HBVdb

Dataset for protein SHBs of genotype D

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                              : .               
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRF
  s    l           s   k     k         s   en   r                          y    
       x                                                                        
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                  .        .    
IIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSS-TTStGPCRTCTTpaQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFG
 x                  h        l        v s k  m tvr    f     i  l               a
                    r                 a        l      x                         
                                               i                                
                                                                                

       170       180       190       200       210       220       
....:....|....:....|....:....|....:....|....:....|....:....|....:..
   .                                     .                         
KFLWEWASARFSWLSLLVPFVQWFVGLSPTVWLSVIWMMWYWGPsLYsILSPFLPLLPIFFCLWVYI
        v      s        a    i   l ml       r cnt r  i      l   a  
                             x   x          n xrx    x             
                                            x fx                   
                                               t                   
© 1998-2022Legal notice