HBVdb

Dataset for protein HBc of genotype C

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                      .    :    
MDIDPYKEFGASVELLS-FLPSDFFPSIRDLLDTASALYREALESPEHCSPHHTALRQAILCWGELMNLATWVGSNLEDP
    t       a  i     a    nv e     t  h d        ta    i   vv  v   s      g  d q
    h                              a                                            
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         .      .   :    .                     .
ASRELVVsYVNVNMGLKiRQlLWFHISCLTFGRETVLEYLVSFGVWIRTPpAYRPPNAPILSTLPETTVVRRRGRSPRRR
   dai g   i   i l  i           sav               tp   q           a i q c ts   
                 f               d                l                    p        
                                 q                q                    c        
                                                  i                             

       170       180    
....:....|....:....|....
         .              
TPSPRRRRSQSPRRRRSQSRESQC
                tk  gp  
                    d   
                        
                        
© 1998-2022Legal notice