSNHSPTSCPPTWPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904419_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
FJ904422_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904426_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904427_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904429_SHBs_P-D      QNSQSPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904431_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904432_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904433_SHBs_C-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904438_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904445_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FM200192_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FM200194_SHBs_P-D      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FM200212_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FM200213_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295500_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295501_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
FN295504_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295506_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295512_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
FN295513_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295514_SHBs_P-D      QNSQSPTSKHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
FN295517_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
FN295519_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295523_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295524_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295525_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDS
FN821457_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN821500_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ167301_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
GQ167302_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
GQ183448_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183449_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183456_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183459_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183460_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183467_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCVLRGIILLFLLLLCLIFLLVLLDY
GQ183471_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183473_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183474_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183475_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183479_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMRLRRFIIFLFILLLCLIFLLVLLDY
GQ183480_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183481_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ184322_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ205382_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ205384_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ205385_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ205389_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ325778_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ353298_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ353303_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ477452_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ477453_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ477455_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ477456_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ477457_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
GQ477458_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486036_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486037_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIXLFILLLCLIFLLVLLDY
GQ486039_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486040_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486041_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486042_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486043_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486045_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486046_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486047_SHBs_P-D      QNSQSPTSNHSPTSCPPTCXGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486049_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486051_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486052_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486053_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486054_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIXLFILLLCLIFLLVLLDY
GQ486055_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486056_SHBs_P-D      QBSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486058_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486059_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486060_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486064_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486065_SHBs_P-D      QNSQXPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486067_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486068_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486069_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486070_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486072_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486073_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486074_SHBs_P-D      QNSQSPTSNHSPTSCPPTCXGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486075_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486078_SHBs_P-D      QNSQSPTSNHSPTYCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486080_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486085_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486086_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486087_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIXLFILLLCLIFLLVLLDY
GQ486088_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486094_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486097_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486098_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486099_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486100_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486102_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486105_SHBs_P-D      QNSQXPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486108_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486109_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486110_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486111_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486113_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486117_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486118_SHBs_P-D      RNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486124_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486125_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486127_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486128_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486132_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486133_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486135_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486136_SHBs_P-D      QNSQSXTSKHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486137_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486138_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486142_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
GQ486144_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486145_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486146_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486147_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486152_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486154_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486157_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486158_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486160_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486163_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486164_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486166_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486167_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486168_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486169_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILXLCLIFLLVLLDY
GQ486170_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486171_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486173_SHBs_P-D      QNSQSLTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486175_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486177_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486178_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486179_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486180_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486181_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486183_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486184_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486185_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486187_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486191_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486193_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486195_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486199_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFXLVLLDY
GQ486200_SHBs_P-D      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486201_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486202_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486206_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRXMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486207_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486210_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486212_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486214_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486215_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486217_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486218_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486220_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486221_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486224_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486229_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486230_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486231_SHBs_P-D      QNSQFPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDX
GQ486235_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486237_SHBs_P-D      QNSQSPTXNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486238_SHBs_P-D      QNSQSPTXNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486239_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486243_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486244_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486247_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486248_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486250_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486251_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486252_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486254_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486256_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486257_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486259_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
GQ486260_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486261_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486263_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486265_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486266_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486270_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486273_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486274_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486275_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486276_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486278_SHBs_P-D      QBSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486279_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486280_SHBs_P-D      QNSQSPTXXHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486281_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486282_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486283_SHBs_P-D      QNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486284_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486285_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486286_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRXFIIFLFILLLCLIFLLVLLDY
GQ486289_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486290_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486293_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486294_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486296_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486297_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486298_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486299_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486301_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486302_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486303_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486304_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
GQ486308_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486313_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486321_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486322_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486323_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLXFLLVLLDY
GQ486324_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDY
GQ486325_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486326_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486328_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486329_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486330_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486332_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486336_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486339_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486340_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFXLGLLDY
GQ486341_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486342_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486343_SHBs_P-D      QDSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486345_SHBs_P-D      QNSQSPTSNHSPTSCPXTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486346_SHBs_P-D      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILXLCLXFLLVLLDY
GQ486347_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
GQ486352_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486354_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486355_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486356_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486358_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486361_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486362_SHBs_P-D      QNSQSXTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486363_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486374_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486378_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486379_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486380_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486381_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486382_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486383_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486384_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486386_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486392_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
GQ486398_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486406_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRXFXIXLFILLLCLIFLLVLLDY
GQ486407_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486412_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
GQ486414_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486420_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486422_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486428_SHBs_P-D      QNSQSPTSNHSPTSCPXTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486429_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486446_SHBs_P-D      QNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486453_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILXLCLIFLLVLLDY
GQ486465_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486467_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486471_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFIXLLCLIFLLVLLDY
GQ486472_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486473_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486476_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486481_SHBs_P-D      QNTQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486483_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486484_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
GQ486487_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486488_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
GQ486489_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486496_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486504_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486506_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486507_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486517_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486520_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486525_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMXLXXFIIFLFILLLCLIFLLVLLDY
GQ486530_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486539_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486545_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486546_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486552_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486555_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
GQ486589_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486593_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486594_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486602_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
GQ486614_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486627_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486634_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486635_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486638_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486655_SHBs_P-D      QSSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
GQ486662_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486672_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486674_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486675_SHBs_P-D      QNSQSPTXNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486678_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486681_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
GQ486698_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486699_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
GQ486700_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLXFLLVLLDY
GQ486705_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486706_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486708_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
GQ486709_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
GQ486711_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486716_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486717_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
GQ486719_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
GQ486730_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486731_SHBs_P-D      QNSXSPTSNHSPTSCPPTCPGYRWMCLRXFIIFLFILLLCLIFLLVLLDY
GQ486735_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486738_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486745_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486746_SHBs_P-D      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486748_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486755_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486759_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486767_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486768_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMXLRRFIIFLFILLLCLIXLLVLLDY
GQ486769_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486771_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486773_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486774_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486781_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486785_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486798_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486806_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486808_SHBs_P-D      QNSQSPTSSHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486815_SHBs_P-D      QNSQSPTSNHSPTSCPXTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486818_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486820_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486822_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486826_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486827_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486842_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486844_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486845_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486846_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486848_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GQ486849_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486851_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486858_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486866_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486867_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ491108_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
GQ491110_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ922000_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
GQ922004_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ922005_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ995474_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU357846_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFVLLLCLIFLLVLLDY
GU456636_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456637_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456639_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456641_SHBs_P-D      QNSQSPTSNHSPTSSPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456642_SHBs_P-D      QNSQSPTSNHSLTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
GU456643_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456645_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456649_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456650_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456651_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456652_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456653_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
GU456654_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456656_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
GU456657_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
GU456658_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456659_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456661_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456662_SHBs_P-D      QNSQSPTSNHSPTSCPLTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456664_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456665_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456666_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456667_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456668_SHBs_P-D      QNSQSPTCSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456669_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456673_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456674_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456675_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456676_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456679_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456682_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU456683_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
GU456684_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798967_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798969_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
GU798971_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798972_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798980_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798985_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798988_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798995_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798997_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799000_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799003_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799012_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799018_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799021_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799022_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799024_SHBs_P-D      QNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799028_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799029_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799035_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799036_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799041_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
GU799042_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799045_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799049_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799053_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799056_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799058_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799059_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938308_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938309_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938310_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938311_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938312_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938316_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938317_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938318_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938319_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938324_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938327_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938331_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938332_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938335_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938338_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938340_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938344_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938345_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU938356_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLRDY
GU938358_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM101101_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM101111_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM101126_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229699_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229700_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229701_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229702_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229704_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229705_SHBs_P-D      QNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229708_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
HM229709_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229710_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229711_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229713_SHBs_P-D      QNSQSLTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229714_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229715_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229717_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229719_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229722_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229723_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229729_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229739_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229740_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229742_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
HM229744_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229747_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
HM229748_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229750_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229751_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229752_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229756_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229757_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229760_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM229767_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348621_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348622_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348628_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348629_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348632_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348634_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348635_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348636_SHBs_P-D      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348640_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348653_SHBs_P-D      QDSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348655_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348658_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348669_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348673_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348677_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348679_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348681_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348683_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348685_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348691_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
HM348692_SHBs_P-D      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348693_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348695_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348699_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348707_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358280_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358282_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
HM358284_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358288_SHBs_P-D      QNSQSLTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358289_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358291_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358292_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358298_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358307_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358308_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358309_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358310_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358316_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358317_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358324_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
HM358326_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358331_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDF
HM358336_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM358337_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM439434_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750153_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM750154_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185213_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185214_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
HQ185215_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185216_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185217_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185218_SHBs_P-D      QNSQSPTSDHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185219_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185220_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185221_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185223_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185224_SHBs_P-D      RNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185225_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185226_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185227_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185228_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185230_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185231_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ185232_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLWRFIIFLFILLLCLIFLLVLLDY
HQ236015_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ641712_SHBs_P-D      QNSQPPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ641713_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700439_SHBs_P-D      QNSQSPTSNHSPTSCPPTCXGYRXXXLRRFIIFLFILLLCLIFLLVLLDY
HQ700444_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700448_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700449_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700455_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700467_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700472_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700473_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700474_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700478_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700480_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700481_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700483_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700487_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700489_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ700553_SHBs_P-D      QNSQSPTSNHSPTSCPPTCXGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ833465_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HQ833467_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF298902_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMYLRRIIIFLFILLLCLIFLLVLLDY
JF439692_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFPFILLLCLIFLLVLLDY
JF439693_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439694_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439696_SHBs_P-D      QNSQSPTSNHSPTSCPPTRPGYRWMYLRRFIIFPFILLLCLIFLLVLLDY
JF439699_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439700_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439702_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439703_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFPFILLLCLIFLLVLLDY
JF439707_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439708_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF439713_SHBs_P-D      QNSQSPTSNHSPTSCTPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439717_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439718_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF439719_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JF754588_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
JF754590_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754599_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754601_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754602_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754605_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754606_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754609_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754611_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754612_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754614_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754617_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIICLFILLLCLIFLLVLLDY
JF754618_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754619_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754623_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754625_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754626_SHBs_P-D      RNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754629_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754631_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754632_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754633_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754634_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF754635_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF815668_SHBs_P-D      QNSQSTTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF815673_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF815674_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040750_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040751_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040753_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040754_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JN040755_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040756_SHBs_P-D      QNSQSPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040757_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040758_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040762_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040766_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040767_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040768_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040769_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040771_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040773_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040774_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040775_SHBs_P-D      QNSQSPTSNHSPTSCPPTCAGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JN040777_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040779_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040782_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040784_SHBs_P-D      QNSQSLTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040786_SHBs_P-D      QNSQSLTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040787_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040788_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040790_SHBs_P-D      QNSQSPTSNHSPTSCPPSCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040793_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040795_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040799_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040800_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040801_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040802_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040804_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040805_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040806_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040807_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040808_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
JN040810_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
JN040811_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040812_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JN040813_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040814_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040815_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JN040816_SHBs_P-D      QNSQSPTSNHSLTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JN040817_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JN040818_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040819_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040820_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040822_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040824_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040827_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040828_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN040830_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN132118_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
JN132120_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN132122_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225964_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
JN225965_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225966_SHBs_P-D      QNSQSPTSNHSPTSCPPTCRGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225967_SHBs_P-D      QNSQSPTSNHSPTSCPPTCRGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225968_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225969_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225971_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225972_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225973_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFXLLLCLIFLLVLLDY
JN225975_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225977_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225978_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225979_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
JN225982_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDY
JN225983_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225984_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFWLVLLDY
JN225986_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFXLLLCLIFLLVLLDY
JN225987_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225989_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLXLLDY
JN225990_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225991_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225993_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225994_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225995_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN225996_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLXILLLCLIFLLVLLDY
JN225999_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226000_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRXXIIFLFILLLCLIFLLVLLDY
JN226001_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226002_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDY
JN226003_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
JN226004_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226005_SHBs_P-D      QNSQSPTSNHXPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226006_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226010_SHBs_P-D      QNSQSPTFNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226011_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
JN226012_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226013_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226015_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226016_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226017_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFXLVLLDY
JN226018_SHBs_P-D      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFXLLLCLIFLLXLLDY
JN226019_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226021_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226022_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFXLVLLDY
JN226023_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226024_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226025_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226026_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226029_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226030_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226031_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226032_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226034_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFXFILLLCLIFLLVLLDY
JN226035_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
JN226036_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226037_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILXLCLIFLLVLLDY
JN226038_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226070_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
JN226072_SHBs_P-D      QNSQXPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226075_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226076_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226077_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFXLLLCLIFLLVLLDY
JN226079_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226080_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226082_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLXILLLCLIFLLVLLDY
JN226083_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226088_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226089_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDY
JN226090_SHBs_P-D      QNSXSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226094_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
JN226095_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226096_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226097_SHBs_P-D      QNSQSPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226098_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN226099_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257148_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257149_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257150_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257153_SHBs_P-D      QNSQSPTCSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257159_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257160_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257162_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257163_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257165_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257176_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257178_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCXRRFIIFLFILXLCLIFLLVLLDY
JN257183_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257186_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257187_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257190_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257196_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257200_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257201_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257203_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257209_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN257211_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILXLCLIFLLVLLDY
JN257214_SHBs_P-D      QNSQSXTSNHSPTSCPPTXPGYRWXCLRRFIIFLFILLLCLIFLLVLLDY
JN558565_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
JN558566_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604120_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604139_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604152_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604161_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604170_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604175_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604196_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604238_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
JN604239_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604250_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604259_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604275_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604301_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN604312_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIICLFILLLCLIFLLVLLDY
JN604318_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
JN642126_SHBs_P-D      KNSQSPTSNHSQTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
JN642129_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642131_SHBs_P-D      QNSQSPTSNHSPTSCPRTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642132_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
JN642133_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTSLLVLLDY
JN642134_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
JN642135_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642136_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642138_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPVYRWMCLRHFIIILFILLLCLIFLLVLLDY
JN642140_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFHFILLLCLIFLLVLLDY
JN642142_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
JN642143_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JN642144_SHBs_P-D      LNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642145_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642148_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JN642149_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642150_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642151_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642153_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642154_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JN642157_SHBs_P-D      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
JN642158_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642159_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642161_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642162_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642163_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642164_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642165_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN642166_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664912_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JN664913_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664919_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
JN664922_SHBs_P-D      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664926_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664927_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
JN664931_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
JN664932_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664937_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
JN664941_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664947_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664948_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIILLVLLDY
JN688685_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688695_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688710_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688711_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN688713_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792905_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792906_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN792912_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVVLDY
JN983913_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983914_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983916_SHBs_P-D      QNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983918_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983920_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983921_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983922_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983923_SHBs_P-D      QNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983924_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983927_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983929_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
JN983931_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983934_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN983938_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
JN983939_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ073848_SHBs_P-D      QNSQSATSNHSPTSCPPTCPGYRGMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514316_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514317_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514318_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514319_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514320_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514321_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514322_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514323_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514324_SHBs_P-D      QNSQSPTSNHSPTSCPPTCXGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514326_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514328_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514329_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514330_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514331_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514332_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514333_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514335_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMRLRRFIIFLFILLLCLIFLLVLLDY
JQ514336_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514339_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514344_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514346_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514347_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514348_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514349_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514350_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514351_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFITFLFILLLCLIFLLVLLDY
JQ514352_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514353_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514355_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514356_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514357_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514359_SHBs_P-D      QNSQSPXSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514361_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514362_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514363_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
JQ514364_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514365_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514368_SHBs_P-D      RNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514370_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514372_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514373_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514375_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514377_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
JQ514378_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514379_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514428_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514429_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514430_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514431_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514439_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514442_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514443_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514444_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514445_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514451_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514453_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514456_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514459_SHBs_P-D      QNSXSPTSNHSPTSCPPTXPGYRWMCLRXFXIFLFILLLCLIFLLVLLDY
JQ514461_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514463_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514465_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514467_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514471_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514473_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514474_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514476_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514478_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514480_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514483_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514484_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514485_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514487_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514488_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILQLCLIFLLVLLDY
JQ514489_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514491_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514492_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514494_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514495_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514496_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514499_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514518_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514522_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514523_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514527_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514549_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514552_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514554_SHBs_P-D      RNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ687530_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ687531_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707476_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707483_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707486_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707493_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707497_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707512_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707513_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707529_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRRMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707682_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707683_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707689_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ707693_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
JQ707703_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811868_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811869_SHBs_P-D      QNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811870_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811871_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811874_SHBs_P-D      QNWQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811876_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811878_SHBs_P-D      QNSQSPTSKHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811879_SHBs_P-D      QNSQSPTSNHSPTSCPPTCRGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
JQ811886_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811887_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811889_SHBs_P-D      QNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811890_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811891_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811895_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
JQ811897_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811901_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ811902_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX036331_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX036356_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090605_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090606_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090607_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLSILLLCLIFLLVLLDY
JX090609_SHBs_P-D      QNSQFPTSNHSLTSCPPTCPGYHWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090610_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090611_SHBs_P-D      QNSQSPTSNHSPTSCPLTCPGYRWMCLRRFIIFLFILMLCLIFLLVLLDY
JX090613_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
JX090615_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090616_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
JX090617_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090619_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090621_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090622_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090623_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFIQLICLILSLVLVDY
JX090624_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGFRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090625_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090628_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090629_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090634_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090635_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090636_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090637_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090640_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
JX090641_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090644_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090646_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090647_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
JX090658_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090660_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090663_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090665_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090667_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090670_SHBs_P-D      QNSQCPTSNHSPTSCPPICPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
JX090671_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090672_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090676_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090677_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLVY
JX090678_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
JX090680_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRSIIFLFILLLCLIFLLVLLDY
JX090681_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090682_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090683_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090685_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090686_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090689_SHBs_P-D      QNSQSPTSHHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090690_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
JX090697_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLICLLGLLDY
JX090698_SHBs_P-D      QNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090700_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
JX090701_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090703_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090706_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFLLLLCLIFLLVLLDY
JX090715_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLGY
JX090719_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090720_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090721_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCMRRFIIFLFILLLCLIFLLVLLDY
JX096955_SHBs_P-D      QNSQSPTTNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX125384_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
JX125385_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX310726_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
JX310727_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLAHLDY
JX310728_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDC
JX310729_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX310733_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX310734_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX310735_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX470760_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849322_SHBs_P-D      XNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX849627_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC162164_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC162165_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC162192_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC162194_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWICLRHFIIFLFILLLCLIFLLVLLDY
KC162195_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC162196_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC162197_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWICLRHFIIFLFILLLCLIFLLVLLDY
KC162198_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC162200_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC162205_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KC176098_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176100_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176103_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176116_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176119_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176129_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176132_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176135_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176136_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176137_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176138_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCFLLLCLIFLLVLLDY
KC176139_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176140_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
KC176141_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176146_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KC176148_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176149_SHBs_P-D      QNSQSPTCSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176153_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176155_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176156_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
KC176159_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176160_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176161_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176162_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176163_SHBs_P-D      QNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCHIFLLVLLDY
KC176164_SHBs_P-D      QNSQSPTSNHSPTSCPPTCAVYRWMCLRRFIIFLFFLLLCLIFLLVLLDY
KC176165_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176169_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176171_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC176172_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774437_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC774440_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875276_SHBs_P-D      QNSQSPTSNHSPTSCAPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875279_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875280_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875282_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVRLDY
KC875287_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875288_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875289_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875290_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875293_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875297_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875299_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875301_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875302_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875304_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875305_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875314_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875316_SHBs_P-D      QNSQSPTANHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875324_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875332_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875336_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875337_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF061167_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF061168_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF061169_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF061170_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170739_SHBs_P-D      QNSQSPTSNXSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170744_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170749_SHBs_P-D      QSSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170755_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170756_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170757_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170760_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170761_SHBs_P-D      QNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
KF170764_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170768_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170770_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170772_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170774_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF170778_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF192830_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KF192834_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KF471640_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471641_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471642_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471644_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
KF471646_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471647_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471653_SHBs_P-D      QNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471654_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471655_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471656_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471657_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471659_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF471660_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
KF476029_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF476030_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
KF584160_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF679990_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF679994_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLDLLDY
KF679998_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF771923_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF771945_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
KF771948_SHBs_P-D      QNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF771951_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLICLLVLLDY
KF771961_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
KF771964_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLGLLDY
KF779212_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779217_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779219_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779222_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779225_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779230_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779289_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779296_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF779340_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF862567_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF862575_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF862577_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF862581_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
KF862582_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
KF862583_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
KF862584_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDX
KF862591_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
KF862593_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KF862596_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF862597_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRXXIIFLFILLLCLIFLLVLLDY
KF862598_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF862603_SHBs_P-D      QNSXSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILXLCLIFLLVLLDY
KF862605_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF862610_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF862617_SHBs_P-D      QNSQSPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ174166_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ174167_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416141_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416142_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
KJ416144_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KJ416145_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416146_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416148_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLICLLVLLDY
KJ416152_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
KJ416158_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416162_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
KJ416164_SHBs_P-D      QNSQSPTSNRSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
KJ416170_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVFLDY
KJ416178_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVFLDY
KJ416181_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
KJ416184_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416189_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416196_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416197_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416198_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416204_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416205_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416207_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416210_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416211_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416213_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIISLFILLLCLIFLLVLLDY
KJ416217_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416220_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416221_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416224_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416225_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416227_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
KJ416228_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ416230_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470885_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470889_SHBs_P-D      QNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ470896_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ647350_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
KJ647352_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDF
KJ647353_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ647355_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ843187_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ958441_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ958442_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ958445_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ958452_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ958460_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KJ958462_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM035536_SHBs_P-D      QNSQSPTSKHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KM035537_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM035538_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLSILLLCLIFLLVLLDY
KM035539_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108592_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108593_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108594_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108595_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108596_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108599_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108608_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM108609_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
KM108621_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLSLIFLLVLLDY
KM455853_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KM524338_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLILLLLLLDY
KM524340_SHBs_P-D      QNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524344_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524346_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524348_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524350_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524356_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524358_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM577669_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
KM577671_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM590904_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KM590905_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KM590912_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM590914_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM590918_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLVDY
KM590920_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTSLLVLLDY
KM606711_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
KM606712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606745_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606762_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KM606771_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606790_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606818_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606823_SHBs_P-D      QNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606836_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KM606839_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606842_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
KM606855_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606861_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606929_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606932_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606935_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM606946_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
KM606955_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KM606958_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP090179_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP165725_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP165746_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP168419_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP676078_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP676079_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP676081_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP676088_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712806_SHBs_P-D      QNSQSPISNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712810_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
KP712811_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712819_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712820_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712821_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712823_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYXWMCLRRFIIFLFILLLCLXFLLVLLDY
KP712825_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
KP712827_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRXFIIFLFILLLCLIFLLXLLDY
KP712830_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDX
KP712831_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712832_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712836_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712837_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712838_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712843_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIXLFILLLCLIFLLVLLDY
KP712844_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712846_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712847_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIXLLVLLDY
KP712850_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCXTFLLVLLDY
KP712853_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712856_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712859_SHBs_P-D      QNSQFPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KP712860_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712864_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP712866_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP995083_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997363_SHBs_P-D      QNSRSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KP997364_SHBs_P-D      QNSRSPTSNHSPTSCPPICPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KP997377_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGPLDY
KP997452_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KP997460_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997480_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
KP997516_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997521_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997531_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997600_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997617_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997621_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997628_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997630_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997631_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997639_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997640_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997642_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997645_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997648_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
KP997660_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997662_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997663_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KP997668_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997674_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLXFLLVLLDY
KP997678_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KP997681_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997686_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997701_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KP997708_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997709_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997711_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997714_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997725_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997731_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997732_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997736_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997742_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997744_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997745_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KP997748_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997749_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997753_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997756_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997801_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KP997873_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KP997913_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KR139748_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201173_SHBs_P-D      QNSQSPTSNHSPTFCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDY
KT201174_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201175_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201176_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201178_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201180_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201181_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201182_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201185_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201186_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
KT201187_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201188_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
KT201191_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201192_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201194_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201203_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201211_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201218_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201225_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201228_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201229_SHBs_P-D      QNSQXPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLXLLDY
KT201230_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201231_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201233_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201234_SHBs_P-D      QNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201236_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201238_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201240_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201241_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201242_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201244_SHBs_P-D      QNSQSPTSNHSPTXCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201245_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201246_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201247_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201248_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201250_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201251_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201254_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201255_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201256_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201257_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
KT201258_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201259_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201260_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIXLFILLLCLXFLLVLLDY
KT201261_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201262_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
KT201264_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201265_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201268_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201270_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
KT201272_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201276_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201278_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201281_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201282_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201283_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201284_SHBs_P-D      XNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201285_SHBs_P-D      QNSQFPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201287_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201288_SHBs_P-D      QNSQSPTSXHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201289_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201290_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201291_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201292_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201294_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201295_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201296_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201297_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201298_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
KT201299_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201300_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201301_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201302_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIXLFILLLCLIFLLVLLDC
KT201303_SHBs_P-D      XNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201305_SHBs_P-D      QNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201308_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDX
KT201309_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201310_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201311_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201312_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201316_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201317_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201318_SHBs_P-D      QNSQSPTSSHSPTSCPQTCPGYRWMCLRRFIIXLFILLLCLIFLLVLLDY
KT201319_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201320_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201321_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201322_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRXIXFLFILLLCLXFLLVLLDY
KT201324_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201325_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201327_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201330_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201331_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201332_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201333_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201338_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201340_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201341_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201344_SHBs_P-D      QNSQSPTSNHSPTSCPXTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201345_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201346_SHBs_P-D      QDSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT235590_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT235591_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT235595_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT235601_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT235612_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT355695_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFITFLFILLLCLIFLLVLLDY
KT355697_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT355699_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT355702_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366465_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KT366491_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366494_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366499_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366508_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366510_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLQCLIFLLVLLDD
KT366511_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366518_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366526_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366530_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366531_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366533_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366534_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFPFILLLCLIFLLVLLDY
KT366537_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366543_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366550_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366557_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366583_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366585_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366586_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLRDY
KT366603_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFPFILLLCLIFLLVLLDY
KT366609_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366623_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366626_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366632_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366633_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366634_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366639_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366640_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366641_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFWLVLLDY
KT366644_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366649_SHBs_P-D      QNWQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366653_SHBs_P-D      QNSQSPTSNHSPASCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366654_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLISLLVLLDY
KT366656_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366659_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366660_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366661_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366666_SHBs_P-D      QNWQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366667_SHBs_P-D      QNSQFPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366675_SHBs_P-D      QNSQSPTSNHSPTPCPLTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366676_SHBs_P-D      LNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366677_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLGY
KT366678_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366679_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366680_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366684_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLSILLLCLIFLLVLLDY
KT366685_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366688_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366689_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFTIFLFILLLCLIFLLVLLDY
KT366694_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366697_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFPFILLLCLIFLLVLLDY
KT366705_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366706_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366709_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLPCLIFLLVLLDY
KT366711_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFWLVLLDY
KT366712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCFIFWLVLLDY
KT366714_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366718_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFWLVLLDY
KT366719_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLPCLIFWLVLLDY
KT366720_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFWLVLLDY
KT630610_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT630613_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT630629_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLALLDY
KT749821_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT749827_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT749828_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT749845_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT852373_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU668441_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU668449_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
KU736924_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736926_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU736927_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847472_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847488_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KU847491_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847493_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847509_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847513_SHBs_P-D      QNSQSPTSNHSPTSCPPTCXGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847519_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847535_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847552_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDX
KU847561_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847571_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847574_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847579_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847593_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLXFLLXLLDY
KU847596_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLLVLLDY
KU847599_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847602_SHBs_P-D      XNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLXILLLCLIFXLVLLDY
KU847618_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847619_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847623_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847624_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KU847735_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
KX196208_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX196209_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX196213_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX196215_SHBs_P-D      QNSQSPTSNQSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX196216_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVPLDY
KX196218_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX196222_SHBs_P-D      QNSQSPTSNDSATSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX196224_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX196226_SHBs_P-D      QNSQSPTSNHSPTSCPPNCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX196227_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX196229_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX196233_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX276856_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFXLLLCLXFLLVLLDY
KX276857_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX276998_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302087_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302088_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302090_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302093_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302096_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
KX302097_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVPLDY
KX302099_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302100_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302103_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
KX302111_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302112_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
KX302115_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302117_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KX302119_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
KX302120_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302121_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302125_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302128_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX302132_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFSLVLLDY
KX372129_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372131_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372133_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372134_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372137_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372139_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372141_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372142_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372143_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRXMCLRRFIIFLFILLLCLIFLLVLLDC
KX372144_SHBs_P-D      QNSQSPTSNHSPTYCPPTCPGYRWMCLRLFIIFLFILLLCLIFLLVLLDY
KX372146_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372147_SHBs_P-D      QNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372148_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372150_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372151_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372152_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
KX372153_SHBs_P-D      QNSQSPTSNHSPTCCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372154_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372156_SHBs_P-D      QNSQXPTSNHSPTSCPPXCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372158_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
KX372160_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372162_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372163_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLSILLLCLIFLLVLLDY
KX372168_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372170_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCHICLLVLLDY
KX372172_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372173_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KX372174_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372175_SHBs_P-D      PNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372176_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
KX372177_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372178_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372179_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372180_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372181_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLXLLDY
KX372182_SHBs_P-D      QNSQXPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
KX372183_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372184_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372185_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372186_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372188_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372189_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372190_SHBs_P-D      QBSQCPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLXLLDY
KX372191_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLXFLLVLLDY
KX372192_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372193_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372195_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
KX372196_SHBs_P-D      RNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372197_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372200_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372202_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372203_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372204_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372205_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCHIFLLVLLDY
KX372206_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
KX372207_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDY
KX372208_SHBs_P-D      QDSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372211_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372214_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX621073_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX827291_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX925286_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX925287_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
KX925288_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX925289_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX925290_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX925292_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX925293_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX925298_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX925299_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX925301_SHBs_P-D      QNSQFPTSNHSPTSCPPTCPGYRWMCLRRFIIFLSILLLCLIFLLVLLDY
KX925302_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX925303_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
KY225828_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY225830_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY225831_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY225834_SHBs_P-D      QNSHSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY225837_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY225840_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWICLRHFIIFLFILLLCLIFLLVLLDY
KY225841_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY353874_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY353878_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY353880_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY353894_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLNY
KY353933_SHBs_P-D      QNSQSPTSNHSPASCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY629630_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660196_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
KY660198_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660199_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660203_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660206_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660210_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660212_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KY660213_SHBs_P-D      QNSQSPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660216_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660217_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660218_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660222_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660223_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY660224_SHBs_P-D      QSSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
KY697832_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY697835_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY697838_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809948_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809950_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KY809952_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809953_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809954_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
KY809955_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809959_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLTFLLGLLDY
KY809960_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809963_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809967_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
KY809968_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809970_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809971_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809972_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809973_SHBs_P-D      QNSQSPTSNHSPTFCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809975_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809976_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809978_SHBs_P-D      QNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809980_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809984_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809985_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
KY809986_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809987_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809988_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809989_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
KY809991_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809993_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KY809994_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809996_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY809999_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810000_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810001_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810002_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810003_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810004_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810007_SHBs_P-D      QNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIICLCILLLCLIFLLVLLDY
KY810009_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810014_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGFRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810016_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810017_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810018_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810019_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810021_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810022_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810023_SHBs_P-D      QDSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810024_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810027_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810028_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810029_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
KY810030_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810031_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810032_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810033_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810034_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810037_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810038_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
KY810039_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810040_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810041_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810042_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
KY810043_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810044_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY810045_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
L27106_SHBs_P-D        QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC519802_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC519808_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC519809_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC519810_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC519816_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC519824_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT717703_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT992438_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LT992444_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
M32138_SHBs_P-D        QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF150685_SHBs_P-D      QNSQSPTSSHSPTSCPPTCPGYRWMSLRRFIIFLFILLLCLIFLLVLLDY
MF488704_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIIFLCLLDY
MF618343_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF618348_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925363_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925366_SHBs_P-D      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MF925379_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925390_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLLVLLDY
MF979155_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF979156_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF979157_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF979163_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF979165_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF979166_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF979167_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF979168_SHBs_P-D      QNLQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
MF979170_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF979171_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF979173_SHBs_P-D      QNLQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
MF979174_SHBs_P-D      QNSQSLTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF979176_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383595_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383596_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFXLLLCLIFLLVLLDY
MG383597_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383601_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383603_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383608_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRXFIXFLFILLLCLIFLLVLLDY
MG383609_SHBs_P-D      QNSQSPTXNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383611_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383614_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MG383618_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
MG383619_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDY
MG383621_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383622_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383623_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG383624_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877709_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877718_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877719_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877720_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG877726_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIXLLVLLDY
MG877728_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIXLLVLLDY
MH272528_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272529_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272531_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272533_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272534_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272538_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272539_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
MH272542_SHBs_P-D      KSAQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272543_SHBs_P-D      QNTQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MH272544_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272545_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272551_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272553_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MH272554_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272558_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272560_SHBs_P-D      QNSQSPTSNHSPTSCLPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272561_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272566_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272567_SHBs_P-D      QNSQSPTSSHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MH272568_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272571_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272572_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272574_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFIRRLGLISLWFRVLI
MH272577_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272579_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272583_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272584_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272588_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272590_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272591_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLLFLLVLLDY
MH272592_SHBs_P-D      QNSQSPTSNHSPTSCTLVCPGYRWMCLRRFIIFLFILLLCLIFEKVLLDY
MH272595_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272600_SHBs_P-D      QLSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272602_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272603_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272605_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272606_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272609_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272610_SHBs_P-D      QYTQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFSLVVLDY
MH272612_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272613_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272614_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MH272615_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272616_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272618_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272620_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272622_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
MH272624_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272626_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272627_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272628_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272632_SHBs_P-D      QNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272634_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272635_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272643_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272645_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272648_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272649_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272650_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272654_SHBs_P-D      QNSKSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272655_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272658_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272661_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272662_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272663_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLQRFIIFLFILLLCLIFLLVLLDY
MH272664_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272666_SHBs_P-D      QNSQSPTSNHSPTSCPPTCRGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272669_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272670_SHBs_P-D      QNSQSPTSNHSPTSCPFTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272676_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272677_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272678_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272680_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272686_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
MH272687_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272688_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLFILLLCLIFLLVLLDY
MH272690_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272694_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272696_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272699_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272702_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272704_SHBs_P-D      QKTQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLTLLLVLLDY
MH272706_SHBs_P-D      LFSKTPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTPLLVLLDY
MH272708_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272711_SHBs_P-D      HHSKSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272714_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272725_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272726_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272727_SHBs_P-D      QKTPSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLILLLVLLDY
MH272728_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
MH272729_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272735_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MH272736_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272738_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464833_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464834_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464836_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464838_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464840_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH464849_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH724216_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH724235_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH724236_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLALLDY
MH724238_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH724241_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
MH724242_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH724245_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
MH724251_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MH932714_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MH981280_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981282_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981284_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981292_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981293_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981298_SHBs_P-D      QNSQSRTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981299_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MH981300_SHBs_P-D      QNSQSRTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981303_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981305_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981306_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK052947_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK052948_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MK052949_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
MK052950_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
MK052951_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MK052952_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCPRRFIIFLFILLLCLIFLLVLLDY
MK052953_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MK052954_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MK052955_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MK052956_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MK052959_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
MK052961_SHBs_P-D      QNSQSPTSNYSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK052963_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MK052972_SHBs_P-D      QNSQSPTSNHSPTSCPPTCLGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK052973_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
MK170925_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDC
MK213855_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK213858_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MK213859_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK213865_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK213866_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK213874_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK213875_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCVRRFIIFLFILLLCLIFLLVLLDY
MK213876_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK213877_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK213879_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK213880_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK213882_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK213883_SHBs_P-D      QNSHAPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK295789_SHBs_P-D      QNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK295791_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK295801_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK295804_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK295806_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK355500_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFIPLLCLIFLLVLLDY
MK355501_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MK484603_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK507913_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598636_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598637_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598638_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598640_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598642_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598644_SHBs_P-D      QNSQSPTSNHSPTSCPPTSPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598647_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCHIFLLVLLDY
MK598649_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598650_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598655_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598659_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598662_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598663_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598665_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598667_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598669_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598670_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRCMCLRRFIIFLFILLLCLIFLLVLLDY
MK598672_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598674_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598676_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598677_SHBs_P-D      QNSQSPTSKHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598679_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618422_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618424_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MK618429_SHBs_P-D      QNSQSPTSNQSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618431_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618432_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618433_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618434_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618435_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618436_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK693107_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK693108_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK693109_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK840525_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK840535_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK840536_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MK975842_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975844_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975846_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975847_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
MK975852_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975853_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMYLRRFIIFLFILLLCLIFLLVLLDY
MK975854_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975856_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975859_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975860_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975861_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975863_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975865_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN310706_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
MN310711_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN310712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN310714_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN310715_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN476100_SHBs_P-D      QNSQSPTSKHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN507836_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN507837_SHBs_P-D      QNSQSPMSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN585095_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN651982_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN758686_SHBs_P-D      QNSQSPTCSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN758691_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN758693_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN758698_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN758715_SHBs_P-D      QNSQCPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MN758720_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN758722_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN758723_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN839643_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN844881_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN844882_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
MT003227_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT114169_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
MT114172_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT114173_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT579898_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT579901_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT579903_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
MT591276_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT591277_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT591279_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT591281_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MT603388_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT603389_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT603390_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT603393_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MT603394_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT603395_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
MT603396_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT603404_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW082640_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW234352_SHBs_P-D      QNFQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW234354_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW234358_SHBs_P-D      QNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MW404228_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW404229_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW455166_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601228_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601229_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601231_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601233_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601234_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLSVLLDY
MW601236_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601237_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601238_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601243_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601249_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601254_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601255_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601256_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601259_SHBs_P-D      QNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601263_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601265_SHBs_P-D      QNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601268_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MW601270_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLHY
MW601271_SHBs_P-D      QNSQSPTSNHSPTSCPPTCVGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601273_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MW601275_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601276_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601277_SHBs_P-D      QNSQSPTSNHSPTSCPLTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601278_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MW601279_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601280_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601281_SHBs_P-D      QNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601285_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLCILLLCLIFLLVLLDY
MW601287_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601288_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601289_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601294_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601298_SHBs_P-D      QNSQCPTSNHSPTSCPPICPGYPWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601299_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601303_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601306_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
MW601307_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601316_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601318_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601320_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601321_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601323_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
MW601324_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601328_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MW601329_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
MW601330_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601332_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601333_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MW601335_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601337_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MW601339_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW675843_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW847931_SHBs_P-D      QNSRSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999632_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MW999636_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
MW999642_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999649_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999650_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLXILLLCLIFLLVLLDY
MW999657_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999658_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065404_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ065407_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMYLRRFIIFLFILLLCLIFLLVLLDY
MZ097626_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
MZ097627_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097629_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097630_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097631_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097632_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MZ097633_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097635_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097636_SHBs_P-D      QDSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097639_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097641_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097642_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097644_SHBs_P-D      QDSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097645_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097646_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097647_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097651_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097653_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097654_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097656_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFXLVLLDY
MZ097658_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097659_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLADY
MZ097660_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
MZ097661_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097663_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097664_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097665_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097668_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDY
MZ097669_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097670_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLXFLLVLLDY
MZ097672_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097673_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097674_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097675_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097676_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097677_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097678_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097682_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097683_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRXIIFLFILLLCLXFLLVLLDY
MZ097684_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDC
MZ097685_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097688_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097689_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097692_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097693_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLALLDY
MZ097694_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MZ097696_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097698_SHBs_P-D      QNSQSPTCSHSPTSCPPTCPGYRWMCLRRXIIFLFILLLCLIFLLVLLDY
MZ097699_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097700_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097701_SHBs_P-D      QNSQSPTSKHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
MZ097712_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097713_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFWLVLLDY
MZ097715_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097718_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097720_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLXVLLDY
MZ097730_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
MZ097734_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097744_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097754_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097755_SHBs_P-D      QNSQSPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097765_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097771_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097779_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097782_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097783_SHBs_P-D      QNSQSPTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097784_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
MZ097787_SHBs_P-D      QNSQXPTSNHSPTSCPPTCTGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097790_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097792_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097794_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLLVLLDY
MZ097795_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
MZ097797_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097799_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097800_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097802_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097803_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097804_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097807_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
MZ097809_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097812_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDC
MZ097815_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097816_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMFLRRSIIFLFILLLCLIFLLVLLDY
MZ097817_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097818_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097820_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097823_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097824_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
MZ097825_SHBs_P-D      QBSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097827_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097828_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097830_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097835_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MZ097836_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097837_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097840_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097842_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIYLLVLLDY
MZ097843_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097844_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097847_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097848_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097851_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097852_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MZ097853_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLGLLDY
MZ097856_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILHLCLIFLLVLLDY
MZ097857_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097858_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097861_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097863_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097864_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRXFIXFLFILLLCLIFLLVLLDY
MZ097865_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097866_SHBs_P-D      QNSXSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097869_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097870_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097871_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097872_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097874_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097875_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
MZ097876_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MZ097877_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097878_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097879_SHBs_P-D      QNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097883_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ268050_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ958806_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ958810_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ958811_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLLVLLDY
MZ958812_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
OK143467_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
OK143470_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OK143474_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OK143476_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OK143490_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OK143496_SHBs_P-D      QNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OK998519_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLAN
OK998522_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OK998525_SHBs_P-D      QNSQSLTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OK998527_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM025254_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM304312_SHBs_P-D      LNSQSPTCSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM304313_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFTLLLCLICLLVLLDY
OM304314_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYHWMCLRRFIIFLFILLLCLIFLLVLLDY
OM304315_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM304316_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM304317_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM304322_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM304323_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLLVLLDY
OM304325_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM304327_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM333239_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM721311_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OM721316_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON529701_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON529704_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLFLLDY
ON529706_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON585703_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON807001_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
ON814656_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON814657_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON814659_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON814661_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLPCLIFLLVLLDY
ON814663_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON814668_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON814673_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153940_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153941_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLLVLLDY
OP153943_SHBs_P-D      QNSQSPTSNHSPTFCPPTCPGYRWMCLRRLIIFLFILLLCLIFLLVLLDY
OP153947_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDS
OP153954_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153955_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFXLVVLDY
OP153956_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153957_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153964_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153966_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCXRRSIXXLLILLVCLIFLLVLLDY
OP153967_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLLVLLDY
OP153968_SHBs_P-D      QNAQARTLNHSPTFCPTTWPGYRWMSLRSAIISLLMPLLCLILLGVILDL
OP153969_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMXXRRFIIFLFILLLCLIFLLVLLDY
OP153970_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFXLFLFILLLCLIFLLVLLDY
OP153971_SHBs_P-D      QNSQSPTSNHSPXXCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153973_SHBs_P-D      QNSQSPTSNHSPTSCPPPCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153978_SHBs_P-D      QNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153983_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
OP153986_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILQLCLIFLLVLLDY
OP153987_SHBs_P-D      QNSQSSTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153988_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153989_SHBs_P-D      QNSXAPTSNHSPTSCPPACPGYRWMCLRRSIIFLFILLLCLIFLLVLLDY
OP153990_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLLVLLAY
OP153992_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153994_SHBs_P-D      QNSQSPTCNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153996_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP154000_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP154002_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP154003_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP255998_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256000_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256001_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFFFILLLCLIFLLVLLDY
OP256002_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256003_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256004_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256006_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256010_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
OP256011_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLSLTFLLVLLAY
OP256012_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256014_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256017_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP653502_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP687080_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLLVLLDY
OR046671_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLXFLLXLLDY
OR123797_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR123798_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLLVLLDY
OR123799_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR123800_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR126893_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILRLCLIFLLVLLDY
OR162375_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR188769_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR188771_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR467901_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR487153_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR580950_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR737806_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR737807_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLLVLLDY
OR769213_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR769214_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR905602_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OR947659_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFSLVLLDY
OR983337_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OY983051_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
U87737_SHBs_P-D        QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X59795_SHBs_P-D        QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X65258_SHBs_P-D        QNSQSPTSNHSPTSCPPTCPGYRWMCLRGFIIFLFILLLCLIFLLVLLEY
X75662_SHBs_P-D        QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X80924_SHBs_P-D        QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
X97848_SHBs_P-D        QNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB078032_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB078033_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109475_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109476_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109477_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109484_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109485_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109486_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB109488_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB110075_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB116266_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB119251_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB119253_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB119254_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB205126_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB210821_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB210822_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB267090_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB471856_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB471857_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653878_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653879_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653882_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653884_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653885_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653889_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653892_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653894_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653895_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738894_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738895_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412382_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412408_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412437_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690471_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690472_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU159677_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414117_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414124_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594400_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594403_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594410_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594413_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594414_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594415_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594419_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594420_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594421_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594423_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594424_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594428_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295546_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295548_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295549_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183477_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ924652_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798974_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798989_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU798991_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799001_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799002_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799006_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799008_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799013_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799016_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799017_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799023_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799026_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799034_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799037_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799044_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799051_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GU799054_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JF815643_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JN664930_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514334_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514341_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514354_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514360_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514369_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514376_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514433_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514434_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514436_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514437_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514448_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514450_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514454_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514460_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514469_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514470_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514472_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514477_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514482_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514497_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514521_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514526_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514529_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514544_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514546_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514548_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514550_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JQ514551_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090675_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090711_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX090717_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
JX096956_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875310_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KC875312_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF679996_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KF771938_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524347_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524352_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524353_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524354_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM524355_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KM590907_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KR905424_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT151620_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201328_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201329_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201336_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201337_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201339_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201342_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT201343_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT235596_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT235597_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT235607_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT235610_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT235613_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366495_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366496_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366506_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366509_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366637_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366638_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366683_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366686_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366687_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366691_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366702_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366703_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366704_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366707_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366708_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KT366710_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX372187_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX827290_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KX827301_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
KY353881_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC488706_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC519789_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC519793_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
LC519795_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925358_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925364_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925383_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MF925393_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MG839212_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272556_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272707_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272718_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH272722_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH724217_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH724223_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH724231_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH724244_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH724246_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981285_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981286_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981287_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981288_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981290_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981291_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981295_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981296_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981297_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981301_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MH981302_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK295790_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK295805_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598666_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598671_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598673_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK598675_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618418_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618419_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618420_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618421_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK618426_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK948375_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK948388_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK948392_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK948393_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK948400_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK948401_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK948402_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975841_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975843_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975845_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MK975848_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN507839_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN891830_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MN905531_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MT579900_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW601274_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999652_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MW999653_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
MZ097750_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OK143489_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OK998523_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON814648_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON814655_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
ON814662_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP153991_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP154001_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP154004_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256008_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256009_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP256018_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
OP653501_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
Z35716_SHBs_P-D        QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB120308_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
HM348652_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB222709_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB222711_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB222713_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB270537_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB493846_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB554016_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB554023_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB554024_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB555497_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561825_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561831_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB561843_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB583680_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AB786644_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF121240_SHBs_C-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF121241_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF214660_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF214661_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AF229159_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AJ627224_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AM494742_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122553_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122554_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122557_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122558_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122568_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY122589_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653814_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653815_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653816_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653818_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653825_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653827_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653828_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653829_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653831_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653832_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653833_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY653834_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY661792_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY661793_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY721605_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY721606_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY721607_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY721608_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY721612_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738857_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738858_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738859_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738862_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738865_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738911_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738913_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738914_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738915_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738916_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY738917_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY796030_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
AY796032_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412281_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412287_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412299_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412301_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412305_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412312_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412317_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412319_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412333_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412334_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412338_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412339_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412351_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412358_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412364_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412376_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412377_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412385_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412386_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412389_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412392_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412394_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412398_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412400_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412406_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412409_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412413_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412417_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412428_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412429_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412431_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412432_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412434_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
DQ412435_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF103275_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690474_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690475_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690476_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690478_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EF690479_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414106_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414107_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414108_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414109_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414110_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414112_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414113_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414135_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414141_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU414143_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594382_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594396_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU594397_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787436_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787440_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787442_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
EU787446_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349220_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349228_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349229_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ349230_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ622870_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692502_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692508_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692509_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692510_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692511_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692513_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692516_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692518_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692519_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692520_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692521_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692522_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692523_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692524_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692526_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692527_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692528_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692533_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692537_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ692539_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ751383_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904399_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904412_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904415_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904418_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904420_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904421_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904424_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904435_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904439_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FJ904443_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FM200190_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FM200191_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FM200205_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295545_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN295547_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN821456_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN821459_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
FN821474_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183470_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ183478_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ353299_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ353300_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ353301_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ353304_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ377589_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ477459_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486044_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486048_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486066_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486115_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486134_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486150_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486162_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486176_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486267_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486318_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486337_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486418_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486431_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486433_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486458_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486475_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486477_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486485_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486492_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486505_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486521_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486527_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486528_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486541_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486561_SHBs_P-D      QNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDY
GQ486566_SHBs_P-D&n