HBVdb

Dataset for protein HBc of genotype C

[Download (right click)] [Sequences] [Repertoires]

3925 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KP148472_HBc_P-C      MDIDPYKEFGASVELLSLFLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014360_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB014361_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
AB014362_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014363_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014364_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALHREALESPGHCT
AB014365_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014367_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB014369_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AB014371_HBc_P-C      MDIDPYKEFGASVELLS-FLPHDFFPSIRDLLDTASALYREALESPEHCS
AB014372_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014373_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014374_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014376_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
AB014377_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014378_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AB014379_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014381_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014382_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014383_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
AB014384_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014385_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014386_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014387_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014388_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014390_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB014391_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
AB014392_HBc_P-C      MDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYREALESPEHCS
AB014393_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESSEHCT
AB014394_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB014395_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014396_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014397_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014398_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB026813_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB042282_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB042283_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB042284_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLXTASALYREALQSPEHCS
AB042285_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPAVRDLLDTASALYLEALESPEHCS
AB049610_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPTIRDLLDTASALYREALESPEHCT
AB074047_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB074755_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESSEHCS
AB074756_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESSEHCS
AB105173_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYREALETPEHSS
AB105174_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLVDTASALHREALESPEHCS
AB106895_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB111112_HBc_P-C      MDIDPYKEFGASXELLS-FLPSDFFPSXRDLLDTASALYREALESPEHXS
AB111114_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB111116_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB111117_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB111118_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB111121_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB111122_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB111123_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB111124_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
AB111125_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
AB111946_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALFREALESPEHCT
AB112063_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALFREALESPEHCT
AB112065_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB112066_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB112348_HBc_P-C      MDIDPYKVFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB112408_HBc_P-C      MDIDPYKEFGASEELLS-FLPSDYFPSIRDLLDTASALYREALESPEHCS
AB112471_HBc_P-C      MDIDPNKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB112472_HBc_P-C      MDIDPNKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB113875_HBc_P-C      MDIDTYKEFGASVELLS-FMPSDFFPSIRDLLDTASALHREALESPEHCS
AB113878_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESQEHCS
AB115417_HBc_P-C      MDIDPNKEFGASVELLS-FLPSDFFPSMRDLLDTASALYREALESPEHCS
AB115418_HBc_P-C      MDIDPNKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB117758_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB176642_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSARDLLDTASALYREALESPEHCS
AB176643_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB182589_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHGS
AB195936_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195945_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AB195946_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195949_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195952_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195953_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB202071_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB202072_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB205124_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB205125_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB246346_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB250109_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB288026_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB300360_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTALALYREALESPEHCT
AB300361_HBc_P-C      MDIDPYKEFGGSVEPLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB300368_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB300372_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
AB300373_HBc_P-C      MDIDPYKEFGASVELLS-FLPHDFFPSIRDLLDTASALYREALESPEHCS
AB365451_HBc_P-C      MDIDPYKEFGASAELIS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367392_HBc_P-C      MDIDTYKEFGASVELLS-FLPPDFFPSVRDLIDTASALYREALESPEHHS
AB367395_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
AB367398_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367401_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367402_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367405_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AB367406_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AB367407_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367408_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB367410_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB367412_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367413_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELIDTASALYREALESPEHCS
AB367418_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB367420_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367421_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367422_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
AB367423_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYREALESPEHCS
AB367425_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367426_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AB367428_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB367430_HBc_P-C      MDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367431_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367432_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367433_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367434_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367435_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367802_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367803_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367804_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB471849_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB485809_HBc_P-C      MDIDPYKEFGASSELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB485810_HBc_P-C      MDIDPYKEFGASSELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB540583_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAXALYREALESPEHCT
AB540585_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHFT
AB554018_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB642095_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB642097_HBc_P-C      MDIDPYKEFGASVELLS-FLPXDFFPSIRDLLDTAAALYREALESPEHCS
AB644281_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHVS
AB670237_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREAXESPEHCS
AB670239_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670241_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AB670242_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670243_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670246_HBc_P-C      MDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYREALESPEHCS
AB670249_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670252_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670253_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670255_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AB670258_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670259_HBc_P-C      MDIDTYKEFGASVELLS-FLPADFFPSXRDLLDTATALYREALESREHCS
AB670260_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670261_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB670262_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB670263_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670264_HBc_P-C      MDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670265_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670266_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
AB670268_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670269_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670270_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYREALESPEHCS
AB670272_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYPEALESPEHCS
AB670273_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670274_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPQHCS
AB670275_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLVDTASALYREALESPEHCS
AB670276_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670277_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670278_HBc_P-C      MDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670279_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670281_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670285_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYXEALESPEHCS
AB670295_HBc_P-C      MDLDPYKEFGASAELVS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670297_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
AB670298_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESREHCS
AB670300_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670301_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670304_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCT
AB670306_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670308_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYREALESPEHCS
AB670309_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670310_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670311_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB697502_HBc_P-C      MDIDPYKEFGASLELLS-FLPQDFFPSVRDLLDTASALYREALESPEHCS
AB697510_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYREALESPEHCT
AB900099_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB900109_HBc_P-C      MDIDPYKEFGASSQLLS-FLPADFFPSVRDLLDTASALYGEALESPEHCS
AB900113_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AB900115_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPNIRDLLDTASALYREALESSEHCS
AB931170_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF182802_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF182803_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF182804_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
AF182805_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF223960_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF223961_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AF241410_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF241411_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF323463_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSVRDLLDTASALYREALESPEHCT
AF324084_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AF363961_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF384367_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF384371_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AF411408_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF411412_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AF458664_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF458665_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF461357_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF533983_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY167090_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY167091_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY167092_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY167096_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY167099_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY206376_HBc_P-C      MDIDPYKEFGASMELIS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AY206378_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
AY206381_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY206385_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY206386_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY206389_HBc_P-C      MDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYREALESPEHCS
AY206392_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY220699_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY220700_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY220702_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTAAALYREALDSPEHCS
AY247032_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY269099_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AY269140_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYRDALESAEHCT
AY306136_HBc_P-C      MDIGPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY596108_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY641558_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIQDRLDTASALYREALESPEHCS
AY641559_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY641562_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY641563_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
AY862869_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
D00630_HBc_P-C        MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTAFALHREALESPEHCS
D23681_HBc_P-C        MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
D23682_HBc_P-C        MDIDPYKEFGASVELVS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
D23684_HBc_P-C        MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
D28880_HBc_P-C        MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
D50517_HBc_P-C        MDIDPYKEFGASVELLS-FMPSDFFPSIRDLLDTASALYREALESPEHCS
D50520_HBc_P-C        MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
DQ089756_HBc_P-C      MDIDPYKEFGASVELLS-FLPNDFFPSIRDLLDTASALYREALESPEHCS
DQ089757_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
DQ089759_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
DQ089760_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089761_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
DQ089762_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089764_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089766_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089767_HBc_P-C      MDIDPYKEFGAXVELLS-FLPSDFFPSXRDLLDTASALYREALESPEHCS
DQ089768_HBc_P-C      MDIDPYKEFGASSELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
DQ089770_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089771_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPTIRDLLDTAAALYREALESPEHCT
DQ089772_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089773_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089775_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089776_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
DQ089777_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
DQ089778_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYREALESPEHCS
DQ089780_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089782_HBc_P-C      MDIDPYKEFGASVELLS-FWPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089784_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089785_HBc_P-C      MDIDPYKEFGASQELIS-FLPSDFFPTIRDLLDTASALYREALESPEHCS
DQ089786_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089787_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
DQ089788_HBc_P-C      MDIDPYKEFGASLELLS-FLPSDFFPSIRDLLETASALYREALESPEHCS
DQ089790_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089791_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
DQ089792_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
DQ089794_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
DQ089795_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089797_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
DQ089799_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089800_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089801_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089802_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089803_HBc_P-C      MDNDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089804_HBc_P-C      MDIDPYKEFGCSAQLLS-FLPSDFFPSIRDLLDTATALYGEALESPEHCS
DQ315782_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ361526_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ361534_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ377160_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFLSIRDLLDTASALYREALESPEHCS
DQ377162_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ377163_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ377164_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ377165_HBc_P-C      MDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ478885_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ478899_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
DQ478900_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
DQ478901_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
DQ536413_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ536414_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ922649_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ922651_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ975272_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYREALESPEHCS
DQ975274_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
DQ980549_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYREALESPEHCS
DQ980551_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
DQ986376_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
DQ993692_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EF137802_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EF137803_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
EF197911_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EF384201_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EF494377_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EF494379_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
EF536065_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306687_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALEPPEHCS
EU306719_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306722_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU410079_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU439005_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU439013_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLETASALYREALESPEHCS
EU439015_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU498227_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU522069_HBc_P-C      MDIDPYKEFGASVELLT-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU522071_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
EU547559_HBc_P-C      MDIDPYKEFGASPKLLS-FLPSDFFPSIHDLLYTASALYREALESPEHCS
EU547562_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU554536_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU554540_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTGSALYREALESPEHCS
EU554541_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEYCS
EU560438_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU560439_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU560440_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU562216_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYREALESPEHCS
EU570067_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU570073_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU579443_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU589336_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU670263_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU717212_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU717214_HBc_P-C      MDIDPYKEFGASRELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU717215_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU796069_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYREALESPEHCS
EU871970_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
EU871973_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
EU871974_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU871976_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU871980_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU872000_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCT
EU872001_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCT
EU872002_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCT
EU872004_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCT
EU872005_HBc_P-C      MDIDPYKEFGASRELLS-FLPSDFFPPVRDLLDTASALYREALESPEHCS
EU872008_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU872013_HBc_P-C      MDIDTYKEFGASVELLS-FLPADFFPSIRDLLDTASALYRETLESPEHCS
EU881996_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916210_HBc_P-C      MDIDPYKEFGASVVLLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916211_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916212_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916213_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYREALESPEHCS
EU916214_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916216_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTAFALHREALESPEHCS
EU916226_HBc_P-C      MDIDIYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916227_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASAPYREALESPEHCS
EU916233_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916234_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU919165_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU919169_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU939536_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939537_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU939538_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939539_HBc_P-C      MDIDPYKEFGASVELLS-FLPNDFFPSARDLLDTATALYREALESPEHCS
EU939540_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939541_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALKSPEHCS
EU939542_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU939544_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939548_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939552_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939553_HBc_P-C      MDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939554_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939556_HBc_P-C      MDIDTYKEFGASVELLS-FLPADFFPSVRDLLDTASALYREALESPEHCT
EU939557_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939558_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939562_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALKSPEHCS
EU939563_HBc_P-C      MDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939567_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
EU939568_HBc_P-C      MDIDHYKEFGASGELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
EU939569_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939570_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
EU939571_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU939573_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRELLDTASALYREALESPEHCS
EU939574_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU939576_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939579_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALEAPEHCS
EU939583_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939584_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939585_HBc_P-C      MDIDLYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
EU939586_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
EU939587_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAFALYREALESPEHCS
EU939588_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939590_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
EU939592_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939593_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939595_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939596_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
EU939597_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939599_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU939601_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESQEHWS
EU939603_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939605_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939607_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939609_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939611_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939612_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939615_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939617_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939625_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939641_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALHREALESPEXCT
EU939642_HBc_P-C      MDIDHYKEFGASVELLS-FLPLDFFPSIRDLLDTASALYREALESPEHCS
EU939643_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTAFALHREALESPEHCS
EU939644_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939647_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939648_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
EU939651_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939652_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939653_HBc_P-C      MDIDPYKEFGASAELIS-FLPNDFFPSIRDLLDTASALYREALESPEHCS
EU939655_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
EU939657_HBc_P-C      MDIDHYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
EU939658_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALETPEHCS
EU939659_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023566_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023567_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023589_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023625_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023640_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023645_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023651_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALFREALESPEHCS
FJ023652_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023655_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032338_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032346_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYREALESPEHCS
FJ032347_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYREALESPEHCS
FJ032351_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032355_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032356_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLGTASALYREALESPEHCS
FJ032359_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALFREALESPEHCS
FJ032360_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTATALYREALESPEHCS
FJ151413_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDLFPSIRDLLDTASALYREALESPEHCS
FJ386574_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386579_HBc_P-C      MDIDHYKEFGASVELLS-FLPLDFFPSIRDLLDTASALYREALESPEHCS
FJ386589_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ386594_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386595_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
FJ386596_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386598_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALXREALESPEHCS
FJ386602_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386603_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ386609_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALHREALESPEHCS
FJ386611_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386612_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
FJ386613_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386617_HBc_P-C      MDIDHYKEFGASVELLS-FLPFDFFPSIRDLLDTASALYREALESPEHCS
FJ386624_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386626_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386627_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386628_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ386630_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386631_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386632_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386638_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDXLDTASALHREALESPEHCS
FJ386640_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSVRDLLDTASALYREALESPEHCS
FJ386641_HBc_P-C      MDIDPYKEFGASXELLS-FLPSDFFPSXRDLLDTASALYREALESPEHCS
FJ386644_HBc_P-C      MDIDPYKEFGASVELLS-FLPFEFFLSIRDLLDTASALYREPLESPEHCS
FJ386645_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386647_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ386650_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ386651_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ386653_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386657_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386659_HBc_P-C      MDIDXYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386661_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
FJ386662_HBc_P-C      MDIDLYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYREALESPEHCS
FJ386663_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLIDTASALHREALESPEHCS
FJ386667_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386670_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
FJ386672_HBc_P-C      MDIDPYKEFGSSVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386673_HBc_P-C      MDIDTYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386677_HBc_P-C      MDIDPYKEFGASVELLS-FLPNDFFPSIRDLLDTASALYREALESPEHCS
FJ386679_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
FJ386685_HBc_P-C      MDIDXYKEFGASXELLS-FLPSDFFPSIRDLXDTASALYREALESPEHCS
FJ386689_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
FJ518810_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIQDLIDTASALYREALESPEHCS
FJ562220_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRELLDTASALYREALESPEHCS
FJ562221_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562225_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVQHLLDTASALYREALESPEHCS
FJ562228_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562230_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562232_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562238_HBc_P-C      MDIDLYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562239_HBc_P-C      MDIDLYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562241_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562242_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562243_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ562248_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562250_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYREALESPQHCS
FJ562251_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPTIRDLLDTASALYREALESPEHCS
FJ562252_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562255_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562256_HBc_P-C      MDLDTYKPFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562261_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562264_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPTIRDLLDTATALYREALESPEHCS
FJ562265_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYREALESPEHCS
FJ562266_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
FJ562270_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562272_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALHREALESPEHCS
FJ562273_HBc_P-C      MDIDTYKEFGASAELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
FJ562276_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562279_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562280_HBc_P-C      MDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562284_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
FJ562285_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562286_HBc_P-C      MDIDXYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562288_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
FJ562291_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
FJ562293_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562300_HBc_P-C      MDIDTYKPFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ562301_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ562304_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562306_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562308_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562324_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVQDLLDTASALYREALESPEHCS
FJ562326_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562327_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562329_HBc_P-C      MDIDPYKEFGAPVDIL-FFFPSDFFPSIQDLLDTAWPLYREALESPEHCS
FJ562333_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562334_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562335_HBc_P-C      MDIDPYKEFGASLQLLS-FLPADFFPSVRDLLDTAIALFREALESPEHCS
FJ562337_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALXSPEXCS
FJ715342_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715343_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715344_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715350_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715351_HBc_P-C      MDIDPYKEFGASAELLS-FLQSDFFPSIRDLLDTASALYREALESPEHCS
FJ715357_HBc_P-C      MDIDPYKEFGASVELLS-FLPSGFFPSIRDLLDTASALYREALESPEHCS
FJ715364_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715366_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715367_HBc_P-C      MDIDPYKEFGASVELLS-FVPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715372_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715375_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715376_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTTSALYREALESPEHCS
FJ715381_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715383_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715389_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPFIRDLLDTASALYREALESPEHCS
FJ715390_HBc_P-C      MDIDPYKEFGASAELLS-FLQSDFFPSIRDLLDTASALYREALESPEHCS
FJ715391_HBc_P-C      MDIDPYKEFGASAELLS-FLQSDFFPSIRDLLDTASALYREALESPEHCS
FJ715392_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEYCS
FJ715404_HBc_P-C      MDIDPYKEFGASVELPS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715406_HBc_P-C      MDIDPYKEFGASVELPS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715415_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ715421_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715422_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715424_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ751764_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ751765_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFSSIRDLLDTASALYREALESPEHCS
FJ751770_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787449_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787452_HBc_P-C      MDIDVYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787455_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSTRDLLDTASALYREALESPEHCS
FJ787456_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIQDLLDTASALYREALESPEHCS
FJ787457_HBc_P-C      MDIDPYKEFGASVELFS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787466_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787469_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787470_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787471_HBc_P-C      MDIDHYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787482_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALEAPEHCS
FJ787483_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALEAPEHCS
FJ787485_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTVSALYREALEAPEHCS
FJ787487_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSVRGLLDTASALHREALESPEHCS
FJ787488_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALHREALESPEHCS
FJ787489_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALHREALESPEHCS
FJ787490_HBc_P-C      MDIDPYKEFGASVELLS-FLPSGFFPSIRDLLDTASALYREALESPEHCS
FJ848339_HBc_P-C      MDIDTYKEFGASGELLS-FLPSDFFPSVRDLLDTASALHREALESPEHCS
FJ899761_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
FJ899768_HBc_P-C      MDIDTYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYREALESPEHCS
FJ899770_HBc_P-C      MDIDPYKEFGASGELLS-FLPSDFFPSIRELLDTASALYREALESPEHCS
FJ899771_HBc_P-C      MDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCL
FJ899774_HBc_P-C      MDIDPYKESGASVELLS-FLPSDFFPSIRDLLDTASALYREALEAPEHCS
FJ899777_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ899783_HBc_P-C      MDIDPYKEFGATAELLS-FLPSDFFPSIRDLLDTASALYREALESPKHCS
FJ899788_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ904423_HBc_P-C      MDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ184326_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTAFALHREALESPEHCT
GQ227692_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ227693_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYREALESPEHCS
GQ227694_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYREALESPEHCS
GQ227695_HBc_P-C      TDIDHYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYREALESPEHCS
GQ227696_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYREALESPEHCS
GQ227697_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ358153_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377518_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
GQ377526_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377543_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
GQ377545_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377552_HBc_P-C      MDIDPYKEFGGSEELLS-FLPSDLFPFIRDILDRGDALYREALECPEHCS
GQ377555_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
GQ377557_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
GQ377575_HBc_P-C      MDIDPYKEFRASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
GQ377583_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377586_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYREALESPEHCS
GQ377597_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377599_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
GQ377605_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377608_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPTIRDLLDTASALYREALESPEHCT
GQ377609_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
GQ377620_HBc_P-C      MDLDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377623_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHVS
GQ377628_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
GQ475318_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475320_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475324_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
GQ475325_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475326_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
GQ475336_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
GQ475337_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475341_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475343_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPPVRDLLDTASALYREALESSEHCS
GQ475344_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
GQ475351_HBc_P-C      MDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475355_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
GQ475356_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ855528_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ855541_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ855543_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ872210_HBc_P-C      MDIDPYKKFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924609_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924612_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924613_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924615_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924616_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924619_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
GQ924620_HBc_C-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYRDALESPEHCS
GQ924622_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924629_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924636_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924642_HBc_P-C      MDIDPYKEFGASAELLS-FLPNDFFPSMRDLLDTASALYREALESPEHCS
GQ924643_HBc_P-C      MDIDPYKEFGASAELLS-FLPADFFPSIRDLLDTASALYREALESPEHCT
GQ924650_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPNIRDLLDTASALFREALESPEHCS
GQ924655_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924658_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GU827639_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM011468_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPTIRDLLDTASALFREALESPEHCT
HM011481_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPPVRDLLDTASALYREALESPEHCS
HM011486_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM011488_HBc_P-C      MDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM011491_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYRQALESPEHCS
HM011495_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM011497_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM011500_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM011502_HBc_P-C      MDIDPYKEFGASXELLS-FLPSDFFPSXRDLLDTASALYREALESPEHCS
HM042269_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
HM750135_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALKSPEHCS
HM750141_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDAASALYREALESPEHCS
HQ700476_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYREALESPEHCS
HQ700490_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700506_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700517_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700522_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYRDALESPEHCS
HQ700543_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYRDALESPEHCS
HQ700559_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700569_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700570_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700571_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700575_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700576_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700577_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYREALESPEHCS
HQ700578_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828905_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828910_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828937_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
JN104434_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN104437_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN315779_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN400087_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYREALESPEHCS
JN827416_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
JQ027317_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ027318_HBc_P-C      MDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ027322_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
JQ027323_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYREALESPEHCS
JQ027324_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYRDALESPEHCT
JQ027332_HBc_P-C      MDIDVYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
JQ027333_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040129_HBc_P-C      MDIDPYKEFGASSELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040131_HBc_P-C      MDIDTYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYREALESPEHCS
JQ040132_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYXEALESPEHCS
JQ040135_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040139_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040141_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040143_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALHREALESPEHCS
JQ040144_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040145_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040149_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040151_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040152_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSXRDLLDTASALYREALESPEHCS
JQ040156_HBc_P-C      -DIDPXKEFGASSELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040158_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040164_HBc_P-C      MDIDTYKEFGASXELLS-FLPSDFFPAIRDLXDTASALYREALESPEHCS
JQ040165_HBc_P-C      MDIDPYKEFGASVELLS-FLXSDFFPSIRDLLDTASALYREALESPEHCS
JQ040166_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
JQ040167_HBc_P-C      MDIDHYKEFGASVELLS-FLPLDFFPSIRDLLDTASALXREALESPEHCS
JQ040168_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
JQ040172_HBc_P-C      MDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ341517_HBc_P-C      MDIDPYKEFXASVELLS-FLPSDFFPNVRDLLDTASALYREALESPEHCS
JQ341518_HBc_P-C      MDIDXYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
JQ341541_HBc_P-C      MDIDPYKEFGASXELLS-FLPSDFFPSIRDLLDTASALXREALESPEHCS
JQ341544_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALXSPEHCS
JQ341545_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ429078_HBc_P-C      MDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707707_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707708_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707768_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801472_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801473_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801480_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801489_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801491_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
JQ801493_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801495_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801499_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
JQ801500_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
JQ801501_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYREALESPEHCS
JQ801503_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801508_HBc_P-C      MDIDTYKEFGASVELLS-FLPQDFFPNVRDLLDTATALYREALESPEHCT
JQ801510_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801515_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
JQ801517_HBc_P-C      MDIDPYKEFGASAELLS-FLPDDFFPSVRDLLDTASALYREALESPEHCS
JQ801518_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
JQ801520_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801522_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801523_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSLLDPLYTASALYREALKSPEHCS
JX026877_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPGHCS
JX026878_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
JX026880_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
JX026888_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429905_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALASPEHCS
JX429912_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429918_HBc_P-C      MDIDPYEEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX504535_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALQSPEHCS
JX504536_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX504539_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIQDLRDTASALYREALESPEHCS
JX507211_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX507212_HBc_P-C      MDIDPYKEFGASAQLLS-FLPSDFFPSIRDLLDTAAALYREALESPEQCS
JX507214_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX560519_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX661497_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
JX870000_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC315399_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774179_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYRDALESPEHCS
KC774182_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774199_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774207_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774221_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774226_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFLFFQNLLNTPSALYREALKSPEHCS
KC774240_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALKSPEHCS
KC774252_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774253_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
KC774284_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774286_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774288_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774296_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774300_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774302_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774306_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYREALESPEHCS
KC774311_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYREALESPEHCS
KC774313_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774319_HBc_P-C      MDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYREALESPEHCT
KC774321_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774331_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KC774340_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774352_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774353_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KC774354_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYREALESPEHCS
KC774357_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KC774358_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC836842_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875263_HBc_P-C      MDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875264_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KC875265_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875268_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875269_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875271_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875273_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KF165568_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF166858_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
KF214651_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF214652_HBc_P-C      MDIDPYKEFGASVQLLS-FLPTDFFPSIRDLLDTAAALYREALESPEHCS
KF214667_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KF214669_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF214670_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPNVRDLLDTASALYREALESPEHCS
KF214671_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF214675_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF214677_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAASLYREALESPEHCS
KF485390_HBc_P-C      MDIDPYKESGASVEILS-FLPSDFFPXIRDLLDTASALYREALESPEHCS
KF779327_HBc_P-C      MDIDTYKEFEASWELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF873514_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREXLESPEHCS
KF873516_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
KF873520_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTATALYRDALESPEHCS
KF873536_HBc_P-C      MDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
KF873539_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAXALYRDALESPEHCS
KF873541_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYRDALESPEHCS
KF873544_HBc_P-C      MDIDXYKEFGASXQLLS-FLPSDFFPSIRDLLDTASALYQEALESQEHCS
KJ173287_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173290_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KJ173295_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173302_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173316_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYREALESPEHCS
KJ173319_HBc_P-C      MDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173393_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ410489_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KJ410491_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KJ410496_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ410498_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ410505_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHVS
KJ410510_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTANALHREALESPEHCS
KJ410511_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ410514_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNVRDLLDTASALYREALESPEHCS
KJ410515_HBc_P-C      MDIDPYKEFGAYQELLS-FLPSDFFPTIRDLLDTASALYREALESPEHCS
KJ410518_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPDHCS
KJ410521_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
KJ598639_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598642_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREAFESPEHCS
KJ598644_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598646_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598649_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598650_HBc_P-C      MDIDPYKEFGASVELLS-FLPLDFFPSIRDLLDTASALYREALESPEHCS
KJ598654_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598656_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598658_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598662_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598663_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598665_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598667_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598671_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREGLESPEHCS
KJ598672_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598679_HBc_P-C      MDIDTYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598680_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598720_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598721_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KJ598722_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KJ598723_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598726_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598727_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KJ598741_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598752_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598762_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALCREALESPGHCS
KJ598780_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KJ803754_HBc_P-C      MDIDPYKEFGASVELLS-FLPQDFFPSIRDLLDTASALYREALESPEHCS
KJ803757_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803760_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803761_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803762_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCT
KJ803766_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803770_HBc_P-C      MDIDPYKEFGASMELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KJ803774_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803776_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803777_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
KJ803779_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803780_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803790_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KJ803809_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHVS
KJ803810_HBc_P-C      MDIDPYNEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KJ803812_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KJ803814_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803815_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803823_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803826_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KM875404_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KM875412_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KM875424_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KM875425_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRALLDTASALYREALESPEHCT
KM875428_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148315_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148462_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148470_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALGSPEHCS
KP148474_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148475_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148476_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREAFESPEHCS
KP148480_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDYFPSIRDLLDTASALYREALESPEHCS
KP148488_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148520_HBc_P-C      MDIDPYKEFGVSVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148525_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDYFPSIRDLLDTASALYREALESPEHCS
KP148526_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148534_HBc_P-C      MDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYREALESPEHCS
KP148540_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148546_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148547_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148548_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148557_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148559_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148562_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148563_HBc_P-C      MDIDPYKEFGASVELLP-FLPSDFFPAIRDLLDTASALYREALESPEHCS
KP148564_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148566_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYRGALESPEHCS
KP148568_HBc_P-C      MDIDPYKAFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013761_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013762_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013764_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASAPYREALESPEHCP
KR013768_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013771_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFLPSIRDLLDTASALYREALESPEHCS
KR013772_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPGHCS
KR013773_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013777_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013780_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013781_HBc_P-C      MDIDPYKEFGASVESLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013784_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLPDTASALYREALESPEHCS
KR013788_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013789_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013792_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013793_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013796_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013797_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013800_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYREALESPEHCS
KR013801_HBc_P-C      MDIDPYIEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013802_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KR013803_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013804_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KR013805_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KR013808_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013809_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013814_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KR013817_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013819_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013820_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013822_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013823_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013824_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013831_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013833_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013837_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDILDTASALYREALESPEHCS
KR013840_HBc_P-C      MDIDPYKGFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KR013846_HBc_P-C      MDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYREALESPEHCS
KR013847_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013850_HBc_P-C      MDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013851_HBc_P-C      MDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013853_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013854_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013855_HBc_P-C      MDIDPYKEFGASVELLS-FLPYDSFPSIRDLLDTASALYREALESPEHCS
KR013856_HBc_P-C      MDTDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013861_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013862_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLVDTASALYREALESPEHCS
KR013868_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013870_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013871_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013872_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESSEHCS
KR013874_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013904_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFLPSIRDLLDTASALYREALESPEHCS
KR013935_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013942_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013943_HBc_P-C      MDLDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALHREALESPEHCS
KR013961_HBc_P-C      MDIDPYKKFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013974_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYREALESPEHCS
KR013984_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013993_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRGLLDTASALYREALESPEHCS
KR013996_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013998_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR014006_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHRS
KR014041_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYREALESPEHCS
KR014055_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPERCS
KR014059_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLVDTASALYREALESPEHCS
KR014098_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR014099_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR819180_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT284757_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT307719_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREGLESPEHCS
KT347089_HBc_P-C      MDIDTYKEFGASLELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU576115_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576118_HBc_P-C      MDIDPYKGFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576122_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576123_HBc_P-C      MDINPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576142_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576193_HBc_P-C      MDIDPYKEFGASGELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU576196_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU576284_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALCRDALESPEHCS
KU576449_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
KU576453_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU576454_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYREALESPGHCS
KU576455_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU576457_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU576580_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576581_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576584_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576588_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576643_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576677_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIWELLDTASALYRDALESPEHCS
KU576688_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576696_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576747_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU576858_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYRDALESPEHCS
KU576860_HBc_P-C      MDIDHYKEFGASVELLS-FLPADFFPSIRDLLDTATALYREALESPEHCS
KU576919_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576920_HBc_P-C      MDIDPYKEFGASVELLS-FSPSDFFPSIRELLDTASALYRDALESPEHCS
KU576951_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU577024_HBc_P-C      MDIDPYKKFGASVELLS-FLPADFFPSVRELLDTASALYREALESPEHCS
KU577049_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU577055_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU577056_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPGHCS
KU577057_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHWS
KU577062_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU667409_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU667576_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
KU667678_HBc_P-C      MDIDHYKEFGASVELLS-FLPADFFPSIRDLLDTATALYREALESPEHCS
KU667914_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCP
KU667964_HBc_P-C      MDIDPYKEFGASVELLS-FLPSGFFPSIRDLLDTASALYREALGSPEHCS
KU667969_HBc_P-C      MDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU668000_HBc_P-C      MDTDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU668018_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU668050_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTATALYREALESPEHCS
KU668127_HBc_P-C      MDIDHYKEFGASVELLS-FLPADFFPSIRDLLDTATALYREALESPEHCS
KU668135_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU668181_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU668197_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU668271_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU668280_HBc_P-C      MDIDPYKELGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU679936_HBc_P-C      MDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
KU679937_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCX
KU679947_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCT
KU679951_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALFRXALESPEHCX
KU679957_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU679960_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCX
KU963874_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963882_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KU963898_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDIASALYREALESPEHCS
KU963917_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963926_HBc_P-C      MDIDPYKEFGASVQLLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963937_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963992_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KU963996_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KU963997_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KU964004_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964011_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964016_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFSSVRDLLDTASDLYREALESPEHCS
KU964023_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYREALESPEHCS
KU964045_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964049_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964076_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964077_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964078_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964180_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYREALESPEHCS
KU964185_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KU964191_HBc_P-C      MDIDPYKEFGASVELLX-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964198_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964200_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964201_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964214_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
KU964222_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964223_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964226_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964228_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964318_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964321_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964343_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964349_HBc_P-C      MDIDTYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KX276831_HBc_P-C      MDIDVYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KX276833_HBc_P-C      MDIDPYKEFGASVELLS-FLPLDFFPSIRELLDTASALYREALESPEHCS
KX276835_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX276836_HBc_P-C      MDIDHYKEFGASVELLS-FLPXDFFPSIRDLLDTATALYREALESPEHIS
KX276838_HBc_P-C      MDIDPYKEFGASAXLLS-FLPSDFFPSVRDLLDTASAMFGEALESPEHCX
KX276839_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPPVRDLLDTASALYREALESPEHCS
KX276840_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHVS
KX276841_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KX276844_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCX
KX276847_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHVS
KX276849_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYXEALESPEHCS
KX276851_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPTIRDLLDTASALYREALESPEHCT
KX276852_HBc_P-C      MDIDXYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
KX276853_HBc_P-C      MDIDPYKEFGASXXLLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX276854_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX276855_HBc_P-C      MDIDTYKEFGASVQLLS-FLPSDFFPNIRDLLDTASALYRDALESPEHLS
KX765822_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765828_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765829_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYRESLESPEHCS
KX765842_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765849_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY353910_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY363253_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDAATALYREALESPEHCS
KY363256_HBc_P-C      MDIDPYKEFGASVELLSS-LPSDFFPSIRDLLDTASALYREALESPEHCS
KY363258_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363260_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
KY363264_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALGSPEHCS
KY363266_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYRKALESPEHCS
KY363267_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY363274_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363275_HBc_P-C      MDLDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
KY363276_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363277_HBc_P-C      MDIDPYKEFGASVELLP-FLPSDFFPSIRDLLDTASALSREALESPEHCS
KY363282_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363283_HBc_P-C      MDIDPYKELGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363285_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363286_HBc_P-C      MDIDLYKEFGASVELLS-FLPTDFFPSIRDLLDTATALYREALESPEHCS
KY363287_HBc_P-C      MDIDLYKEFGASVELLS-FLPTDFFPSIRDLLDTATALYREALESPEHCS
KY470873_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470874_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470875_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470886_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470896_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470900_HBc_P-C      MDVDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470908_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470910_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470911_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470913_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470918_HBc_P-C      MDIDPYKEFGVSVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470925_HBc_P-C      MDIDTYKEFRASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470934_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYWEALESPEHCS
KY470937_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYQEALESPEHCS
KY470965_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470966_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470967_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470968_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470971_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFSPSIRDLLDTASALYREALESPEHCS
KY470975_HBc_P-C      MDIDPYKEFGASAELLS-FLPADFFPSIRDLLDTASALYRGALESPEHCS
KY470976_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470978_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470983_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY629637_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY689435_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY689471_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY689518_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY689525_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881802_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALCREALESPEHCS
KY881803_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881806_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALSREALESPEHCS
KY881807_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881810_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881812_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREVLESPEHCS
KY881814_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFSSIRDLLDTASALYREALESPEHCS
KY881818_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881819_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881871_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALSREALDSPEHCS
KY881872_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALNREALESPEHCS
KY881873_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881874_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881876_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881878_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREAFESPEHCS
KY881881_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYRVALESPEHCS
KY881884_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYRETLESPEHCS
KY881885_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREAFESPEHCS
KY881886_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KY881887_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881888_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYRVALESPEHCS
KY881889_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYRVALESPEHCS
KY881890_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREAFESPEHCS
KY881891_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881915_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881917_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881920_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881938_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881959_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881961_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCL
KY881963_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881966_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYREALESPEHCS
KY881968_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881971_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYREALESPEHCS
KY881972_HBc_P-C      MDIEPYKEFGASVKLLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881974_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881977_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881978_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRGLLDTASALYREALESPEHCS
KY881979_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881981_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYREALESPEHCS
KY881983_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPERCS
KY881988_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREAFESPEHCS
KY881989_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHSS
KY881991_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881992_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESSEHCS
KY881994_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREAFESPEHCS
KY881997_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881999_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY882001_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY882002_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYRVALESPEHCS
LC279246_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279250_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279253_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
LC279258_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279261_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEQCS
LC456110_HBc_P-C      MDIDPYKEFGASVELLS-FLPHDFFPSIRDLLDTASALYREALESPEHCS
LC456113_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCT
LC456114_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456118_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
LC456121_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
LC456122_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCT
LC456123_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCT
LC456124_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
LC456126_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456129_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHVS
LC456134_HBc_P-C      MDIDPYKEFGASTHLLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC516606_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCT
LC516609_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC516610_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC519790_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPNVRDLLDTASALYREALESPEHCS
LC519792_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESQEHCS
LC519799_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC519813_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC519818_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC519821_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYRDALESPEHCS
LC519822_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYQEALESPEHCS
MF488701_HBc_P-C      MDIDPYKEFGASVELLS-FLPKDFFPSVRDLLDTASALYREALESPEHCS
MF488703_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSVRDLLGTAAPLYREALKSPELCR
MF568467_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MF674390_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674411_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674425_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVHDLLDTASALYREALESPEHCS
MF674428_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674430_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MF674444_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674463_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674471_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
MF674474_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALGSPEHCS
MF674475_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674486_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674514_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925369_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MF925374_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925378_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925394_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MF925395_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MF925403_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPDHCT
MF925405_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MF925409_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG571332_HBc_P-C      MDIDPYKEFGASSELLS-FLPSDFFPSIRDLLDTASALYREGLESPEHCS
MG571335_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG571345_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826122_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTAQALYREALESPEHCS
MG826123_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDFLDTASALYREALESPEHCS
MG826124_HBc_P-C      MDIDTYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826126_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MG826129_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826132_HBc_P-C      MDIDPYIEFGASVEILS-FLPSAIFPSILDLLDTASALYLEGLESPEHCS
MG826136_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826137_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826138_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MG826139_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826140_HBc_P-C      MDIDVYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG893556_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG893558_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MH818373_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MH891502_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK037655_HBc_P-C      MDIDPYKEFGASVELLS-FLPNDFFPNVRDLLDTASALYREALESPEHCS
MK037843_HBc_P-C      MDIDPYKEFGASVELLS-FLPPDFFPSVRDLLDTASALYREALESPEHCS
MK038372_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLNTASALYREALESPEHCS
MK038386_HBc_P-C      MDIDPYKEFGASVELLSL-LPSDFFPSIRDLLDTASALYREALESPEHCS
MK038389_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038393_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK286461_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK321266_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTAAALYREALESPEHCS
MK534557_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534586_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534596_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534597_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534657_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRELLDTASALYREALESPEHCS
MK534671_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534678_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534720_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK720629_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTAAALYREALESPEHCS
MT114171_HBc_P-C      MDIDPYKEFGASLELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426108_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426250_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426255_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426263_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426264_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426265_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426272_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDPASALYREALEFPEHCS
MT426277_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426283_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426287_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426288_HBc_P-C      MDIDPYKGFGASVELLS-FLPSDFFSPIRDLLDTASALYREALESPEHCS
MT426289_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFTSIRDLLDTASALYREALESPEHCS
MT426293_HBc_P-C      MDIDPYKEIGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426297_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426298_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426306_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426312_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426324_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426326_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426347_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426350_HBc_P-C      MDIDQYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426351_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426352_HBc_P-C      MDIDPYTEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426354_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426355_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYQEALESPEHCS
MT426369_HBc_P-C      MDIDPYKEFGASVELLS-FLPSYFFPSIRDLLDTASALYREALESPEHCS
MT426373_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426374_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTSSALYWEALESPEHCS
MT426383_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYRKALESPEHCS
MT426384_HBc_P-C      MDIDPYTEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426405_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESQEHCS
MT426415_HBc_P-C      MDIEPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426418_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFSSIRDLLDTASALYREALESPEHCS
MT426422_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426435_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426440_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSICDLLDTASALYREALESPEHCS
MT426448_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426458_HBc_P-C      MDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYREALESPEHCS
MT426552_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426577_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426579_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFRSIRDLLDTASALYREALESPEHCS
MT426582_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426585_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426589_HBc_P-C      LDIDPSKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426603_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426622_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426644_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPLIRDLLDTASALYREALESPEHCS
MT426647_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALNREALESPEHCS
MT426663_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426666_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426673_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426677_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426684_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426685_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426691_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426700_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426704_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426711_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPKHCS
MT426729_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426732_HBc_P-C      MDIDPYKEFAASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426734_HBc_P-C      MDIDPYKEFGASVELLS-FLPFDFFPSIRDLLDTASALYREALESPEHCS
MT426739_HBc_P-C      MDIDPYKEFGAAVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426740_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCL
MT426747_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426750_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426751_HBc_P-C      MDIDPYKEFGASVELLT-FLASDFFPSIRDLLDTASALYREALESPEHCS
MT426762_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426780_HBc_P-C      MDIDPYKEFGASVELLS-FLPYDFFPSIRDLLDTASALYREALESPEHCS
MT426795_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426802_HBc_P-C      MDIDPYKEFGASVELLS-FLHSDFFPSIRDLLDTASALYREALESPEHCS
MT426810_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALEFPEHCS
MT426827_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426837_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426838_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426843_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426844_HBc_P-C      MDNDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426848_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426849_HBc_P-C      MNIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT644996_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MT644997_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT644998_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT644999_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645004_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645006_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645007_HBc_P-C      MDIDPYKEFGASAELIS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MT645008_HBc_P-C      MDIDPYKEFGASVELLS-FLPNDFFPSIRDLLDTASALYREALESPEHCS
MT645009_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTATALYREALESPEHCS
MT645010_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MT645011_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645012_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MT645013_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645014_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALFREALESPEHCS
MT645019_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MT645020_HBc_P-C      MDIDPYKEFGASMELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645021_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645022_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
MT645023_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MT645024_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIQDLRDTATALYREALESPEHCS
MT645027_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
MT645033_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645036_HBc_P-C      MDIDPYKEFGASFELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
MT645037_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MT645038_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645040_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTASALYREALESPEHCS
MT645043_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MT645046_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALKSPEHCS
MT645050_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645051_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSMRDLIDTASALFREALESPEHCS
MT645052_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
MT645053_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645054_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MT645059_HBc_P-C      MDIDPYKEFGTSVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645072_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW310259_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW310260_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MW675885_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW847936_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MW887641_HBc_P-C      MDIDPYKEFGASAELIS-FLPGDFFPNVRDLLDTASALYREALESPEHCT
MW887642_HBc_P-C      MDIDPYKEFGASVELLS-FLPNDFFPSIRDLLDTASALYREALESPEHCS
MW887643_HBc_P-C      MDIDPYKEFGASVQLLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MW887646_HBc_P-C      MDIDPYKEFGASVELLS-FLPNDFFPSVRDLLDTAAALYREALESPEHCS
MW887647_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW887650_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW887651_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
MW887652_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTAAALYREALESPEHCS
MZ439270_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439286_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTTSALYREALESPEHCT
MZ439290_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439300_HBc_P-C      MDIDPYKEFGASVQLLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439309_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439316_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
MZ439319_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYQVALESPEHCS
MZ439320_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
MZ439323_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439325_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439331_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
MZ439391_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYRQALESPEHCS
MZ439392_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439397_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439408_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439409_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439418_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439424_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439437_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439465_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439488_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439552_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439554_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439557_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYREALESPEHCS
MZ439560_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYREALESPEHCS
MZ439562_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYREALESPEHCS
MZ439565_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439566_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYREALESPEHCS
MZ439570_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYREALESPEHCS
MZ439580_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439582_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439601_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439605_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHHS
MZ439624_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCT
MZ439629_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439632_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439640_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439642_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439647_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439650_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439652_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439653_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439654_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439658_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439662_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439663_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439664_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439667_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439669_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439672_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439677_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439678_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439681_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439683_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439690_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439691_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439695_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439697_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLATASALYREALESPEHCS
MZ439702_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLATASALYREALESPEHCS
MZ439711_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLATASALYREALESPEHCS
MZ439716_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPSIRDLLATASALYREALESPEHCS
MZ439721_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439726_HBc_P-C      MDIDPYKEFGASMELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ671234_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671235_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671241_HBc_P-C      MDIDPNKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671242_HBc_P-C      MDIDPNKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671246_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OK106255_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM471090_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM471110_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM471136_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM732334_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
ON093164_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
ON402774_HBc_P-C      LDIDPYKEFGASAELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
ON402776_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
ON402777_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
ON402779_HBc_P-C      MDIDRYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
ON402782_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OX341769_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
X52939_HBc_P-C        MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB697494_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB014368_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB026811_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB026812_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB026814_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB026815_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB031262_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB033550_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB033551_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB033552_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB033556_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB050018_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB111119_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB111120_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB113879_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB198076_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB198077_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB198078_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB198079_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB198080_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB198081_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB198082_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB198083_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB205123_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB222714_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB222715_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB241110_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB241111_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB246345_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB247916_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB299858_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB300359_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB300362_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB300363_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB300365_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB362932_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367394_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367396_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367397_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367399_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367403_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367404_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367409_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367411_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367417_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB426467_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB471848_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB471850_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB471852_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB471853_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB485808_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB540584_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB640730_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB642100_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670238_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670247_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670267_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670282_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670283_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670287_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670292_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670294_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670305_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670307_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB675674_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB675675_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB675677_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB697490_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB697500_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB900116_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB981580_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF068756_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF223954_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF223955_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF223956_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF223957_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF223958_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF223959_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF286594_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF324081_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF384364_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF384365_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF384366_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF473543_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AJ748098_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AP011097_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AP011098_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AP011099_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AP011100_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AP011101_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AP011106_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AP011107_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY057947_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY206384_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY596107_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY641560_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
D12980_HBc_P-C        MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
D23680_HBc_P-C        MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
D50519_HBc_P-C        MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089758_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089763_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089765_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089769_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089779_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089781_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089783_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089789_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089793_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ246215_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ315781_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ315783_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ377161_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ922650_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ993690_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ993693_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EF688062_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU305540_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306673_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306685_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306688_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306689_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306690_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306691_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306694_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306713_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306714_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306720_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306721_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306729_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU410080_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU410081_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU554535_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU554537_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU554538_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU562215_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU562217_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU570068_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU589345_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU871975_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU871977_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU871982_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916217_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916224_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916225_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916237_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939549_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939580_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939604_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023571_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023641_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023642_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023643_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023644_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023646_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023647_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023649_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023650_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023653_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023654_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023656_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023657_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023658_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032331_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032332_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032340_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032341_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032350_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032361_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ349225_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386575_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386577_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386587_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386588_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386591_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386607_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386619_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386623_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386639_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386664_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386678_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ518813_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562218_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562244_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562245_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562258_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562269_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562274_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562275_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562282_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562283_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562297_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562298_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562320_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562323_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715341_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715352_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715353_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715355_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715358_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715365_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715370_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715371_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715374_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715377_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715378_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715379_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715380_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715382_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715395_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715397_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715398_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715400_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715402_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715405_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715407_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715409_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787441_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787447_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787453_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787454_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787479_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ899763_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ899775_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ358154_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ358158_HBc_C-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377514_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377515_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377517_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377523_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377524_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377527_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377528_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377529_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377531_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377533_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377535_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377536_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377538_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377540_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377541_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377546_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377551_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377553_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377554_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377559_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377562_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377563_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377570_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377571_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377572_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377574_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377576_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377578_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377579_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377580_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377584_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377585_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377591_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377598_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377600_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377601_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377603_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377615_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377616_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377617_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377618_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377619_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377624_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377631_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377637_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377640_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377642_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475305_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475306_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475307_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475308_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475310_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475311_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475312_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475313_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475314_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475315_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475316_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475317_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475319_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475327_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475328_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475329_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475330_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475331_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475333_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475334_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475339_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475345_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475346_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475347_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475348_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475350_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ855523_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ855525_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ855534_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ855544_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ855548_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924604_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924614_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924633_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924649_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GU434374_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GU563561_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM011465_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM011489_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM750131_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM750132_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM750136_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM750137_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM750138_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM750139_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM750140_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828913_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828915_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828916_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828917_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828918_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828919_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828920_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF899336_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN104432_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN104433_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN104440_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN827414_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN827415_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN827417_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN827418_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN827420_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN827421_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN827422_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN827423_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN827424_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN827425_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040133_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040162_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040163_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ688403_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ688404_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801470_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801475_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801482_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801486_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801488_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801496_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801497_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801504_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801505_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801511_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801513_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801519_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429904_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429906_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429907_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429909_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429913_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429915_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429916_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429917_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX504537_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX504544_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX504545_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX504546_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX661489_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX661490_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX661492_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX661496_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774180_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774181_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774184_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774185_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774187_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774189_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774190_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774191_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774192_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774196_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774197_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774200_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774202_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774203_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774204_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774205_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774206_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774208_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774209_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774210_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774213_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774214_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774215_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774216_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774219_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774220_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774223_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774224_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774228_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774229_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774231_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774232_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774233_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774235_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774236_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774237_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774238_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774239_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774241_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774242_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774244_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774248_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774249_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774250_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774254_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774255_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774256_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774257_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774260_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774261_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774262_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774265_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774266_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774267_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774268_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774270_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774271_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774272_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774274_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774276_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774277_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774280_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774281_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774283_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774285_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774287_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774289_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774290_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774292_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774293_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774295_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774298_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774299_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774303_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774304_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774308_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774309_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774310_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774312_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774315_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774318_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774325_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774327_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774329_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774330_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774333_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774336_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774337_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774339_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774342_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774343_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774347_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774348_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774351_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774356_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774359_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774360_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875262_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875267_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875270_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875272_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF214673_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF485389_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF495606_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173281_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173282_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173283_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173284_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173286_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173288_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173289_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173291_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173292_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173293_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173294_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173296_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173301_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173303_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173304_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173305_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173307_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173308_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173309_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173310_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173312_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173313_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173314_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173315_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173321_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173324_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173327_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173328_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173331_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173332_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173333_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173335_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173336_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173391_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173392_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173395_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173396_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173426_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173427_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173428_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173433_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173434_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173435_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173436_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173437_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173438_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173439_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173440_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173441_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173442_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173443_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173444_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173446_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ410495_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ410501_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ410504_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ410513_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ410519_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598635_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598636_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598640_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598641_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598659_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598689_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598694_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598698_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598710_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598716_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598740_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598749_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598753_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ790199_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803759_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803792_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803793_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803799_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803811_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803818_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KM213037_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KM229703_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KM526744_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KM526745_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KM526746_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP027477_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148463_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148466_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148468_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148469_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148471_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148473_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148481_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148482_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148492_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148493_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148512_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148517_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148521_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148524_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148529_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148531_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148532_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148535_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148538_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148545_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148549_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148551_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148555_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148560_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148561_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148571_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148573_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148574_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP784761_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013763_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013774_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013776_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013779_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013782_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013783_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013785_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013786_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013787_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013791_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013794_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013798_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013799_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013810_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013811_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013812_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013813_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013815_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013827_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013828_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013829_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013830_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013834_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013858_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013873_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013875_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013877_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013909_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT284753_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT284754_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT284755_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT284756_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT307718_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT364718_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT364719_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT364720_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT364721_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT364751_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT364752_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT366463_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT987423_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT987424_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT987425_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT987426_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU051424_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU051425_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU051426_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU051427_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963886_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963887_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963888_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963889_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963890_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963892_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963893_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963894_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963895_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963896_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963897_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963899_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963900_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963901_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963902_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963903_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963904_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963905_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963906_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963907_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963908_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963909_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963910_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963911_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963912_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963913_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963914_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964020_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964021_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964022_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964024_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964025_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964026_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964027_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964028_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964029_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964030_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964031_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964032_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964033_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964034_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964035_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964036_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964037_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964038_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964039_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964040_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964041_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964042_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964043_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964044_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964047_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964048_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964050_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964051_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964052_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964053_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964054_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964055_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964056_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964057_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964058_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964059_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964060_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964061_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964062_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964063_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964064_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964065_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964066_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964067_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964068_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964069_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964070_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964071_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964072_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964073_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964074_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964075_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964169_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964170_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964171_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964174_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964176_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964178_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964181_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964183_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964184_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964187_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964188_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964192_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964193_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964194_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964195_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964196_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964197_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964199_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964218_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964224_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964225_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964334_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964336_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964337_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964338_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964339_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964340_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964341_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964342_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964344_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964345_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964346_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964347_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964348_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765818_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765819_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765820_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765821_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765823_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765824_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765825_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765826_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765827_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765830_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765831_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765832_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765833_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765836_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765837_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765838_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765840_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765843_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765844_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765845_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765846_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765847_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765848_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765850_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765853_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765855_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX774504_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX774506_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY022423_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470876_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470877_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470878_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470879_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470881_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470882_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470884_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470885_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470889_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470890_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470891_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470892_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470894_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470895_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470897_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470899_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470901_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470902_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470903_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470904_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470905_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470929_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470980_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470981_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470982_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470984_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470985_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470986_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470987_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470988_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY629631_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881736_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881737_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881738_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881739_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881742_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881743_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881744_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881748_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881749_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881750_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881751_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881754_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881755_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881758_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881762_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881763_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881764_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881765_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881766_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881767_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881768_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881769_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881770_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881771_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881772_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881773_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881774_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881775_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881776_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881777_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881980_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881984_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC064754_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC064755_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC090200_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279245_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279247_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279248_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279249_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279254_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279255_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279256_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279257_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279259_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279260_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279262_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279274_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279275_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279276_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC318702_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC318703_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC360507_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC373511_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC373512_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456117_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456125_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456128_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456130_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456131_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456132_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456135_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC519796_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC519807_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC592171_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC592172_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC730886_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674386_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674388_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674402_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674408_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674412_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674418_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674429_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674435_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674442_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674454_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674472_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674484_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674494_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674501_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674502_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925365_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925375_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925377_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925408_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925410_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG725248_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826127_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826128_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826131_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826133_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826134_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826135_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG893557_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG893560_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MH094411_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MH887433_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038373_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038381_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038391_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038394_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038395_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534592_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534593_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534604_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534605_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534619_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534622_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534624_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534628_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534631_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534636_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534638_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534640_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534642_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534643_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534644_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534645_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534647_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534649_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534650_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534652_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534656_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534666_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534667_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534674_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534677_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK628732_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MN683726_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MN683727_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MN683728_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MN683729_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT111596_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426105_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426106_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426107_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426109_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426248_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426249_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426251_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426252_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426253_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426254_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426256_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426257_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426258_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426259_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426260_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426261_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426262_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426266_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426267_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426268_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426269_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426270_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426271_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426273_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426274_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426275_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426276_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426278_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426279_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426280_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426281_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426284_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426285_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426286_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426290_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426291_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426292_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426294_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426295_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426296_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426299_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426300_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426301_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426302_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426303_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426304_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426305_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426308_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426310_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426311_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426313_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426314_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426316_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426317_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426318_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426319_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426320_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426321_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426322_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426323_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426325_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426327_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426328_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426329_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426330_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426331_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426332_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426333_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426334_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426335_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426336_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426337_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426338_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426339_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426340_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426341_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426342_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426343_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426344_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426345_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426348_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426349_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426356_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426358_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426359_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426360_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426361_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426362_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426363_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426364_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426365_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426366_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426367_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426368_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426370_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426372_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426375_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426376_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426377_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426378_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426379_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426380_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426381_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426382_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426385_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426386_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426387_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426388_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426389_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426390_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426391_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426392_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426393_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426394_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426395_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426396_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426397_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426398_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426399_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426400_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426401_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426402_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426403_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426404_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426406_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426407_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426408_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426409_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426411_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426412_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426413_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426416_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426417_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426419_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426420_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426421_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426423_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426424_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426425_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426426_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426427_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426429_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426430_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426431_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426432_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426433_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426434_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426437_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426438_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426439_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426441_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426442_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426443_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426444_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426445_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426450_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426451_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426452_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426454_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426516_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426548_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426580_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426581_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426583_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426584_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426586_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426587_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426588_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426590_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426591_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426592_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426593_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426594_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426595_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426596_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426597_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426598_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426599_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426601_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426602_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426604_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426605_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426606_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426607_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426608_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426609_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426610_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426611_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426612_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426613_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426615_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426616_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426617_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426618_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426619_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426620_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426621_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426623_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426624_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426625_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426626_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426628_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426629_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426630_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426632_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426633_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426634_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426635_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426636_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426637_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426638_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426639_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426640_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426641_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426642_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426643_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426645_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426646_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426648_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426649_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426650_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426651_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426652_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426653_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426654_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426655_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426656_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426657_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426658_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426659_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426660_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426661_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426662_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426664_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426665_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426668_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426669_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426670_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426671_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426672_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426674_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426675_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426676_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426678_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426679_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426680_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426681_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426682_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426683_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426686_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426687_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426688_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426689_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426690_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426692_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426693_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426694_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426695_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426696_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426698_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426699_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426701_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426702_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426703_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426705_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426706_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426707_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426708_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426709_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426710_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426712_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426713_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426714_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426715_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426716_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426718_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426719_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426720_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426721_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426722_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426723_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426724_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426725_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426726_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426727_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426728_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426730_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426731_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426733_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426736_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426737_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426738_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426741_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426742_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426743_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426744_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426745_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426746_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426749_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426754_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426755_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426756_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426757_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426758_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426760_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426763_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426764_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426765_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426766_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426767_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426768_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426769_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426770_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426772_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426773_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426774_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426775_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426776_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426777_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426778_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426779_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426781_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426782_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426783_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426784_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426785_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426786_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426787_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426789_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426790_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426791_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426792_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426793_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426794_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426797_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426798_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426799_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426800_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426801_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426803_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426804_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426805_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426806_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426807_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426808_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426809_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426811_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426812_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426814_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426815_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426816_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426817_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426818_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426819_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426820_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426821_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426822_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426823_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426824_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426825_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426826_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426828_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426830_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426831_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426832_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426833_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426834_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426835_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426836_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426840_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426841_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426842_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426845_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426847_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426850_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426851_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426852_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426853_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426854_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426855_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426856_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426857_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426858_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT644995_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645031_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645034_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645042_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645047_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645055_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675886_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675888_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675889_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675890_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675891_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675892_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675893_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675894_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675895_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439307_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439308_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439310_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439311_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439318_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439324_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439327_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439553_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439556_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439564_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439571_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439572_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439573_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439574_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439575_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439576_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439577_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439578_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439625_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439626_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439627_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439628_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439630_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439634_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439635_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439638_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439639_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439688_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ675793_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ934422_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ934424_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ934425_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ934431_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ934432_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ934433_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM688312_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM688313_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM688317_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM688318_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM732335_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OP153979_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OP153980_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
V00867_HBc_P-C        MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
X04615_HBc_P-C        MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670256_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU717217_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916218_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ872211_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774225_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB033553_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB471851_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB560662_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY641561_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ144553_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ144603_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ144604_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU305541_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU305542_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386576_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386601_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386637_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562268_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562281_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562290_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562295_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377577_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475322_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475332_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ040154_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX661495_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774217_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774251_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774264_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774326_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774345_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF779300_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173431_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803813_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148513_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148523_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148528_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148554_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148570_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013852_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963872_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963873_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765852_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470933_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470936_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674398_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674399_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674468_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925406_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038376_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038382_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038387_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038392_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426752_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW887649_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439407_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439410_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439412_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439413_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439419_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439420_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439422_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439425_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439429_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439431_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439432_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439433_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439435_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439436_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ675792_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OP153981_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023648_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
FJ562332_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
KF214672_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
MT645028_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
AB014380_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195942_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195943_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195944_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195947_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195948_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670289_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF411410_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939545_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939618_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386605_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386625_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386629_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787462_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787463_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ638218_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828923_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828924_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828925_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828926_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828929_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828930_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828931_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ027321_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801509_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774279_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774282_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774301_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF214676_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173337_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013821_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013826_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT284759_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363284_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470906_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470907_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470909_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470912_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470914_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470915_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470917_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470920_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674504_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925387_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925398_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534595_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645003_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439334_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439336_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439338_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439339_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439340_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439341_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439343_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439344_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439345_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439346_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439347_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439349_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439350_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439351_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439355_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439356_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439357_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439358_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439361_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439363_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439364_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439365_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439366_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439367_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439368_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439369_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439370_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439371_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439372_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439375_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439376_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439378_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439379_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439380_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439381_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439382_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439383_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439384_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439385_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439386_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439387_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439388_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439389_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439390_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801490_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB014399_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367416_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939564_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386604_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787437_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475357_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828921_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828922_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828928_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU554542_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939619_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032333_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032336_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032339_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ032345_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386597_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386665_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774335_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF214668_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173306_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC519804_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC519805_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB644284_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ027319_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KM875430_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363257_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670302_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
DQ993691_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU589340_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU589341_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU589342_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ787481_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KC774278_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KF214655_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881875_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MZ439417_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MZ439423_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB298720_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB298721_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939582_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ027320_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964217_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964219_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964220_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964221_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964227_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363278_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363279_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674467_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367427_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306725_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598637_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLVDTASALHREALESPEHCS
KJ598638_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLVDTASALHREALESPEHCS
AY066028_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939572_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939594_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386671_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562307_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475309_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173445_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013969_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013975_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB971714_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB971715_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939560_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562299_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787468_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377593_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF436920_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX504542_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774245_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU576929_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963875_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963876_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963879_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963881_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963884_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963915_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963916_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963918_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963919_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963920_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963921_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963922_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963923_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963924_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963925_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963927_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963928_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963929_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW755445_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB246344_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
HM011493_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
KJ803765_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
KM359441_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
AB113876_HBc_P-C      MDIDTYKEFGASVELLS-FMPSDFFPSIRDLLDTASALHREALESPEHCS
AB195930_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESQEHCS
AB195931_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESQEHCS
AB195932_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESQEHCS
AY206382_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ683578_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715359_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674489_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925367_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671240_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671245_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ675788_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195937_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195938_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367414_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC279251_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB195954_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ089796_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU522068_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939614_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475349_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX429903_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774218_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598750_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470880_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB642099_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ975273_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ980550_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916223_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916229_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX026885_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX560520_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598645_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598647_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598648_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598652_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598655_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598660_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598681_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148465_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148487_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148489_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765834_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645000_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OR833942_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013790_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562318_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
FJ562330_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALHREALESPEHCS
KY470916_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367429_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB367424_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787442_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787443_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787458_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787464_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787465_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774194_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY363281_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ934434_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX661493_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AB670290_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881870_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881877_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881879_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881882_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881883_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881892_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881973_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MZ439415_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MZ439416_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MZ439421_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MZ439427_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MZ439428_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MZ439430_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MZ439450_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
GQ377632_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KC774338_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KJ173432_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
AB367801_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
AB670291_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023639_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386620_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562249_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562319_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801481_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801483_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX504541_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774269_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013859_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013860_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456119_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439332_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439333_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439335_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439337_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439342_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439348_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439352_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439353_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439354_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439359_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439360_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439362_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439373_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439374_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439377_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939578_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX661491_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB554025_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB560661_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB644287_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ358157_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700516_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801502_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765851_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KX774503_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426631_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675887_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MW675896_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
X75665_HBc_P-C        MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670240_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB670254_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HM750134_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF873526_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AB931171_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU871969_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU871971_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN104435_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671248_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671249_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671251_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
ON402780_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY247031_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386618_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562233_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774316_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
DQ536410_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF384372_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU560441_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
EU919168_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ787486_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ899776_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
JX026884_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KR013807_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964014_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
AF411411_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU796070_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU796072_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916215_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AF461363_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ899789_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ386652_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU562218_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
AY206379_HBc_P-C      MDIDPYKEFGASMELIS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KR013832_HBc_P-C      MDIDPYKEFGASVELLS-FLPPDFFPSIRDLLDTASALYREALESPEHCS
JN400088_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIQDRLDTASALYREALESPEHCS
EU939550_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU554539_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
D23683_HBc_P-C        MDIDPYKEFGASVELVS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
S75184_HBc_P-C        MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
D50518_HBc_P-C        MDIDPYKEFGASVELLS-FMPSDFFPSIRDLLDTASALYREALESPEHCS
EU939543_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
FJ562340_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
FJ032334_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377521_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964046_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK534588_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828906_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828907_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828908_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828911_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JF828912_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013818_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881937_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU306727_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ801487_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148558_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426357_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426428_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU916238_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EF536066_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ562325_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674457_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU570072_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939546_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU579442_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774320_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC875261_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU570074_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GU721029_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645017_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU871972_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
EU871998_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU872003_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCT
EU939600_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013844_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013845_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013848_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013849_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KT284758_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470883_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439312_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439313_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439314_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439315_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439317_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439321_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439322_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439326_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439328_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439329_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939561_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939610_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939613_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939626_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ899767_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ562235_HBc_P-C      MDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ899769_HBc_P-C      MDIDPYKEFGASGELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ899764_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
KJ598687_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ899778_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939591_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
MF925376_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939640_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426667_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
EU939656_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
FJ023568_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023587_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023590_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ023591_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148572_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLGTASALYREALESPEHCS
KR013857_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLGTASALYREALESPEHCS
FJ386687_HBc_P-C      MDIDAYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK040792_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALHREALESPEHCS
GQ372968_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ377636_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598705_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598706_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598707_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598708_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598709_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598711_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598712_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598713_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598714_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598715_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598717_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598718_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598719_HBc_P-C      MDIDSYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475342_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KC774334_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MH220971_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MT426839_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964215_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTAAALYREALESPEHCS
FJ787461_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KF214678_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ803769_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ787439_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715368_HBc_P-C      MDIDPYKEFGASAELLS-FLQSDFFPSIRDLLDTASALYREALESPEHCS
FJ715418_HBc_P-C      MDIDPYKEFGASAELLS-FLQSDFFPSIRDLLDTASALYREALESPEHCS
MT426735_HBc_P-C      MDIDPYKEFGASVELLS-FVPSDFFPSIRDLLDTASALYREALESPEHCS
KU963891_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTTSALYREALESPEHCS
FJ715403_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ715416_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
FJ787467_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
FJ899765_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTAAALYREALESPEHCS
KC774195_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774211_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774227_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774243_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774259_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774346_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG826143_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MG893553_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
ON402783_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ259588_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSTRDLLDTASALYREALESPEHCS
HQ700456_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700495_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700496_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700502_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700504_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700544_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700555_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700556_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700558_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700561_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700562_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700563_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700564_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700565_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700566_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700567_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700568_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700572_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700573_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
HQ700574_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475321_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ924623_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX504534_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JX661488_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774247_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774314_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173311_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173317_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173429_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173430_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964216_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY670782_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF925359_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OP153982_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU963871_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KU963877_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KU963878_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KU963880_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KU963885_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439452_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
GQ475338_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
GQ475354_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MF674403_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KY881880_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ173285_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KR013866_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
MT645032_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439455_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439463_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439464_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439466_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439477_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439481_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439484_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439497_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
GQ475352_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPPVRDLLDTASALYREALESSEHCS
KU667984_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU668013_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774275_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MK038388_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JN400089_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIQDLLDTASALYREALESPEHCS
KT366464_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707709_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707710_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707711_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707712_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707713_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707715_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707716_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707717_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707718_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707719_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707720_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707721_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707722_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707723_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707724_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707725_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707726_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707727_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707728_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707729_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707730_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707731_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707732_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707733_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707769_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707770_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707771_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707772_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707773_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
JQ707774_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013770_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774297_HBc_P-C      MDIDPYKEFGATVELLS-FLPSDFFPSVRDLLDTASALYRDALESPEHCS
KY363268_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774361_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KC774355_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPAIRDLLDTASALYREALESPEHCS
KR013767_HBc_P-C      MDIDPYKEFGAPVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456111_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426578_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598772_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KJ173394_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ410492_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KJ410494_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KJ410499_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KJ410508_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHVS
KU051423_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT645044_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598651_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598653_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598661_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598657_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598664_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598666_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598668_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598669_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598670_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598673_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598674_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598676_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598677_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598678_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598686_HBc_P-C      MDIDTYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964238_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964243_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964242_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KJ598733_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964241_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KJ598724_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598725_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598728_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598729_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598731_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598732_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598734_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598735_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598738_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598739_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964229_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964231_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964232_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964233_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964234_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964237_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964239_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964240_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964236_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598730_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KJ598736_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KJ598737_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964230_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964235_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KJ598742_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598743_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598744_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598746_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598747_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598748_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598751_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KJ598754_HBc_P-C      MDIDTYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674417_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148464_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426627_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KP148477_HBc_P-C      MDIDPYKEFGASVELLSLFLPSDFFPSIRDLLDTASALYREALESPEHCS
KX765839_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426600_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426759_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426761_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426846_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470887_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881967_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881970_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439633_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013825_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR013876_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KR014060_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPERCS
KU576116_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576117_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576119_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576120_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576121_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576124_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576143_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576144_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576422_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576503_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576585_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576615_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576631_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576635_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576642_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576644_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576697_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576752_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576763_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576833_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576835_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576838_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576899_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576937_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576941_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576627_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU577106_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYRDALESPEHCS
KU576863_HBc_P-C      MDIDHYKEFGASVELLS-FLPADFFPSIRDLLDTATALYREALESPEHCS
KU576864_HBc_P-C      MDIDHYKEFGASVELLS-FLPADFFPSIRDLLDTATALYREALESPEHCS
KU576865_HBc_P-C      MDIDHYKEFGASVELLS-FLPADFFPSIRDLLDTATALYREALESPEHCS
KU667741_HBc_P-C      MDIDHYKEFGASVELLS-FLPADFFPSIRDLLDTATALYREALESPEHCS
KU577051_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU577052_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KU964002_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
LC279252_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KU964012_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964013_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964015_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964017_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964018_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964019_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCS
KU964186_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KU964189_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KU964190_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
KU964202_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964203_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964205_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964206_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964209_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964212_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964204_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964207_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964208_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964210_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964211_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964213_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTATALYREALESPEHCS
KU964319_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964320_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964322_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964324_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964325_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964327_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964330_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964331_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964332_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964333_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964323_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964326_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964328_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964329_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
KU964358_HBc_P-C      MDIDTYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KU964363_HBc_P-C      MDIDTYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470888_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426829_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426353_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYWEALESPEHCS
MT426614_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYWEALESPEHCS
KY470969_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470974_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470970_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470973_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470977_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470979_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
KY470972_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFSPSIRDLLDTASALYREALESPEHCS
KY470990_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY470991_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC519812_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881815_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFSSIRDLLDTASALYREALESPEHCS
KY881960_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYRETLESPEHCS
KY881987_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREAFESPEHCS
KY882003_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREAFESPEHCS
KY881916_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881918_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881919_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881921_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881922_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881923_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881924_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881925_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881926_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881927_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881929_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881930_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881931_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881932_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881933_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881934_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881935_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881936_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881965_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881975_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881982_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881985_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881986_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881995_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881998_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY882000_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881928_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881939_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881940_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881941_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881942_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881943_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881964_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881996_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881969_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881976_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
KY881993_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLIDTASALYREALESPEHCS
MT426449_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426697_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
LC456115_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MF674458_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVHDLLDTASALYREALESPEHCS
MK720630_HBc_P-C      MDIDPYKEFGASVELLS-FLPTDFFPSIRDLLDTAAALYREALESPEHCS
MT426307_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426414_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426446_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426309_HBc_P-C      MDIDPYKEIGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426453_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426748_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426753_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MT426796_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439271_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439272_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439273_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439274_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439275_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439276_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439277_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439278_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439279_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439280_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439281_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439282_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439283_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439284_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439285_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439287_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439288_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439289_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSVRDLLDTASALYREALESPEHCT
MZ439291_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439292_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439293_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439294_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439295_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439296_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439297_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439298_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439299_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439302_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439303_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439304_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439305_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439306_HBc_P-C      MDIDPYKEFGASVELLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439301_HBc_P-C      MDIDPYKEFGASVQLLS-FLPEDFFPSVRDLLDTASALYREALESPEHCT
MZ439330_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLIDTASALYREALESPEHCS
MZ439395_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYRQALESPEHCS
MZ439404_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYRQALESPEHCS
MZ439393_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439394_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439396_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439398_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439399_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439400_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439401_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439402_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439403_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439405_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439406_HBc_P-C      MDIDPYKEFGASTELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCT
MZ439411_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439414_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439434_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439445_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439460_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439467_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439476_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439480_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439483_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439438_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439439_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439440_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439441_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439442_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439443_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439444_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439446_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439447_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439448_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439449_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439451_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439453_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439456_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439457_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439458_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439459_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439461_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439462_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439468_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439469_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439470_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439471_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439472_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439474_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439475_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439478_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439479_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439482_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439486_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439487_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439489_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439490_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439491_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439492_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439493_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439494_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439495_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439496_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439498_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439499_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439500_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439501_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439502_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439503_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439504_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439505_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439506_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439507_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439508_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439509_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439510_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439511_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439512_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439513_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439514_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439515_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439516_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439473_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439485_HBc_P-C      MDIDPYKEFGASVELLS-FLPADFFPSIRDLLDTASALYREALESPEHCS
MZ439569_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439558_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYREALESPEHCS
MZ439559_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYREALESPEHCS
MZ439568_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRELLDTASALYREALESPEHCS
MZ439581_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439583_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439584_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439585_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439586_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439587_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439588_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439589_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439590_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439591_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439592_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439593_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439594_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439595_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439596_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439597_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439598_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439599_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439600_HBc_P-C      MDIDPYKEFGASAELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439602_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439603_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439604_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439606_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439608_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439609_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439610_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439612_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439613_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439614_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439615_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439616_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439617_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439618_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439619_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439620_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439621_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439622_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439623_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439607_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHHS
MZ439611_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHHS
MZ439631_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439636_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439637_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439641_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439643_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439644_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439645_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439649_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439656_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439659_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439661_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439665_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439648_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439651_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439668_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439670_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439655_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439660_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439657_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439666_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439675_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439684_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439686_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439692_HBc_P-C      MDIDHYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ439671_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439679_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439680_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439682_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439685_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439687_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439689_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439720_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439676_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439703_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439729_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439732_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439733_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439734_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439735_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439696_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439698_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439699_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439700_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439701_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439704_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439705_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439706_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439707_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439708_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439710_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439712_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439713_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439714_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439715_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439717_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439718_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439719_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439722_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439709_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLATASALYREALESPEHCS
MZ439723_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439724_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439725_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439727_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439728_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439730_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439736_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ439737_HBc_P-C      MDIDPYKEFGASVELIS-FLPSDFFPNIRDLLDTASALYREALESPEHCS
MZ671250_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671247_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ675789_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ675791_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671243_HBc_P-C      MDIDPNKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ671244_HBc_P-C      MDIDPNKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ675787_HBc_P-C      MDIDPNKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
MZ675790_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM471131_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
OM471143_HBc_P-C      MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCS
                       :                                                

KP148472_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014360_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGIKIRQ
AB014361_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB014362_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014363_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014364_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014365_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
AB014367_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014369_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB014371_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPTSREAVVGYVNVNMGLKLRQ
AB014372_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB014373_HBc_P-C      PHHTALRQAIICWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB014374_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014376_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014377_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014378_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014379_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB014381_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014382_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
AB014383_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
AB014384_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB014385_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014386_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQ
AB014387_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKIRQ
AB014388_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014390_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014391_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014392_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB014393_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
AB014394_HBc_P-C      PHHTALRQATLCWGELMNLATWVGSNLADPASRDLVVNYVNVNMGLKFRQ
AB014395_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014396_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB014397_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB014398_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB026813_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRR
AB042282_HBc_P-C      PHHTALRQAILCWGKLMNLATWVGSNLEDPASRELLVSYVNVNMGLKIRQ
AB042283_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB042284_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB042285_HBc_P-C      PHHTALRQAILCWDELMKLATWVGGNLDDQASRDLVVSYVNVNMGLKIRQ
AB049610_HBc_P-C      PHHTALRQAILCWGELMDLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
AB074047_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB074755_HBc_P-C      PHHTALRQAILCWGEMMNLATWVGSNLQDPASRELVVSYVNVNMGLNIRQ
AB074756_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB105173_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB105174_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB106895_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB111112_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKXRQ
AB111114_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB111116_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB111117_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB111118_HBc_P-C      PHHTALRQAILCWAELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQ
AB111121_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB111122_HBc_P-C      PHHTALRQAILCWGEMMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB111123_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB111124_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB111125_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB111946_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQ
AB112063_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
AB112065_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNSEDPASRELVVSYVNVNMGLKIRQ
AB112066_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVLSYVNVNMGLKIRQ
AB112348_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB112408_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB112471_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB112472_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB113875_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB113878_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB115417_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKLRQ
AB115418_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYGNGNMGLKLRH
AB117758_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB176642_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLXDPASRELVVGYVNVNMGLKFRQ
AB176643_HBc_P-C      PHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB182589_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB195936_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB195945_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLKLRQ
AB195946_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKLRQ
AB195949_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB195952_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB195953_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB202071_HBc_P-C      PHHTALRQAIMCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB202072_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB205124_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVDVNMGLKIRQ
AB205125_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB246346_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB250109_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB288026_HBc_P-C      PHHTALREAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKXRQ
AB300360_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB300361_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB300368_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB300372_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB300373_HBc_P-C      PHHTALRQAVVCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQ
AB365451_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVGYVNVNMGLKLRQ
AB367392_HBc_P-C      PHHTALRQGILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
AB367395_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367398_HBc_P-C      PHHTALRQAFLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRR
AB367401_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB367402_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB367405_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
AB367406_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQ
AB367407_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
AB367408_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367410_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367412_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB367413_HBc_P-C      PHHTALRQALLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB367418_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367420_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB367421_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB367422_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367423_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB367425_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNAGLKIRQ
AB367426_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB367428_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367430_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB367431_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367432_HBc_P-C      PHHTALRQAILCWGELMNLATWVGANLDDPASRESVVSYVNVNMGLKLRQ
AB367433_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB367434_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367435_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367802_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB367803_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB367804_HBc_P-C      PHHTALRQAILCWGELMNLATWVGANLDDPASRESVVSYVNVNMGLKLRQ
AB471849_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB485809_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB485810_HBc_P-C      PHHTALRQAILCWGELMNLGTWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB540583_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLEHPASRELVVSYVNVNMGLKFRQ
AB540585_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB554018_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB642095_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
AB642097_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLXDPASRELVVSYVNVNMGLKLRQ
AB644281_HBc_P-C      PHHTALRQAVLCWGELMTLASWVGHNLEDQASRDSVVSYVNGHMGLKIRQ
AB670237_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB670239_HBc_P-C      PHHTALRQXILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670241_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB670242_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
AB670243_HBc_P-C      PHHTALRQXILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670246_HBc_P-C      PHHTAIRQAIVCWGELMNLATWVGSNLEDQASRDSVVSYVNVNMGLKLRQ
AB670249_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB670252_HBc_P-C      PHHTALRQAXLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670253_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670255_HBc_P-C      PHHTAIRQAVLCWGELMSLATWVGSNLEDPASREAVVNYVNVNMGLKFRQ
AB670258_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670259_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670260_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEE-SSRELVVSYVNVHMGLKIRQ
AB670261_HBc_P-C      PHHTAIRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670262_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASREVVVSYVNVNMGLKFRQ
AB670263_HBc_P-C      PHHTALRQAILCWXELMNLATWVGSNLXDPASRELVVXHVNVNMGLKIRQ
AB670264_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670265_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670266_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB670268_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGXKXRP
AB670269_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQ
AB670270_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVNHVNVNMGLKIRQ
AB670272_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNVNMGLKLRQ
AB670273_HBc_P-C      PHHTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670274_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLDDQASRDLVVGYVNVNMGLKLRQ
AB670275_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670276_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB670277_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB670278_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKLRQ
AB670279_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLQDPASRESVVSYVNVNMGLKIRQ
AB670281_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPXSRELXVSYVNVNMGLKIRQ
AB670285_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLLIRQ
AB670295_HBc_P-C      PHHTAIRQAIICWGELMNLATWVGGNLDDQASRDLVVSYVNVNMGLKLRQ
AB670297_HBc_P-C      PHHTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670298_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB670300_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670301_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AB670304_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRT
AB670306_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670308_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVNHVNVNMGLKIRQ
AB670309_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEETASRELVVSYVNVNMGLKIRQ
AB670310_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AB670311_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB697502_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLDDPSSRELVVGYVNVNMGLKFRQ
AB697510_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQ
AB900099_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDQASRDLVVGYVNVNMGLKLRQ
AB900109_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDQGSRELVVGYVNVNMGLKFRQ
AB900113_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
AB900115_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB931170_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNVNMGLKIRQ
AF182802_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF182803_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF182804_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF182805_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF223960_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF223961_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVXHVNVNMGLKIRQ
AF241410_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF241411_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF323463_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNVNMGIKIRQ
AF324084_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF363961_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF384367_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF384371_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF411408_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVGYVNVNMGLKLRQ
AF411412_HBc_P-C      PRHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
AF458664_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF458665_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQPSRDLVVSYVNVNMGLKLRQ
AF461357_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVASYVNVNMGLKIRQ
AF533983_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY167090_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRR
AY167091_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLDDPASRELVVGYVNVNMGLKLRQ
AY167092_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
AY167096_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY167099_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY206376_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AY206378_HBc_P-C      PHHTALRQAVVCWGELVNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
AY206381_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY206385_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AY206386_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
AY206389_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY206392_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
AY220699_HBc_P-C      PHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AY220700_HBc_P-C      PHHTALRQATLCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQ
AY220702_HBc_P-C      PHHTALRQAIQCWGEVMNLATWVGSNLDDPASRELVVSYVNVNMGLKMRQ
AY247032_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPTSRELVVSYVNVNMGLKIRQ
AY269099_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY269140_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY306136_HBc_P-C      PHHTALRQATLCWGELMNLATWVGSNLEDPTSRELVVGYVNVNMGLKLRR
AY596108_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRESVVSYVNVNMGLKIRQ
AY641558_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY641559_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
AY641562_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
AY641563_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY862869_HBc_P-C      PRHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
D00630_HBc_P-C        PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
D23681_HBc_P-C        PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
D23682_HBc_P-C        AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
D23684_HBc_P-C        PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
D28880_HBc_P-C        PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
D50517_HBc_P-C        PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
D50520_HBc_P-C        PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089756_HBc_P-C      PHHTALRQGILCWGELMNLATWVGGNLDDPASRELVVSYVNVNMGLKLRQ
DQ089757_HBc_P-C      PHHTALRQAILCWGELMNLATWVGXNLXDPASREXVVSYVNVNMGLKXRQ
DQ089759_HBc_P-C      PHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRX
DQ089760_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNWEDPASRELVVSYVNVNMGLKIRQ
DQ089761_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGIKIRQ
DQ089762_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089764_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089766_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
DQ089767_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089768_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLEDPGSRELVVGYVNVNMGLKFRQ
DQ089770_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089771_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQ
DQ089772_HBc_P-C      YHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
DQ089773_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRH
DQ089775_HBc_P-C      AHHTALRQAIVCWGELMNLATWVGSNLDDPASREVVVNYVNVNMGLKIRQ
DQ089776_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDQGSRDLVVSYVNVNMGLKVRQ
DQ089777_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDQXSRELVVSYVNVNMGLKVRQ
DQ089778_HBc_P-C      PHHTALRQAILCWXELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
DQ089780_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089782_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089784_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089785_HBc_P-C      PHHTALRQAILCWGELMSLATWVGGNLDDPASRDAVVSYVNVNMGLKLRQ
DQ089786_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRP
DQ089787_HBc_P-C      PHHTALRQAIVCWGEVMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
DQ089788_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
DQ089790_HBc_P-C      PHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNDNMGLKTRQ
DQ089791_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVGYVNVNMGLKLRQ
DQ089792_HBc_P-C      PHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNXNMGLKXRQ
DQ089794_HBc_P-C      PHHTAIRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089795_HBc_P-C      PHHTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
DQ089797_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKTRQ
DQ089799_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKXRQ
DQ089800_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
DQ089801_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089802_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
DQ089803_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089804_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
DQ315782_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQ
DQ361526_HBc_P-C      PHHTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQ
DQ361534_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
DQ377160_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ377162_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
DQ377163_HBc_P-C      PHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ377164_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
DQ377165_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
DQ478885_HBc_P-C      PHHTALRQAILCWGDLMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ478899_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ478900_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ478901_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
DQ536413_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
DQ536414_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ922649_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ922651_HBc_P-C      QHHATLRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ975272_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVDVNMGLKLRQ
DQ975274_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGPKIRQ
DQ980549_HBc_P-C      PHHTALRQAILCWAEVTNLATWVGSNLEDLASRELVVNYVDVNMGLKIRQ
DQ980551_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
DQ986376_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ993692_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EF137802_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EF137803_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EF197911_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRH
EF384201_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EF494377_HBc_P-C      PHHTAFRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EF494379_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EF536065_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU306687_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306719_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306722_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASMELVVSYVNVNMGLKIRQ
EU410079_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKXRH
EU439005_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQ
EU439013_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
EU439015_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU498227_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRESVVTYVNVNMGLKIRQ
EU522069_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU522071_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU547559_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLQDXASRESVVSYVNVNMGLKIRQ
EU547562_HBc_P-C      AHHTALRQAILCWGELMNLATWVGGNLQDPTSREAVVSYVNVNMGLKIRQ
EU554536_HBc_P-C      PHHTALRHAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU554540_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU554541_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU560438_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU560439_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU560440_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU562216_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
EU570067_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU570073_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU579443_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDSASRELVVSYVNVNMGLKLRQ
EU589336_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDSASRELVVSYVNVNMGLKLRQ
EU670263_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU717212_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EU717214_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLNFRQ
EU717215_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKLRQ
EU796069_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU871970_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU871973_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU871974_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU871976_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU871980_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRQ
EU872000_HBc_P-C      HHHTALRQAILCWGELMNLATWVGSNLEDPGSRELVVGCVNVNMGLKIRQ
EU872001_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLDDPGSRDLVVSYVNVNMGLKIRQ
EU872002_HBc_P-C      HHHTALRQAILCWGELMNLATWVGSNLEDPGSRELVVGYVNVNMGLKIRQ
EU872004_HBc_P-C      HHHTALRQAILCWGELMNLATWVGSNLEDPGSRELVVGYANVNMGLKIRQ
EU872005_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLNFRQ
EU872008_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU872013_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRQ
EU881996_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916210_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916211_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916212_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916213_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916214_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916216_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916226_HBc_P-C      PHHTALRQVILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916227_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU916233_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU916234_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU919165_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU919169_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRESVVSYVNVNMGIKIRQ
EU939536_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EU939537_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939538_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRXLVVGYVNVNMGLKLRQ
EU939539_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEEQASRDLVVSYVNVNMGIKMRQ
EU939540_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU939541_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLENPASRELVVSYVNVNMGLKIKQ
EU939542_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRESVVGYVNVNMGIKIRQ
EU939544_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPTSREAVVSYVNVNMGLKLRQ
EU939548_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNTNMGLKLRQ
EU939552_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIKQ
EU939553_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EU939554_HBc_P-C      PHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939556_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939557_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKXRQ
EU939558_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNVNMGLKIRQ
EU939562_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU939563_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU939567_HBc_P-C      PHHTALRQANLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EU939568_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLKIRQ
EU939569_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU939570_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
EU939571_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939573_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQ
EU939574_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQ
EU939576_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
EU939579_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU939583_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939584_HBc_P-C      PHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRR
EU939585_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
EU939586_HBc_P-C      PHHTALRQAFLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939587_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
EU939588_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EU939590_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU939592_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU939593_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU939595_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
EU939596_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQ
EU939597_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939599_HBc_P-C      PHHTALRQAILCWVEVTNLATWVGSNLEDPASRELVVNYVNVNMGLKIRQ
EU939601_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EU939603_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EU939605_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
EU939607_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGIKLRQ
EU939609_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQ
EU939611_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
EU939612_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EU939615_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
EU939617_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDQASRDLVVGYVNVNMGLKLRQ
EU939625_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRESVVGYVNVNMGLKLRQ
EU939641_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRR
EU939642_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKIRQ
EU939643_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939644_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
EU939647_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
EU939648_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939651_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVTYVNVNMGLKLRQ
EU939652_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939653_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
EU939655_HBc_P-C      PHHTALRQATLCWVELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQ
EU939657_HBc_P-C      PHHTALRQAIICWGELMNLATWVGGNLDDPASREAVVNYVNVNMGLKLRQ
EU939658_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939659_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ023566_HBc_P-C      PHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQ
FJ023567_HBc_P-C      PHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQ
FJ023589_HBc_P-C      PHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQ
FJ023625_HBc_P-C      PHHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQ
FJ023640_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIKQ
FJ023645_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023651_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
FJ023652_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
FJ023655_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASREVVVSYVNVNMGLKIRQ
FJ032338_HBc_P-C      PHHTALRQAILCWGESMNLATWAGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032346_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032347_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
FJ032351_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLEIRQ
FJ032355_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032356_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032359_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032360_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ151413_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386574_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
FJ386579_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386589_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386594_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
FJ386595_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386596_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
FJ386598_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386602_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386603_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386609_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386611_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386612_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386613_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
FJ386617_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
FJ386624_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQ
FJ386626_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386627_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386628_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKTRQ
FJ386630_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386631_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386632_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ386638_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386640_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
FJ386641_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRDLVVSYVNVNMGLKIRQ
FJ386644_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQ
FJ386645_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQ
FJ386647_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386650_HBc_P-C      PHHTALRQAILCWGELLNLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQ
FJ386651_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386653_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386657_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
FJ386659_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ386661_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQ
FJ386662_HBc_P-C      PHHTALRQAIVCWGELINLATWVGSNVEDPASRELIVSYVNVNMGLKIRQ
FJ386663_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386667_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386670_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386672_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
FJ386673_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386677_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
FJ386679_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
FJ386685_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
FJ386689_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ518810_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
FJ562220_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVGHVNGNMGLKIRQ
FJ562221_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
FJ562225_HBc_P-C      PHHTALRQAILCWGEVMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562228_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDQQSREAVVGYVNVNMGLKLRQ
FJ562230_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
FJ562232_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562238_HBc_P-C      PHHTALRQAAVCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQ
FJ562239_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
FJ562241_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ562242_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562243_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQ
FJ562248_HBc_P-C      PHHTAVRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVKVNMGLKRGQ
FJ562250_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
FJ562251_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
FJ562252_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
FJ562255_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQ
FJ562256_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562261_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ562264_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ562265_HBc_P-C      PHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562266_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562270_HBc_P-C      PHHTALRHAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
FJ562272_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562273_HBc_P-C      PHHTALRQAILCWGELTNLATWVGSNLEDPASRELVVGYVNGNMGLKLRQ
FJ562276_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562279_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQ
FJ562280_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562284_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562285_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562286_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNGNTGLKIRQ
FJ562288_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562291_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562293_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
FJ562300_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562301_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ562304_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562306_HBc_P-C      PHHTALRHAILCWGELMNLATWVGGNLEDQASRELVVGYVNVNMGLKLRQ
FJ562308_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
FJ562324_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
FJ562326_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562327_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562329_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELGVGYVNGNMGLKFRQ
FJ562333_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ562334_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562335_HBc_P-C      PHHTALRQAILCWGDLMNLATWVGSNLEDPVSRELVVNYVNVNMGLKFRQ
FJ562337_HBc_P-C      PHHTALRQAFLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQ
FJ715342_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715343_HBc_P-C      PHHTALRQAILCWGELMNLVTWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715344_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIKQ
FJ715350_HBc_P-C      PHHTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715351_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715357_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715364_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715366_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715367_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715372_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715375_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715376_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715381_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715383_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715389_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715390_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715391_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715392_HBc_P-C      PHHTALRQAILCWGELMNLATWAGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ715404_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715406_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715415_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715421_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVSVNMGLKIRQ
FJ715422_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ715424_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ751764_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ751765_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ751770_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ787449_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ787452_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ787455_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ787456_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVTHVNVNTGLKIRQ
FJ787457_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
FJ787466_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNINMGLKIRQ
FJ787469_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ787470_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNTGLKIRQ
FJ787471_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
FJ787482_HBc_P-C      PHHTAIRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ787483_HBc_P-C      PHHTAIGQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ787485_HBc_P-C      PHHTAIRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ787487_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQ
FJ787488_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQ
FJ787489_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGGNLEDQASRDLVVSYVNVNMGLKIRQ
FJ787490_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
FJ848339_HBc_P-C      PHHTALRQAFVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ899761_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
FJ899768_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDQASRELIVSYVNVNMGLKIRQ
FJ899770_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
FJ899771_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ899774_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
FJ899777_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ899783_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGIKLRQ
FJ899788_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
FJ904423_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRESVVSYVNVNMGLKIRQ
GQ184326_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKVRQ
GQ227692_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
GQ227693_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQ
GQ227694_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQ
GQ227695_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQ
GQ227696_HBc_P-C      PHHTALRQAILCWGELMNLTTWVGSNLEDQASRDLVVSYVNVNMGLKIRQ
GQ227697_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
GQ358153_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLKLRQ
GQ377518_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377526_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
GQ377543_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQ
GQ377545_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQ
GQ377552_HBc_P-C      PPHTALRQAILCWGELMNLTPWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377555_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377557_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
GQ377575_HBc_P-C      PHHTALRQAVLCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377583_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377586_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
GQ377597_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQ
GQ377599_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
GQ377605_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377608_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
GQ377609_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377620_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
GQ377623_HBc_P-C      HHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQ
GQ377628_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475318_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475320_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475324_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475325_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475326_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475336_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475337_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
GQ475341_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
GQ475343_HBc_P-C      PHHTALRQAILCWGELMDLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
GQ475344_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKVRQ
GQ475351_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
GQ475355_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKARQ
GQ475356_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
GQ855528_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
GQ855541_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIKQ
GQ855543_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ872210_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924609_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924612_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924613_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924615_HBc_P-C      YHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
GQ924616_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924619_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924620_HBc_C-C      PHHTALRQATLCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924622_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
GQ924629_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924636_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924642_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKLRQ
GQ924643_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
GQ924650_HBc_P-C      HHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924655_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
GQ924658_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
GU827639_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPTSREAVVGYVNVNMGLKLRQ
HM011468_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLDDPASRELVVSYVNVNMGLKIRQ
HM011481_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
HM011486_HBc_P-C      PHHTALRQAIXCWGELMNLATWVGSNLEDPASREXVVSYVNVNMGLKIRQ
HM011488_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
HM011491_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
HM011495_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM011497_HBc_P-C      SHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM011500_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
HM011502_HBc_P-C      PHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM042269_HBc_P-C      PHHTALRQAILCWGELMTLVTWVGVNLEDPASRDLVVSYVNTNMGLKFRQ
HM750135_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM750141_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HQ700476_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLXDPASRELVVSYVNINMGLKIRQ
HQ700490_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNINMGLKIRQ
HQ700506_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HQ700517_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HQ700522_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HQ700543_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNXAXXXKX
HQ700559_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQ
HQ700569_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKXRQ
HQ700570_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQ
HQ700571_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
HQ700575_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGGNLEDPASRELVVNYVNINMGLKLRQ
HQ700576_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNXNMGLKIRQ
HQ700577_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLXDPASREXVVSYVNINMGLKIRQ
HQ700578_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLQDQASRELVVSYVNINMGLKIRQ
JF828905_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQ
JF828910_HBc_P-C      PHHTALRQAILCWGGLMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQ
JF828937_HBc_P-C      PHHTALRQAILCWGELMNLATWAGSNLEGPASRELVVSYVNVNMGLKIRQ
JN104434_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
JN104437_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYANVNMGLKIRQ
JN315779_HBc_P-C      PHHTALRQAILCWGELLNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN400087_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827416_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ027317_HBc_P-C      PHHTALRQAILCWGELMNLATWVGXNLEDPASRELVVGYVNVNMGLKLRQ
JQ027318_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ027322_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
JQ027323_HBc_P-C      PHHTALRQAIXCWGELMNLATWVGSNLDDPASRELIVSYVNVNMGLKXRQ
JQ027324_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
JQ027332_HBc_P-C      PHHTALRQASLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
JQ027333_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
JQ040129_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQ
JQ040131_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDXASRELVVGYVNVNMGLKLRQ
JQ040132_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040135_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040139_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLQDPASRELIVNYVNVNMGLKIRQ
JQ040141_HBc_P-C      PHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040143_HBc_P-C      PHHTALRQAFVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040144_HBc_P-C      PHHTALRQAILCWGELMNLATWVGXNLEDPASRELVVGYVNVNMGLKLRQ
JQ040145_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040149_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELXVXYVNVNMGLKIRQ
JQ040151_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQ
JQ040152_HBc_P-C      PHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040156_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
JQ040158_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPGSRELVVSYVNVNMGLKIRQ
JQ040164_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
JQ040165_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040166_HBc_P-C      PHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040167_HBc_P-C      PHHTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040168_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
JQ040172_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
JQ341517_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPTSREAVVSYVNVNMGLKIRQ
JQ341518_HBc_P-C      PHHTALRQAIXCWGELMNLATWVGXNLEDXXSRXLVVSYVNVNMGLKIRQ
JQ341541_HBc_P-C      PHHTALRQAILCWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ341544_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ341545_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQ
JQ429078_HBc_P-C      PHHTAIRQVILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ707707_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
JQ707708_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
JQ707768_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
JQ801472_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
JQ801473_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801480_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLDDPASREVVVSYVNVNMGLKIRQ
JQ801489_HBc_P-C      PHHTALRQAILCWGESMNLATWVGSNLEDPASRELVVSYVNVNVGLKIRQ
JQ801491_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRQ
JQ801493_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801495_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPGSRELVVSYVNVNMGLKIRQ
JQ801499_HBc_P-C      YHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
JQ801500_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRESVVSYVNVNMGIKIRQ
JQ801501_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801503_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQ
JQ801508_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGGNLQDPASREAVVNYVNVNMGIKIRQ
JQ801510_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801515_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801517_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGIKFRQ
JQ801518_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
JQ801520_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801522_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801523_HBc_P-C      PHHTALRQAILCWGELMNLAAWVGSNLEDPASRELLVSYVNVNTGLKIRQ
JX026877_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX026878_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX026880_HBc_P-C      PHHTALRHAILCWGELMNLATWVGGNLEDQASRELVVGYVNVNMGLKLRQ
JX026888_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLQDPASRELVVSYVNVNMGLKIRQ
JX429905_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX429912_HBc_P-C      PHHTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX429918_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
JX504535_HBc_P-C      PHHTAIRQAILCSGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQ
JX504536_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
JX504539_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQ
JX507211_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVNYVNVNMGLKLRQ
JX507212_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPTSREAVVGYVNVNMGLKLRQ
JX507214_HBc_P-C      PHHTTLRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX560519_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKVRQ
JX661497_HBc_P-C      PHHTALRQAFLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX870000_HBc_P-C      LHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
KC315399_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
KC774179_HBc_P-C      PHHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQ
KC774182_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774199_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KC774207_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQ
KC774221_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774226_HBc_P-C      PHHTALRQAILGWVELINLAPWGGSNLKNPPSRELLFTFVNVNMGLKIKQ
KC774240_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIFSYVNVNMGLKIKQ
KC774252_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774253_HBc_P-C      PHHTALRQAIVCWGELSNLATWVGSNLEDPASRELVVRYVNVNMGLKLRQ
KC774284_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KC774286_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774288_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLKP
KC774296_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774300_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774302_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
KC774306_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLDDPASRELVVSYVNVNMGLKIRQ
KC774311_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
KC774313_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KC774319_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
KC774321_HBc_P-C      PHHTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KC774331_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774340_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KC774352_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774353_HBc_P-C      PHHTALRQATLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774354_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELIVSYVNVNMGLKIRQ
KC774357_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774358_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRR
KC836842_HBc_P-C      PHHTAIRQAVLCWGELMNLATWVGSNLQDQASRELVVGYVNINMGLKFRQ
KC875263_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC875264_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC875265_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC875268_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC875269_HBc_P-C      PHHTALRQAILCWGELMTLATWVGSNLEDPASRELVVSYVNVNMGLKIRE
KC875271_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGVKIRQ
KC875273_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KF165568_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRR
KF166858_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNDNMGLKTRQ
KF214651_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
KF214652_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KF214667_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVNHVNVNMGLKIRQ
KF214669_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KF214670_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQ
KF214671_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KF214675_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLNLRQ
KF214677_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KF485390_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVXSYVNVNMGLKIRQ
KF779327_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVNYVNINMGLKIRQ
KF873514_HBc_P-C      AHHTALRQAILCWGALMNLATWVGSNLDDPASRELVVSYVNVNMGLQIRQ
KF873516_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KF873520_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLNDPASRELVVNYVNVNMGLKFRQ
KF873536_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKXRQ
KF873539_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELXVSYVNVNMGLKIRQ
KF873541_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KF873544_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDXASRELVVXYVNVNMGLKXRQ
KJ173287_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173290_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
KJ173295_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRR
KJ173302_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173316_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
KJ173319_HBc_P-C      PHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KJ173393_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQ
KJ410489_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KJ410491_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KJ410496_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ410498_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ410505_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KJ410510_HBc_P-C      PHHTAFRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGMKISQ
KJ410511_HBc_P-C      PHHTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
KJ410514_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVRYVNVNMGLKIRQ
KJ410515_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNTNMGLKLRQ
KJ410518_HBc_P-C      AHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVNYVNVNMGLKLRQ
KJ410521_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKFRQ
KJ598639_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598642_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598644_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598646_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KJ598649_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
KJ598650_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598654_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598656_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598658_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
KJ598662_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKLRQ
KJ598663_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
KJ598665_HBc_P-C      PHHKALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
KJ598667_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVYVNMGLKIRQ
KJ598671_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
KJ598672_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
KJ598679_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQ
KJ598680_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQ
KJ598720_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598721_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
KJ598722_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598723_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598726_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598727_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
KJ598741_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KJ598752_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KJ598762_HBc_P-C      PHHTALRQAILCCGELMNLATWVGNNLEDQASRELVVSYVNANMGLKIRQ
KJ598780_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803754_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKLRQ
KJ803757_HBc_P-C      HHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKIRQ
KJ803760_HBc_P-C      PHHAALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
KJ803761_HBc_P-C      PHHTALRQAILCWGELLNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803762_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
KJ803766_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803770_HBc_P-C      PHHTALRQAIVCWGEVMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803774_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803776_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGGNLEDPTSREAVVGYVNVNMGLKFRQ
KJ803777_HBc_P-C      PHHTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQ
KJ803779_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803780_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KJ803790_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803809_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRESVVSYVNVNMGLKIRQ
KJ803810_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803812_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803814_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803815_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803823_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803826_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KM875404_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KM875412_HBc_P-C      PHHTALRQVILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKLRH
KM875424_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQ
KM875425_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQ
KM875428_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQ
KP148315_HBc_P-C      PHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148462_HBc_P-C      PHHTALRQAILCWGELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148470_HBc_P-C      PHHTALRQAILCWGELMDLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148474_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVSVNMGLKIRQ
KP148475_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148476_HBc_P-C      PHHTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148480_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148488_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148520_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148525_HBc_P-C      PHHTALRQAILRWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148526_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVHMGLKIRQ
KP148534_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
KP148540_HBc_P-C      PHHTALGQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148546_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148547_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148548_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVDVNMGLKIRQ
KP148557_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148559_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148562_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148563_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKLRQ
KP148564_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148566_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148568_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013761_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013762_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013764_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013768_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013771_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013772_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013773_HBc_P-C      PHHTALRQAILCRGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013777_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRESVVSYVNVNMGLKLRQ
KR013780_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013781_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013784_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013788_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013789_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKIRQ
KR013792_HBc_P-C      PHHTALRQAILCWGELMDLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013793_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLKDPASRELVVSYVNVNMGLKIRQ
KR013796_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMDLKIRQ
KR013797_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013800_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KR013801_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLNIRQ
KR013802_HBc_P-C      PRHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013803_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIGQ
KR013804_HBc_P-C      PHHTALRQAILCWVELMNLATRVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013805_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVASYVNVNMGLKIRQ
KR013808_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013809_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013814_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIGQ
KR013817_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KR013819_HBc_P-C      PHHTALRQAILCWGEWMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013820_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KR013822_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQ
KR013823_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQ
KR013824_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KR013831_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013833_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQ
KR013837_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013840_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKTRQ
KR013846_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013847_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013850_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KR013851_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPAFRELVVGYVNVNMGLKLRQ
KR013853_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNSEDPASRELVVSYVNVNMGLKIRQ
KR013854_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEGPASRELVVSYVNVNMGLKIRQ
KR013855_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013856_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013861_HBc_P-C      PHHTALRRAILCWGELMNLATWVGSNLEDPASREFVVSYVNVNMGLKLRQ
KR013862_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013868_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KR013870_HBc_P-C      PHHAALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KR013871_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013872_HBc_P-C      PHHTALRQAILCWGGLMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KR013874_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KR013904_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013935_HBc_P-C      PHHTALRQAILCWGELMTLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013942_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKVRQ
KR013943_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013961_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013974_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013984_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013993_HBc_P-C      PHHTALRQAIPCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013996_HBc_P-C      PHHTTLRQAILCWGELMNLATWVGGNLEDPASRELVVSYVYVNMGLKIRQ
KR013998_HBc_P-C      PHHTALWQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR014006_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR014041_HBc_P-C      PHHTALRQALLCWGVVMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR014055_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KR014059_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEGPASRELEVSYVNVNMGLKIRQ
KR014098_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KR014099_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KR819180_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
KT284757_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT307719_HBc_P-C      PHPTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT347089_HBc_P-C      AHHTALRHAIVCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQ
KU576115_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576118_HBc_P-C      PHHTALRQAILCWVELMSLATWVGRNLEDPASRELVVSYVNVNMGLKIRQ
KU576122_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576123_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576142_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576193_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
KU576196_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
KU576284_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576449_HBc_P-C      PHHTALRQAILCWVELMNLATWVESNLEDPASRKLVVNYVNVNMGLKIRQ
KU576453_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSHVNINMGLKMRQ
KU576454_HBc_P-C      PHHTALRQAILCWGELMNLAAWVGSNLEDPASRELVVSYVNVNMGLKMRQ
KU576455_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
KU576457_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
KU576580_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSDLEDPASRELVVSYVNVNMGLKIRQ
KU576581_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576584_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576588_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNINMGLKIRQ
KU576643_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576677_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576688_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKVRQ
KU576696_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEGPASRELVVSYVNVNMGLKIRQ
KU576747_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVKVNMGLKLRQ
KU576858_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576860_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KU576919_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576920_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU576951_HBc_P-C      PHHTALRQAILCWVELMSPATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU577024_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRKLVVNHVNVNMGLKIRQ
KU577049_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNVNMGLKLRQ
KU577055_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU577056_HBc_P-C      AHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNVNMGLKLRQ
KU577057_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNVNMGLKLRQ
KU577062_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
KU667409_HBc_P-C      PHHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU667576_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU667678_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KU667914_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYDNVNMGIKIRQ
KU667964_HBc_P-C      PHHTALRQAILCWGELMDLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
KU667969_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
KU668000_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
KU668018_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQ
KU668050_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGGNLEDPASRDLVVSYVNVNMGLKIRQ
KU668127_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KU668135_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
KU668181_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
KU668197_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
KU668271_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KU668280_HBc_P-C      PHHTALRQAILCWGELMNLATW-GSNLEDPASRELVVSYVNVNMGLKIRQ
KU679936_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKIRQ
KU679937_HBc_P-C      XXHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU679947_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU679951_HBc_P-C      PHHTXLRQAILCWGELMNLATWVGXNLEDXASRXLVVSYVNXNMGLKLRQ
KU679957_HBc_P-C      PHHTALRQAILCWGELMSLATWVGSNLQDPASRELVVNYVNVNMGIKLRQ
KU679960_HBc_P-C      XHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963874_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNVEDPASRELVVGYVNVNMGLKLRQ
KU963882_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963898_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963917_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVDMGLKLRQ
KU963926_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KU963937_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963992_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963996_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963997_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964004_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964011_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964016_HBc_P-C      PHHTALRQAILCWVELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQ
KU964023_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964045_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLQDPASRELVVSYVNVNMGLKIRQ
KU964049_HBc_P-C      PHHTALRQAILCWGELMNLATWVRSNLEDPASRELVVSYVNVNMGLKIRQ
KU964076_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQ
KU964077_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKITQ
KU964078_HBc_P-C      PHHTTLRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964180_HBc_P-C      PHHTALRQAILCWGELMKLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964185_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRR
KU964191_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964198_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964200_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQ
KU964201_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQ
KU964214_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964222_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964223_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDLASRELVVSYVNVNMGLKIRQ
KU964226_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964228_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964318_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964321_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964343_HBc_P-C      AHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQ
KU964349_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KX276831_HBc_P-C      PHHTALRQAILCWGELMNLATWVGXNLEDXASRELVVGYVNVNMGLKLRQ
KX276833_HBc_P-C      XHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX276835_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX276836_HBc_P-C      PHHTALRQAFLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX276838_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPXSRDSVVSYVNVNMGLKFRQ
KX276839_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKFRQ
KX276840_HBc_P-C      SHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
KX276841_HBc_P-C      PHHTALRQQILCWGELMNLATWVGGNLEDPASRDAVVSYVNVNMGLKLRQ
KX276844_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLXDPGSREAVVSYVNVNMGLKIRQ
KX276847_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKLRQ
KX276849_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGIKIRQ
KX276851_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KX276852_HBc_P-C      XHHTALRQAIVCWGELXNLATWVGSNLEDPASRELVVGYVNXNMGLKIRQ
KX276853_HBc_P-C      PHHTALRQAILCWGELMNLATWVGXNLBDQASRELVVXYVNVNMGLKIRQ
KX276854_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX276855_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765822_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KX765828_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KX765829_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765842_HBc_P-C      HHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765849_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY353910_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQ
KY363253_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY363256_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY363258_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
KY363260_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY363264_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQ
KY363266_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY363267_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQ
KY363274_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY363275_HBc_P-C      PHHTALRQAIVCWGELMNLATWVESNLEDPASRGLVVSYVNVNMGLKIRQ
KY363276_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY363277_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLNIRQ
KY363282_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
KY363283_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQ
KY363285_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKLRQ
KY363286_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY363287_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY470873_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470874_HBc_P-C      PHHTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVNVNMGQKIRQ
KY470875_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470886_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470896_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470900_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470908_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVDVNMGLNIRQ
KY470910_HBc_P-C      PHHTALGQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KY470911_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLNIRQ
KY470913_HBc_P-C      PHHTALRQAILCWGVLMNLATWVGGNLEDPASRELVVSYVNVNMGLKLRQ
KY470918_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
KY470925_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVGYVNVNMGLKLRQ
KY470934_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470937_HBc_P-C      PHHTALRQAILCCGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470965_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470966_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASGELVVSYVNVNMGLKIRQ
KY470967_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVSMGLKIRQ
KY470968_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470971_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470975_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470976_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470978_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPAPRELVVSYVNVNMGLKIRQ
KY470983_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY629637_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY689435_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY689471_HBc_P-C      PHHTALRQAXLXWXELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
KY689518_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY689525_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881802_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881803_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881806_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881807_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881810_HBc_P-C      PHYTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881812_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881814_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881818_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881819_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNSEDPASRELVVSYVNVNMGLKIRQ
KY881871_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881872_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881873_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881874_HBc_P-C      SHHAALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881876_HBc_P-C      SHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881878_HBc_P-C      PHHTALRQAILRWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881881_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881884_HBc_P-C      PHHSALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881885_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLKDPASRELVVSYVNVNMGLKIRQ
KY881886_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881887_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881888_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881889_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881890_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881891_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881915_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881917_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881920_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881938_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881959_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881961_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLEIRQ
KY881963_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881966_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881968_HBc_P-C      PPHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881971_HBc_P-C      PHHTALRQAILCWVELMDLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881972_HBc_P-C      PHHTALRQAILCWVALMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881974_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881977_HBc_P-C      PHHTTLRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881978_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881979_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
KY881981_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881983_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881988_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881989_HBc_P-C      PHHTALRQTILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881991_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881992_HBc_P-C      PYHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY881994_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLGDPASRELVVSYVNVNMGLKIRQ
KY881997_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881999_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
KY882001_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPAPRESVVSYVNVNMGLKIRQ
KY882002_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279246_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279250_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279253_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279258_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279261_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456110_HBc_P-C      PHHTALRQVVLCWGELMSLATWVGSNLEDPASREAVVSYVNVNMGLKIRQ
LC456113_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKFRQ
LC456114_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
LC456118_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456121_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456122_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456123_HBc_P-C      PHHTALRQIILCWGELMNLATWVGGNLDDPSSREAVVSYVNVNMGLKIRQ
LC456124_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
LC456126_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
LC456129_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456134_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKLRQ
LC516606_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKVRQ
LC516609_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
LC516610_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
LC519790_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
LC519792_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
LC519799_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
LC519813_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
LC519818_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC519821_HBc_P-C      PHHTALRQAILCWGDLMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQ
LC519822_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF488701_HBc_P-C      PHHTALRQAILCWVEVTNLATWVGSNLEDPASRELVVGYVNGNMGPKIRQ
MF488703_HBc_P-C      PLRTGLRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKLRQ
MF568467_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
MF674390_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNVNMGLKLRQ
MF674411_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674425_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQ
MF674428_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674430_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVTYVNVNMGLKFRQ
MF674444_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQ
MF674463_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674471_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674474_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674475_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674486_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674514_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
MF925369_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF925374_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
MF925378_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF925394_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGLKIRQ
MF925395_HBc_P-C      PHHTALRQAVVCWAELMNLATWVGSNLEDPASRELVVSYVNGNMGLKFRQ
MF925403_HBc_P-C      PHHTALRQIVLCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQ
MF925405_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF925409_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG571332_HBc_P-C      HHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVGYVNVNMGIKLRQ
MG571335_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREXVVSYVNVNMGLKLRQ
MG571345_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826122_HBc_P-C      YHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
MG826123_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826124_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQSSRDLVVGYVNVNMGLKLRQ
MG826126_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRESVVGYVNVNMGIKIRQ
MG826129_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826132_HBc_P-C      PLHIALRRAILRWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826136_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826137_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLDDPASRELVVGYVNVNMGLKLRQ
MG826138_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSHVNVNMGLKIRQ
MG826139_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKIRQ
MG826140_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
MG893556_HBc_P-C      PRHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG893558_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MH818373_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
MH891502_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MK037655_HBc_P-C      PHHTAIRQAILCWGELVNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQ
MK037843_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK038372_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK038386_HBc_P-C      PHHTALRRAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK038389_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK038393_HBc_P-C      PHRTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK286461_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNXGLKIRQ
MK321266_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534557_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDQASRELVVSYVNVNMGLKLRQ
MK534586_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534596_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MK534597_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MK534657_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534671_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVTMGLQMRQ
MK534678_HBc_P-C      PHHTALRQAILCWGDLMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQ
MK534720_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQ
MK720629_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT114171_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426108_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426250_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426255_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426263_HBc_P-C      PHHTALRQAILCWGELMNLATSVGSNLEDPASRELVVSYVNVNMGLKITQ
MT426264_HBc_P-C      PHHTALRQAILCWGELMNLATSVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426265_HBc_P-C      PHHTALRQAILCWGELMNLATWVGNNLEDPASRELVVSYVNVNMGLKIRQ
MT426272_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426277_HBc_P-C      PHHTALRQAILCWGELMNLATSVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426283_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426287_HBc_P-C      PHHTALRQAILCWGELMNLATSVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426288_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426289_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426293_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426297_HBc_P-C      PHHTALRQAILCWGELMNLATLVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426298_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426306_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426312_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426324_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVDMGLKIRQ
MT426326_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426347_HBc_P-C      PHHTAPRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426350_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426351_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDRASRELVVSYVNVNMGLKIRQ
MT426352_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426354_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426355_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426369_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426373_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426374_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426383_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426384_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426405_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426415_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426418_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426422_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426435_HBc_P-C      PHHTALRQVILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426440_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426448_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426458_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRE
MT426552_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNTGLKIRQ
MT426577_HBc_P-C      PHHTGVRQAIVCWGELMNLAPWVGSNLEDPAPRELVVSYVNVNMGLKIRQ
MT426579_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426582_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426585_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASSELVVSYVNVNMGLKIRQ
MT426589_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426603_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426622_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKISQ
MT426644_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426647_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426663_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426666_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426673_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426677_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426684_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426685_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDSASRELVVSYVNVNMGLKIRQ
MT426691_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQ
MT426700_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKIRQ
MT426704_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426711_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426729_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRG
MT426732_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426734_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426739_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426740_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426747_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426750_HBc_P-C      PHHTALRQATLCWGELMNLATWVRSNLEDPASRELVVSYVNVNMGLKIRQ
MT426751_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426762_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426780_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426795_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426802_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426810_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426827_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426837_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKIRQ
MT426838_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426843_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426844_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426848_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426849_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT644996_HBc_P-C      PHHTAIRQVIVCWGELMNLATWVGSNLDDPASREVVVSYVNVNMGLKIRQ
MT644997_HBc_P-C      AHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRQ
MT644998_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQ
MT644999_HBc_P-C      PHHTAVRQIILCWGELMNLATWVGSNVENPASRELIVSYVNVNMGLKIRQ
MT645004_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT645006_HBc_P-C      PHHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLTIRR
MT645007_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGGNLQDQQSRELVVGYVNGNMGLKFRQ
MT645008_HBc_P-C      YHHTALRQAILCWGELVNLATWVGSNLDDPASRELVVGYVNGNMGLKIRH
MT645009_HBc_P-C      PHHTALRQAIVCWGEVTNLATWVGGNLEDQASRELVVSYVNDNMGLKIRQ
MT645010_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGGNLQDQASREAVVGYVNVNMGIKIRQ
MT645011_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVGYVNVNMGLKLRQ
MT645012_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGIKIRQ
MT645013_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLQDQTSREAVVSYVNVNMGLKIRQ
MT645014_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT645019_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDQGSRDLVVSYVNVNMGLKVRQ
MT645020_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKLRQ
MT645021_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQ
MT645022_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLQDPTSREAVVSYVNVNMGLKIRQ
MT645023_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT645024_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
MT645027_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLDDPASRDLVVNYVNVNMGLKLRQ
MT645033_HBc_P-C      PHHTALRQGIVCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQ
MT645036_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQ
MT645037_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLQDQASRELVVNYVNVNMGLKFRQ
MT645038_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
MT645040_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQ
MT645043_HBc_P-C      PHHTALRQAILCWGDLMNLATWVGGNLDDPASRELVVGYVNVNMGLKIRQ
MT645046_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVDMGMKLSQ
MT645050_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKISQ
MT645051_HBc_P-C      AHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKFRQ
MT645052_HBc_P-C      PHHTALRQALLCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT645053_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQ
MT645054_HBc_P-C      PHHTALRQEILCWGELMNLATWVGSNLDDPTSREAVVSYVNVNMGLKIRQ
MT645059_HBc_P-C      PHHTALRQAILSWGELMNLATWVGSNLEDPASRELVVSYANVNMGLKIRQ
MT645072_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDQASRDLVVSYVNVNMGLKIRQ
MW310259_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNSEDPASRELVVSYVNVNMGLKIRQ
MW310260_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVGYVNVNMGLKLRQ
MW675885_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MW847936_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MW887641_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGGNLEDPASRDVVVGYVNGNMGLKFRQ
MW887642_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPSSRELVVSYVNVNMGLKLRQ
MW887643_HBc_P-C      PHHTALRQAILCWSELMNLATWVGSNLDEPASRDLVVSYVNVNMGLKFRQ
MW887646_HBc_P-C      HHHTALRQAILCWVELMNLATWVGGNLEDPASRELVVNHVNVNMGLKIRQ
MW887647_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGGNLEDPASREAVVSYVNINMGLKIRQ
MW887650_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKXRQ
MW887651_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
MW887652_HBc_P-C      AHHTAIRQAFVCWGELLNLATWVGSNLDDPTSREAVVSYVNVNMGLKIRQ
MZ439270_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
MZ439286_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELAVSYVNVNMGLKFRQ
MZ439290_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVRYVNVNMGLKFRQ
MZ439300_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVRYVNVNMGLKFRQ
MZ439309_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRH
MZ439316_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439319_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439320_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439323_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439325_HBc_P-C      PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439331_HBc_P-C      PHHTALRQAVLCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439391_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439392_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439397_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439408_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439409_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLNFRR
MZ439418_HBc_P-C      PHHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLNFRR
MZ439424_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439437_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439465_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439488_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439552_HBc_P-C      PHHTALRQALLCWGELMTLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439554_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439557_HBc_P-C      PHHTALRQALLCWGELMTLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439560_HBc_P-C      PHHTALRQALLCWGELMTLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439562_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439565_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439566_HBc_P-C      PHHTALRQALLCWGELMTLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439570_HBc_P-C      PHHTALRQALLCWGELMTLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ439580_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439582_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ439601_HBc_P-C      YHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
MZ439605_HBc_P-C      YHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
MZ439624_HBc_P-C      YHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQ
MZ439629_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQ
MZ439632_HBc_P-C      PHHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKIRQ
MZ439640_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439642_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439647_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439650_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439652_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439653_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVGYVNVNMGLKLRQ
MZ439654_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
MZ439658_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQ
MZ439662_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVGYVNVNMGLKLRQ
MZ439663_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKLRQ
MZ439664_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQ
MZ439667_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439669_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439672_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439677_HBc_P-C      PHHTAIRQASLCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKFRQ
MZ439678_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439681_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKLRQ
MZ439683_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKLRQ
MZ439690_HBc_P-C      PHHTAIRQASLCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439691_HBc_P-C      AHHTALRQAILCWGELMNLATWVGSNLEDPASREAVVGYVNVNMGLKIRQ
MZ439695_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLNDPASREAVVGYVNVNMGLKFRQ
MZ439697_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439702_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLNDPASREAVVGYVNVNMGLKFRQ
MZ439711_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439716_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ439721_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLNDPASREAVVGYVNVNMGLKFRQ
MZ439726_HBc_P-C      PHHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQ
MZ671234_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MZ671235_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ671241_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQ
MZ671242_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVGYVNVNMGLKIRQ
MZ671246_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
OK106255_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
OM471090_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
OM471110_HBc_P-C      HHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
OM471136_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
OM732334_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQ
ON093164_HBc_P-C      PHHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
ON402774_HBc_P-C      PHHTALRQAILCWVEVMNLATWVGSNSEDPASRELVVSYVNVNMGLKIRQ
ON402776_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVYMGLKIRQ
ON402777_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVTYVNVNMGLKVRQ
ON402779_HBc_P-C      PHHTALRQAILCWGELMNLATWLGSNLEVPASRGLVVSYVNVNMGLKIRQ
ON402782_HBc_P-C      PHHTALRQAILCWVDLMNLATWVGSNSEDPASRELVVSYVNVNMGLKIRQ
OX341769_HBc_P-C      PHHTAIRQAVLCWGELMNLASWVGGNLEDPASRELVVSYVNVNMGLKLRQ
X52939_HBc_P-C        PHHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB697494_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVSYVNVNMGIKIRQ
AB014368_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB026811_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB026812_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB026814_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB026815_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB031262_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB033550_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB033551_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB033552_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB033556_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB050018_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB111119_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB111120_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB113879_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB198076_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB198077_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB198078_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB198079_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB198080_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB198081_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB198082_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB198083_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB205123_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB222714_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB222715_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB241110_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB241111_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB246345_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB247916_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB299858_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB300359_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB300362_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB300363_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB300365_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB362932_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367394_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367396_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367397_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367399_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367403_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367404_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367409_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367411_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB367417_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB426467_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB471848_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB471850_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB471852_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB471853_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB485808_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB540584_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB640730_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB642100_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670238_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670247_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670267_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670282_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670283_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670287_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670292_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670294_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670305_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB670307_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB675674_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB675675_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB675677_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB697490_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB697500_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB900116_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AB981580_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF068756_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF223954_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF223955_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF223956_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF223957_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF223958_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF223959_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF286594_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF324081_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF384364_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF384365_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF384366_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AF473543_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AJ748098_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AP011097_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AP011098_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AP011099_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AP011100_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AP011101_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AP011106_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AP011107_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY057947_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY206384_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY596107_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
AY641560_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
D12980_HBc_P-C        PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
D23680_HBc_P-C        PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
D50519_HBc_P-C        PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089758_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089763_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089765_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089769_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089779_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089781_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089783_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089789_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ089793_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ246215_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ315781_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ315783_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ377161_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ922650_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ993690_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
DQ993693_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EF688062_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU305540_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306673_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306685_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306688_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306689_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306690_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306691_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306694_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306713_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306714_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306720_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306721_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU306729_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU410080_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU410081_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU554535_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU554537_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU554538_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU562215_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU562217_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU570068_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU589345_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU871975_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU871977_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU871982_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916217_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916224_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916225_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU916237_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939549_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939580_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
EU939604_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023571_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023641_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023642_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023643_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023644_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023646_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023647_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023649_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023650_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023653_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023654_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023656_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023657_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ023658_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032331_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032332_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032340_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032341_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032350_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ032361_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ349225_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386575_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386577_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386587_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386588_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386591_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386607_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386619_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386623_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386639_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386664_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ386678_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ518813_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562218_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562244_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562245_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562258_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562269_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562274_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562275_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562282_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562283_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562297_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562298_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562320_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ562323_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715341_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715352_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715353_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715355_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715358_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715365_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715370_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715371_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715374_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715377_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715378_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715379_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715380_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715382_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715395_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715397_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715398_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715400_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715402_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715405_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715407_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ715409_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ787441_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ787447_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ787453_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ787454_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ787479_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ899763_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
FJ899775_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ358154_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ358158_HBc_C-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377514_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377515_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377517_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377523_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377524_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377527_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377528_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377529_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377531_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377533_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377535_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377536_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377538_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377540_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377541_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377546_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377551_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377553_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377554_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377559_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377562_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377563_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377570_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377571_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377572_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377574_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377576_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377578_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377579_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377580_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377584_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377585_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377591_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377598_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377600_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377601_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377603_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377615_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377616_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377617_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377618_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377619_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377624_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377631_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377637_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377640_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ377642_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475305_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475306_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475307_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475308_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475310_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475311_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475312_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475313_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475314_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475315_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475316_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475317_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475319_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475327_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475328_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475329_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475330_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475331_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475333_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475334_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475339_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475345_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475346_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475347_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475348_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ475350_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ855523_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ855525_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ855534_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ855544_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ855548_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924604_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924614_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924633_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GQ924649_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GU434374_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
GU563561_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM011465_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM011489_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM750131_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM750132_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM750136_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM750137_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM750138_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM750139_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
HM750140_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JF828913_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JF828915_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JF828916_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JF828917_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JF828918_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JF828919_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JF828920_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JF899336_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN104432_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN104433_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN104440_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827414_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827415_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827417_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827418_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827420_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827421_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827422_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827423_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827424_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JN827425_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040133_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040162_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ040163_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ688403_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ688404_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801470_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801475_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801482_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801486_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801488_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801496_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801497_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801504_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801505_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801511_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801513_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JQ801519_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX429904_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX429906_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX429907_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX429909_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX429913_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX429915_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX429916_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX429917_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX504537_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX504544_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX504545_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX504546_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX661489_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX661490_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX661492_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
JX661496_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774180_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774181_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774184_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774185_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774187_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774189_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774190_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774191_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774192_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774196_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774197_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774200_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774202_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774203_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774204_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774205_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774206_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774208_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774209_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774210_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774213_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774214_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774215_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774216_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774219_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774220_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774223_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774224_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774228_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774229_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774231_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774232_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774233_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774235_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774236_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774237_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774238_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774239_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774241_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774242_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774244_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774248_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774249_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774250_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774254_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774255_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774256_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774257_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774260_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774261_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774262_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774265_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774266_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774267_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774268_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774270_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774271_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774272_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774274_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774276_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774277_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774280_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774281_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774283_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774285_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774287_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774289_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774290_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774292_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774293_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774295_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774298_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774299_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774303_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774304_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774308_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774309_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774310_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774312_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774315_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774318_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774325_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774327_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774329_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774330_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774333_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774336_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774337_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774339_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774342_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774343_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774347_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774348_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774351_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774356_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774359_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC774360_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC875262_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC875267_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC875270_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KC875272_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KF214673_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KF485389_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KF495606_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173281_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173282_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173283_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173284_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173286_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173288_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173289_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173291_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173292_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173293_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173294_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173296_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173301_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173303_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173304_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173305_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173307_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173308_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173309_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173310_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173312_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173313_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173314_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173315_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173321_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173324_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173327_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173328_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173331_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173332_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173333_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173335_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173336_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173391_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173392_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173395_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173396_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173426_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173427_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173428_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173433_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173434_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173435_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173436_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173437_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173438_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173439_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173440_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173441_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173442_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173443_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173444_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ173446_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ410495_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ410501_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ410504_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ410513_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ410519_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598635_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598636_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598640_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598641_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598659_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598689_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598694_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598698_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598710_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598716_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598740_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598749_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ598753_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ790199_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803759_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803792_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803793_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803799_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803811_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KJ803818_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KM213037_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KM229703_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KM526744_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KM526745_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KM526746_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP027477_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148463_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148466_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148468_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148469_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148471_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148473_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148481_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148482_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148492_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148493_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148512_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148517_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148521_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148524_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148529_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148531_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148532_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148535_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148538_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148545_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148549_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148551_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148555_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148560_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148561_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148571_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148573_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP148574_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KP784761_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013763_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013774_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013776_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013779_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013782_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013783_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013785_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013786_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013787_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013791_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013794_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013798_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013799_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013810_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013811_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013812_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013813_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013815_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013827_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013828_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013829_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013830_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013834_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013858_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013873_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013875_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013877_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KR013909_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT284753_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT284754_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT284755_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT284756_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT307718_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT364718_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT364719_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT364720_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT364721_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT364751_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT364752_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT366463_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT987423_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT987424_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT987425_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KT987426_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU051424_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU051425_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU051426_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU051427_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963886_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963887_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963888_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963889_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963890_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963892_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963893_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963894_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963895_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963896_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963897_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963899_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963900_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963901_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963902_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963903_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963904_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963905_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963906_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963907_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963908_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963909_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963910_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963911_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963912_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963913_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU963914_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964020_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964021_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964022_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964024_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964025_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964026_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964027_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964028_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964029_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964030_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964031_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964032_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964033_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964034_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964035_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964036_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964037_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964038_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964039_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964040_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964041_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964042_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964043_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964044_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964047_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964048_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964050_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964051_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964052_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964053_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964054_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964055_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964056_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964057_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964058_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964059_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964060_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964061_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964062_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964063_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964064_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964065_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964066_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964067_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964068_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964069_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964070_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964071_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964072_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964073_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964074_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964075_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964169_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964170_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964171_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964174_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964176_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964178_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964181_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964183_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964184_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964187_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964188_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964192_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964193_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964194_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964195_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964196_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964197_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964199_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964218_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964224_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964225_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964334_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964336_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964337_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964338_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964339_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964340_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964341_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964342_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964344_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964345_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964346_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964347_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KU964348_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765818_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765819_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765820_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765821_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765823_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765824_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765825_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765826_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765827_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765830_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765831_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765832_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765833_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765836_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765837_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765838_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765840_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765843_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765844_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765845_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765846_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765847_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765848_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765850_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765853_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX765855_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX774504_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KX774506_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY022423_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470876_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470877_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470878_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470879_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470881_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470882_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470884_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470885_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470889_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470890_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470891_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470892_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470894_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470895_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470897_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470899_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470901_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470902_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470903_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470904_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470905_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470929_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470980_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470981_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470982_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470984_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470985_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470986_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470987_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY470988_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY629631_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881736_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881737_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881738_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881739_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881742_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881743_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881744_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881748_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881749_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881750_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881751_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881754_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881755_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881758_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881762_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881763_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881764_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881765_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881766_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881767_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881768_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881769_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881770_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881771_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881772_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881773_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881774_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881775_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881776_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881777_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881980_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
KY881984_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC064754_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC064755_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC090200_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279245_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279247_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279248_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279249_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279254_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279255_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279256_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279257_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279259_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279260_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279262_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279274_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279275_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC279276_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC318702_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC318703_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC360507_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC373511_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC373512_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456117_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456125_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456128_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456130_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456131_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456132_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC456135_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC519796_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC519807_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC592171_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC592172_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
LC730886_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674386_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674388_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674402_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674408_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674412_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674418_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674429_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674435_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674442_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674454_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674472_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674484_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674494_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674501_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF674502_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF925365_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF925375_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF925377_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF925408_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MF925410_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG725248_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826127_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826128_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826131_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826133_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826134_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG826135_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG893557_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MG893560_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MH094411_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MH887433_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK038373_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK038381_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK038391_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK038394_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK038395_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534592_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534593_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534604_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534605_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534619_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534622_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534624_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534628_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534631_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534636_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534638_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534640_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534642_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534643_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534644_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534645_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534647_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534649_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534650_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534652_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534656_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534666_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534667_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534674_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK534677_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MK628732_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MN683726_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MN683727_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MN683728_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MN683729_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT111596_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426105_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426106_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426107_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426109_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426248_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426249_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426251_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426252_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426253_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426254_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426256_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426257_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426258_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426259_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426260_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426261_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426262_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426266_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426267_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426268_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426269_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426270_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426271_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426273_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426274_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426275_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426276_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426278_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426279_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426280_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426281_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426284_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426285_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426286_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426290_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426291_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426292_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426294_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426295_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426296_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426299_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426300_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426301_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426302_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426303_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426304_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426305_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426308_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426310_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426311_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426313_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426314_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426316_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426317_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426318_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426319_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426320_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426321_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426322_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426323_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426325_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426327_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426328_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426329_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426330_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426331_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426332_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426333_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426334_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426335_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426336_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426337_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426338_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426339_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426340_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426341_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426342_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426343_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426344_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426345_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426348_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426349_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426356_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426358_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426359_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426360_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426361_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426362_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426363_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426364_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426365_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426366_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426367_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426368_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426370_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426372_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426375_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426376_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426377_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426378_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426379_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426380_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426381_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426382_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426385_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426386_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426387_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426388_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426389_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426390_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426391_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426392_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426393_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426394_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426395_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426396_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426397_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426398_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426399_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426400_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426401_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426402_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426403_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426404_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426406_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426407_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426408_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426409_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426411_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426412_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426413_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426416_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426417_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426419_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426420_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426421_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426423_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426424_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426425_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426426_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426427_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426429_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426430_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426431_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426432_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426433_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426434_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426437_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426438_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426439_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426441_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426442_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426443_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426444_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426445_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426450_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426451_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426452_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426454_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426516_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426548_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426580_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426581_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426583_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426584_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426586_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426587_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426588_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426590_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426591_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426592_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426593_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426594_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426595_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426596_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426597_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426598_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426599_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426601_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426602_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426604_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426605_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426606_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426607_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426608_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426609_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426610_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426611_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426612_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426613_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426615_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426616_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426617_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426618_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426619_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426620_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426621_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426623_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426624_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426625_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426626_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426628_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426629_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426630_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426632_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426633_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426634_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426635_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426636_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426637_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426638_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426639_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426640_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426641_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426642_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426643_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426645_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426646_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426648_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426649_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426650_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426651_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426652_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426653_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426654_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426655_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426656_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426657_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426658_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426659_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426660_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426661_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426662_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426664_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426665_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426668_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426669_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426670_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426671_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426672_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426674_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426675_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426676_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426678_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426679_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426680_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426681_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426682_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426683_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426686_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426687_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426688_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426689_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426690_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426692_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426693_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426694_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426695_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426696_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426698_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426699_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426701_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426702_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426703_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426705_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426706_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426707_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426708_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426709_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426710_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426712_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426713_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426714_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426715_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426716_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426718_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426719_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426720_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426721_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426722_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426723_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426724_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426725_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426726_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426727_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426728_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426730_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426731_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426733_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426736_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426737_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426738_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426741_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426742_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426743_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426744_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426745_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426746_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426749_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426754_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426755_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426756_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426757_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426758_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426760_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426763_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426764_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426765_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426766_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426767_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426768_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426769_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426770_HBc_P-C      PHHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQ
MT426772_H