HBVdb

Dataset for protein HBSP of genotype B

[Download (right click)] [Sequences] [Repertoires]

2617 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KP659240_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADXXLNHRVAEDLNLGNPNDHQ
EU660224_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNQTE
AB010289_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
AB010290_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AB010292_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AB014366_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB031266_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
AB031267_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB033555_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRPVAEDLNLGNLNDHQ
AB048705_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQR
AB073821_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073822_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073823_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073824_HBSP_P-B      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDRQ
AB073825_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073826_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073830_HBSP_P-B      MPLSYQXFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073832_HBSP_P-B      MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AB073835_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073836_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073837_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073838_HBSP_P-B      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB073839_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073841_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073842_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
AB073843_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB073844_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB073846_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHHVAEDLNLGNPNDHQ
AB073847_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB073848_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB073849_HBSP_P-B      MPLSYQHFRKLXLLDDEAGPLEEELPRLADEGLNXRVAEDLNLGNPNDHQ
AB073850_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB073851_HBSP_P-B      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB073852_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB073853_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB073855_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AB073857_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPTDHQ
AB073858_HBSP_P-B      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQ
AB100695_HBSP_P-B      MPLSYPPFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB117759_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
AB195933_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB195934_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
AB205120_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB205122_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB212625_HBSP_P-B      MPLSYQHFRKLLLLDEQAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
AB219427_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB219428_HBSP_C-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB219430_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB231909_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGFNHRVAEDLNLGNLNDHQ
AB241116_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB246339_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
AB246343_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB287314_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
AB287316_HBSP_P-B      MPLSYQHFRKLLLLDDESGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
AB287317_HBSP_P-B      MPLSYQYFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
AB287320_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDPNDHQ
AB287321_HBSP_P-B      MPLSYQHFRKLLLLDDEAGALEEELPRLADPDLNHRVAEDLNLGDPNDHQ
AB287322_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
AB287323_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADQDLNRRVAEDLNLGNPNDHQ
AB287325_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
AB287326_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB287327_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADAGLNHRVAEDLNLGNPNDHQ
AB287329_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB300370_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB300371_HBSP_P-B      MPLSYQLFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB302095_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB302942_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB302945_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB362933_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB365445_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB493833_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB555499_HBSP_P-B      MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AB642093_HBSP_P-B      MPLSYQHFRKLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AB642094_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB713527_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB713528_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB713529_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
AB713530_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
AB713531_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB900095_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB900096_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AB900097_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADAGLNRRVAEDLNLGNPNDHQ
AB900098_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQ
AB900104_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQ
AB900105_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AB900106_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDPQ
AB900107_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB900108_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPDDHQ
AB900110_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB900112_HBSP_P-B      MPLSYQHFRKLLLLDDGAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB931168_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQ
AB931169_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQ
AF121243_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
AF121247_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF121248_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF121251_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF282917_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF461360_HBSP_P-B      MPLSYQRFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF461362_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF479684_HBSP_P-B      MPLSYQHFRKLLLLDGEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
AJ627225_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011086_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011087_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011092_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011093_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011094_HBSP_P-B      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY033072_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
AY033073_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
AY163869_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQ
AY167089_HBSP_P-B      MPLSCQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY167093_HBSP_P-B      MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY167094_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY167098_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY167100_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY167101_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQ
AY167102_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY206383_HBSP_P-B      MPLSYQRFRRLLLLEQDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY206387_HBSP_P-B      MPLSYQRFRKLLLLDGDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AY206390_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY206391_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY217357_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
AY217359_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
AY217360_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRIAEDLNLGNLNDHQ
AY217362_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY217364_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY217368_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY220698_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY518556_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY596103_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
AY596104_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY596105_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY596111_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AY800389_HBSP_P-B      MPLSYQPFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY800391_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
D00329_HBSP_P-B        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
D00331_HBSP_C-B        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
D23679_HBSP_P-B        MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
D50521_HBSP_P-B        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLGLGNLNDHQ
D50522_HBSP_P-B        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLGLGNLNDHQ
DQ361535_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ377158_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
DQ448622_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQ
DQ448624_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ448627_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ448628_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDHQ
DQ463788_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQ
DQ463789_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQ
DQ463791_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHR
DQ463792_HBSP_P-B      MPLSYQHFRKLLLLDTDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
DQ463793_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
DQ463794_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGDPNDHQ
DQ463795_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
DQ463799_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQ
DQ463800_HBSP_P-B      MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
DQ463801_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNLRVAEDLNLGNPNDHQ
DQ904357_HBSP_P-B      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993680_HBSP_P-B      MPLSYEDFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
DQ993685_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
DQ993687_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
DQ993696_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993698_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993700_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
DQ993704_HBSP_P-B      MPLYYQHFRKLLLLDEQAGPLEKELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993706_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993707_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
DQ993711_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGTLNDHQ
DQ995801_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ995802_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
DQ995803_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
DQ995804_HBSP_P-B      MPLSYQHFRKLLLLDQESGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
EF473971_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
EF473972_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
EF473973_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRPVADDLNLGNLNDHQ
EF473975_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVADDLNLGNLNDHQ
EF473976_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHP
EF473977_HBSP_P-B      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EF494382_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNHRVAKDLNLGTLNDHQ
EU139543_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU158262_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU158263_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
EU305547_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
EU305548_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
EU306677_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306681_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306696_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
EU306699_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306704_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306707_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRAAEDLNLGNLNDHQ
EU306711_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQ
EU330989_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU522072_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU547563_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU564822_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
EU564823_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
EU564826_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
EU570069_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
EU570075_HBSP_P-B      MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDRR
EU579441_HBSP_P-B      MPLSYQHFRKILLLDQDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRR
EU595031_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU660231_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
EU796066_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
EU796067_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU881997_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU881998_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU882002_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU882004_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU919171_HBSP_P-B      MPLSYQRFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQ
EU919172_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU919175_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU919176_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
EU939559_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939636_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
EU939637_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939638_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939639_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQ
EU939660_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939661_HBSP_P-B      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVADELNLGNLNDHQ
EU939665_HBSP_P-B      MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939667_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
EU939669_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939670_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGDLNEHQ
EU939673_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939674_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
EU939675_HBSP_P-B      MPLSYQHFRSVLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939676_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939677_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHP
EU939678_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ023631_HBSP_P-B      MPLSYQHFRKLLLLDQESGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ023632_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ023633_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
FJ023634_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ023635_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
FJ023636_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ023637_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEGLPRLADEGLNRRVAEDLNLGNLNDHQ
FJ032342_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
FJ032344_HBSP_P-B      MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDHQ
FJ032352_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ032353_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ032358_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386600_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386608_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHR
FJ386610_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386648_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGILNEHQ
FJ386654_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
FJ386655_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386660_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
FJ386666_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386669_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386676_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
FJ386681_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
FJ386682_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386683_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNEHQ
FJ386688_HBSP_P-B      MPLSYQRFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ518811_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ518812_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562219_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562222_HBSP_P-B      MPLSYQHFRKLLLLDEKAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562224_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562234_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562240_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
FJ562246_HBSP_P-B      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562254_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
FJ562257_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562260_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562262_HBSP_P-B      MPLSYQHFRRLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562296_HBSP_P-B      MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562303_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562311_HBSP_P-B      MPLSYQHFRKLLLLEGDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
FJ562312_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562316_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
FJ562322_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ787475_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ787476_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ787477_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ899779_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ899787_HBSP_P-B      MPLSYQHFRKLLSLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ358136_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHP
GQ358137_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGINRRVAEDLNLGNLNDPQ
GQ358138_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GQ358139_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDFNLGNLNDHQ
GQ358141_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ358142_HBSP_P-B      MPLSYRHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHP
GQ358143_HBSP_P-B      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ358145_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGLNRRVAEDLNLGNLNDHQ
GQ358147_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRLVAEDLNLGNLNDHQ
GQ358148_HBSP_P-B      MPLFYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377525_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
GQ377542_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377558_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377566_HBSP_P-B      MPLSYQHFRKLQLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377567_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377587_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377606_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377622_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQ
GQ377625_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAKDLNLGNLNDHQ
GQ377629_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377641_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHR
GQ377644_HBSP_P-B      MPLSYQHFRKLLLLEEDAGPLEEELHHLADEGLNRRVAEDLNLGNLNDHQ
GQ924605_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPXLAXEGLNRRVAEDLNLGNLNDHQ
GQ924607_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNGRVAEDLNLGNLNDHQ
GQ924608_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924617_HBSP_P-B      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLHDHQ
GQ924624_HBSP_P-B      MPLSYPLFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924626_HBSP_P-B      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
GQ924628_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
GQ924630_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
GQ924632_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924635_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDFNVGNVNDHQ
GQ924637_HBSP_P-B      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924638_HBSP_P-B      MPLSYQRFRKLLLLEDEAGPLEEELPRVADEGLNRRVAEDLNLGNLNDHQ
GQ924639_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRVADEGLNRRVAEDLNLGNLNDHQ
GQ924640_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924645_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHP
GQ924646_HBSP_P-B      MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924647_HBSP_P-B      MPLSYQRFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924648_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924651_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815548_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815550_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNPGNLNDPQ
GU815554_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815571_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815573_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNYPQ
GU815574_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815578_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815616_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815641_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815662_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLDRRVAEDLNLGNLNDHQ
GU815673_HBSP_P-B      MPLSYQHFRKLLLLGEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815709_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815712_HBSP_P-B      IPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815720_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815723_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNNHQ
GU815727_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815741_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815760_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815765_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNDHQ
GU815772_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815774_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011466_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
HM011467_HBSP_P-B      MPLSYQHFRKLLLLED-AGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011469_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQ
HM011470_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011471_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
HM011473_HBSP_P-B      MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011474_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAXDLXLGNXNDHQ
HM011475_HBSP_P-B      MPLSYQHFRKXLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
HM011476_HBSP_P-B      MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011478_HBSP_P-B      MPLSCQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
HM011482_HBSP_P-B      MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011483_HBSP_P-B      MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011487_HBSP_P-B      MPLSYQRFRKLLLLDDAAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011490_HBSP_P-B      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011492_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011494_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011496_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
HM011499_HBSP_P-B      MPLSYQHFRKLLLLDBEAGPLEEELPRLADEGLNRRVAEDLNLGBPXDHQ
HM011503_HBSP_P-B      MPLSYQHFRKLLXLDEGAGPLEEELPRLADEGLNRRVAEDLNLGXLNDHQ
HM011504_HBSP_P-B      MPLSYQRFRKLVLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HQ700546_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQ
HQ700548_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JN792894_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
JN792900_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
JN792901_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNLRVAEDLTLGNPNDHQ
JN792902_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNLRVAEDLTLGNPNDHQ
JN827419_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ027311_HBSP_P-B      MPLSYQHFRKLLLLDDEXGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQ
JQ027312_HBSP_P-B      MPLSYQHFRKLLLLDXXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ027313_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADDDLNRRVAEDLNLGNLNDHQ
JQ027315_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
JQ027325_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
JQ027329_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQ
JQ027330_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
JQ027334_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ040125_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRIAEDLNLGNLNDHQ
JQ040128_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQ
JQ040147_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ040157_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNXHQ
JQ040170_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ040171_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNDHQ
JQ341549_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341551_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341552_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341553_HBSP_P-B      MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ341554_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLXLGNLNDHQ
JQ341556_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
JQ341557_HBSP_P-B      MPLSYQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341559_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
JQ341560_HBSP_P-B      MPLSYQHFRRLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341561_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
JQ341562_HBSP_P-B      MPLSYQYFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341564_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341565_HBSP_P-B      MPLSYQHFRKLLLLDXXAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQ
JQ341567_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQ
JQ341569_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341571_HBSP_P-B      MPLSYXHFRKLLLLEDGAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
JQ341572_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLSLGNLNDHQ
JQ341576_HBSP_P-B      MPLSYPHFRRILLLDQDAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQ
JQ341577_HBSP_P-B      MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341578_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341580_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
JQ341581_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ341582_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
JQ341585_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDHQ
JQ341586_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341587_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNINDHQ
JQ341588_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEELNLGNLNDHQ
JQ341589_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGDLNDHQ
JQ341590_HBSP_P-B      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341592_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLHLGNINDHQ
JQ341594_HBSP_P-B      MPLSYQHFRKLLLLXXEAGPLEEELPRLADEGLNRRVAEDLXLGNLNDHQ
JQ341595_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341596_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
JQ341597_HBSP_P-B      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341600_HBSP_P-B      MPLSYQCFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
JQ341601_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ341603_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
JQ341605_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341606_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGXLNDHQ
JQ341607_HBSP_P-B      MPLSYQRFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
JQ341608_HBSP_P-B      MPLSYQHFRKLLLLDEKAGPLEEELPRLADEGLNRRVAEDLSLGNLNDHQ
JQ341609_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
JQ429079_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ429080_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQ
JQ707740_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNNHQ
JQ707745_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707747_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707750_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDRQ
JQ801474_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ801494_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ801506_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
JQ801516_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
JX026879_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX026881_HBSP_P-B      MPLSYQHFRRLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX026883_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
JX026886_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQ
JX429901_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
JX429908_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNFNDHQ
JX429910_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGILNDHQ
JX429911_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNCRVAEDLNLGNLNDHQ
JX504543_HBSP_P-B      MPLSYRHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
JX507213_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661473_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661484_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX869998_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JX869999_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNDHR
KC492739_HBSP_P-B      MPLSYQHFRRLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLTDHQ
KC510643_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510646_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510654_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774369_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774370_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLILGNLNDHQ
KC774372_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774379_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPR
KC774380_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KC774382_HBSP_P-B      MHLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774390_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774394_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774397_HBSP_P-B      MPLSYQHFRKILLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774401_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774407_HBSP_P-B      MPLSYQHFRKLLLLDEEAGLLEEELPRLADDGLNRRVAEDLNLGNLNDHQ
KC774409_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774410_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHP
KC774412_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774415_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLSLGNLNDHQ
KC774417_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774419_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792652_HBSP_P-B      MPLSYQHFRKLLLLDQDARPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KC792674_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792701_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792712_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQ
KC792717_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KC792719_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792742_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792745_HBSP_P-B      MPLSYQHFRKLLLLDHDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDQQ
KC792748_HBSP_P-B      MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLTDHQ
KC792765_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792767_HBSP_P-B      --LSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KC792777_HBSP_P-B      MPLSCQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLGLGTLNDQQ
KC792779_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792780_HBSP_P-B      MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQ
KC792786_HBSP_P-B      MPLSYQHFRKLLLLDEESGPLEEELPRLADEGLNRRVAEDLNLGXLNDHQ
KC792800_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792801_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDXQ
KC792811_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KC792843_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KC792859_HBSP_P-B      --LSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KC792860_HBSP_P-B      MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
KC792889_HBSP_P-B      --LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792896_HBSP_P-B      --LSYQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792897_HBSP_P-B      MPLSYQRFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792901_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KC792904_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNXNDHQ
KC792920_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQ
KC792935_HBSP_P-B      --LSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
KC792936_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLXLGBLNDHQ
KC792938_HBSP_P-B      MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792939_HBSP_P-B      --LSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KC792947_HBSP_P-B      MPLSYQHFRKLLLLEEDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
KC792949_HBSP_P-B      --LSYQHFRKLLLLDEEAGPLEEELPRLADEXLNRRVAXELNLGNXNXHQ
KC792955_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLHLGNLNDHQ
KC792970_HBSP_P-B      --LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792973_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
KC792974_HBSP_P-B      --LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792976_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLSLGXLNDHQ
KC792985_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQ
KC793004_HBSP_P-B      --LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KC793006_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC793030_HBSP_P-B      MPLSYQQFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC793042_HBSP_P-B      --LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC793061_HBSP_P-B      --LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KC793064_HBSP_P-B      --LSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC793069_HBSP_P-B      --LSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KC793076_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEXLNXRVABDLXLGNLNDPQ
KC793125_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KC793139_HBSP_P-B      --LSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC793141_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
KC793168_HBSP_P-B      --LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC793180_HBSP_P-B      MPLSYQRFRKLLLLDZEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC793189_HBSP_P-B      -PLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNHRVAEDLHLGNLNDHR
KC793199_HBSP_P-B      --LSYQRFRXLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KF053159_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADKGLNRRVAEDLNLGNLNDHQ
KF053162_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KF053163_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KF053171_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADKGLNRRVAEDLNLGNLNDHQ
KF053174_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
KF053180_HBSP_P-B      MPLSYPHFRRLLLLDQEAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQ
KF053182_HBSP_P-B      MPLSYPHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQ
KF053189_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KF053190_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173298_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173341_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173360_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173375_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
KJ173378_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLRNLNDHQ
KJ173385_HBSP_P-B      MRLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173397_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
KJ173399_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQ
KJ173401_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173403_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173420_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ410500_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KJ717792_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRFAEDLNLGNLNDHQ
KJ717795_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ717798_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDHQ
KJ717801_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KJ717808_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRFADDLNLGNLNDHQ
KJ717813_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ717817_HBSP_P-B      MPLSYQHFRKLVLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
KJ717818_HBSP_P-B      MPLSYQRFRKLLLLDQEAGPLEEELPRLADEGLNRRVAENLHLGDLNDHQ
KJ717820_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEDELPRLADEGLNRRVAEDLTLGNLNEHQ
KJ717829_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRFAEDLNLGTLNDHR
KJ717835_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ717836_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQ
KJ717837_HBSP_P-B      MPLSYQRFRKLLLLDTDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ717840_HBSP_P-B      MPLSYQHFRKLLLFDNAAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQ
KJ717842_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRFAEDLNLGNLNDHQ
KJ717843_HBSP_P-B      MPLSYQRFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ790200_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KJ803752_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADKGLNRRVAEDLNLGNLNDHQ
KJ843165_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQ
KM213032_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KM213034_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KM213035_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KM213036_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KM392084_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAXDLNLGNLNDHQ
KM875420_HBSP_P-B      MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148328_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148335_HBSP_P-B      MPLSYQHFWKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148341_HBSP_P-B      MPLSYQHFRKLPLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148373_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148374_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148377_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPR
KP148387_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPR
KP148399_HBSP_P-B      MPLSYQHFRKLLLLDDGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148401_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148405_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148406_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148407_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148420_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148426_HBSP_P-B      MPLSNQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148429_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148437_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148438_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDHNLGNLDDPQ
KP148452_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148453_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGFNRRVAEDLNLGNLNDHQ
KP148459_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAENLNLGNLNDHQ
KP148581_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406164_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406167_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406168_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KP406172_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KP406174_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KP406175_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KP406255_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406256_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KP406257_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNINDHQ
KP406258_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQ
KP406265_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406267_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KP406268_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406269_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406274_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406280_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNINDHQ
KP406284_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406290_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406291_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406297_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQQ
KP406298_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406302_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDQR
KP406304_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406331_HBSP_P-B      MPLSYQHFRKLLLLDEDAAPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP659220_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659223_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659234_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLKEELPRLANENLNHRVAKNLNLGNPNDHQ
KP659235_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLXEELPRLADEDLNHRVAXBLNLGNPNDHQ
KP659239_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADQDLNHRVAEDLNLGNPNDHQ
KP659244_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLXDEDLNHRVAEDLNLGNPNDHQ
KP659245_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADQDLNHRVAEELDLGIPNDHQ
KP659250_HBSP_P-B      MPLSYQCFRKLLLLDDVTGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQ
KP659251_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659253_HBSP_P-B      MPLSYQCFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659255_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNLRVAEDLNLGNPNDHQ
KR152339_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KT749820_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU963799_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963814_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963815_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNXXX
KU963854_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963946_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU964079_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964109_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964120_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964141_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964155_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964156_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964165_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLKLGNLNDHQ
KU964245_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQ
KU964257_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964258_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964259_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964265_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964267_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964287_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964293_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964302_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964381_HBSP_P-B      MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276771_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHR
KX276772_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276775_HBSP_P-B      MPLSYQRFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KX276777_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276778_HBSP_P-B      MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276779_HBSP_P-B      MPLSYQHFRKLLLLDZXAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
KX276782_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNINDHQ
KX276783_HBSP_P-B      MPLSYQHFRKLLLLEAGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KX276785_HBSP_P-B      MPLSXQHFRKLLLLDEXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276786_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQ
KX276787_HBSP_P-B      MPLSYQRFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276789_HBSP_P-B      MPLSYQRFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGDPNDHQ
KX276790_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
KX276792_HBSP_P-B      MPLSYQHFRXLLLLEZDAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQ
KX276793_HBSP_P-B      MPLSYQHFRKLLLLXQGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276794_HBSP_P-B      MPLSYQHFRKLLLLDEEXGPLEEELPRLADDDLNRRVAEDLNLGNLNDHQ
KX276795_HBSP_P-B      MPLSYXXFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQ
KX276796_HBSP_P-B      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHX
KX276797_HBSP_P-B      MPLSYQHFRXLLLLDKDAGPLEEELPRLADEGLNRRVAEDLXLGXLNDHQ
KX276798_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGXLNDHX
KX276799_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276800_HBSP_P-B      MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
KX276801_HBSP_P-B      MPLSYQHFRKLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHR
KX276802_HBSP_P-B      MPLSYQRFLKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276803_HBSP_P-B      MPLSYQRFRKLLLLDKEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KX276804_HBSP_P-B      MPLSYQRFRKLLLLXXXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276805_HBSP_P-B      MPLSYQRFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276806_HBSP_P-B      MPLSYQLFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276807_HBSP_P-B      MPLSYXXFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276809_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNXNDHQ
KX276810_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276811_HBSP_P-B      MPLSYQLFRKLLLLDNEAGPLEEELPRLADEXLNRRVAEDLNLGDLNDHQ
KX276812_HBSP_P-B      MPLSYQHFRKLLLLDNESGPLEEELPRLADEGLNRRVAEDLHLGNLNDHQ
KX276813_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276814_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276815_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276817_HBSP_P-B      MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNRRVAEDLDLGXPNDHQ
KX276818_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
KX276819_HBSP_P-B      MPLSYXHFRRLVLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KX276820_HBSP_P-B      MPLSYQHFRKLLLLDHXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276822_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGBLNDHQ
KX276823_HBSP_P-B      MPLSXQHFRKLLLLDBDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276824_HBSP_P-B      MPLSYQHFRKLXLLDBEAGXLEEELPRLADEGLNRRVAEDLNLGXLNDHQ
KX276825_HBSP_P-B      MPLSYQCFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
KX276827_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276828_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276829_HBSP_P-B      MXLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276858_HBSP_P-B      MPLSYQHFRKLLLLDBXAGPLEEELPRLADEGLNRRVAEDLNLGBXXDHQ
KX765841_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470962_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLENLNDHQ
KY629636_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881721_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881782_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881787_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881790_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881792_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLRNLNDHQ
KY881794_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881795_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881808_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881822_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881837_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEKLPRLADEGLNRRVAEDLNLENLNDHQ
KY881841_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881845_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881846_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881849_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881851_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881853_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881861_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVSEDLNLGNLNDHQ
KY881862_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLSRRVAEDLNLGNLNDHQ
KY881864_HBSP_P-B      MPLSYQHFRKLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881865_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881869_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881899_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLHDHQ
KY881913_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881945_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881952_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KY881956_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KY881957_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRIAEDLNLGNLNDHQ
LC349868_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC349872_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC349873_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
LC349874_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQ
LC349877_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC461174_HBSP_P-B      MPLSYQHFRKLLLLDDEXGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
LC461175_HBSP_P-B      MPLSYQHFRKLLLLDDEXGPLEEELPRLADEXLNRRVAEDLNLGNPNDHQ
LT992442_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
M54923_HBSP_P-B        MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRPVAEDLNLGNLNDHQ
MF674382_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674385_HBSP_P-B      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674389_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674396_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674397_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNHRVAEDLNLGNLNDHQ
MF674401_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674404_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674406_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674407_HBSP_P-B      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEDLNHRVAEDLNLGNLNDHQ
MF674415_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674419_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEQQ
MF674420_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGDLNDHQ
MF674437_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEELNLGNLNDHQ
MF674439_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLSLGTPNDHQ
MF674440_HBSP_P-B      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
MF674441_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674446_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNEHQ
MF674455_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADESLNRRVAEDLNLGNLNDHQ
MF674456_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674459_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674460_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674462_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674465_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
MF674473_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674478_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
MF674488_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674492_HBSP_P-B      MPLSYQRFRKLLLLDHEAGPLEEELPRLADEGLNHRVAEELNLGNLNDHP
MF674496_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNHRVAEDLNLGNLNDHR
MF674503_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRHVAEDLNLGNLNDHQ
MF674505_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674507_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MF674508_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674513_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MG372436_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQ
MG571323_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571325_HBSP_P-B      MPLSYQRFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
MG571326_HBSP_P-B      MPLSYQRFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571329_HBSP_P-B      MPLSYQRFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571331_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571333_HBSP_P-B      MPLSYQRFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571334_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MG571336_HBSP_P-B      MPLSYQHFRKLLLLDNDAGPLEKELPRLANEGLNRRVAQHLNLGNLNDHQ
MG571337_HBSP_P-B      VPLWYKHFRKLPLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571338_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571339_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571340_HBSP_P-B      MPLSYQLFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571341_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571347_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571349_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLQEELPRLADEGLNRRVAKDLNLGNLNDHQ
MG571351_HBSP_P-B      MPLSYQHFRKLVLLDKEAGPLKEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571352_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLHDHQ
MG571353_HBSP_P-B      MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
MG571354_HBSP_P-B      MPLSYQHFRKLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571357_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MG571358_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
MG571360_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571361_HBSP_P-B      MPLSYQRFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571364_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571367_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571368_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLPDEGLNRRVAKDLNLGNLNDHQ
MG571369_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHP
MG571370_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEKELPRLADEGLNHRVAEDLNLGNLNDHQ
MG571374_HBSP_P-B      MPLSYRHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571375_HBSP_P-B      MPLSYQHFRKLLLLNDDARPLKQELPRLADEGLNRRVAEDLNLGNLNEHQ
MG571376_HBSP_P-B      MPLSYQHFRKLLLLEEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
MG826152_HBSP_P-B      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG826153_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQ
MH061283_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534571_HBSP_P-B      MPLSYQHFRKLPLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534608_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MK534612_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK534614_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPR
MK534661_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGSLNDHQ
MK534673_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MK534676_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQ
MK534683_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHR
MK534691_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MK534692_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK534698_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDHQ
MK534699_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534703_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MK534708_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534710_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPR
MK534727_HBSP_P-B      MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
MK818223_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQ
MN689117_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
MN689118_HBSP_P-B      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
MN689119_HBSP_P-B      MPLSYQCFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGTLNDHQ
MN689122_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGFHRRVAEEFHLGNLNDHR
MN689123_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNLRVAEDLNLGNLNDHQ
MT426102_HBSP_P-B      MPLSYQHFRRLVLLDPEAGPLEEELPRLADEGLNRRVAEDLNLGNINDHQ
MT426103_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MT426859_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426863_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426890_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVTEDLNLGNLNDHQ
MT426906_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426909_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426940_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426942_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426951_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRIADEGLNRRVAEDLNLGNLNDHR
MT426956_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426965_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426974_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426976_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427009_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLKLGNLNDHR
MT427064_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQ
MT427067_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427070_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427071_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427073_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427081_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427090_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427097_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT645001_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MT645005_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
MT645016_HBSP_P-B      MPLSYQHFRKLLLLDEGVGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT645018_HBSP_P-B      MPLSYQLFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT645057_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757438_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757439_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757442_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757443_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757445_HBSP_P-B      MPLSYPHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757447_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757448_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757455_HBSP_P-B      MPLSYPHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW310261_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW310263_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845288_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845289_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVADDLTLGNLNDHQ
MW845290_HBSP_P-B      MPLSYQHFRKLLLLEDDAGPLEEELPRLADEGLNRRVAEDLLLGDLNDHQ
MW845291_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845292_HBSP_P-B      MPLSYQHFRKLLLLEGDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MW845294_HBSP_P-B      MPLSYQHFRRLLLLEEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845295_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845296_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845297_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
MW845298_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845299_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGDLNDHQ
MW845301_HBSP_P-B      MPLSYPHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MW845302_HBSP_P-B      MPLSYPHFRKLLLLEDVAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHR
MW845303_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845304_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MW845305_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEELNLGNLNEHQ
MW845306_HBSP_P-B      MPLSYQHFRKLLLLDTEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
MW845310_HBSP_P-B      MPLSYQRFRKLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845311_HBSP_P-B      MPLSYQRFRKLLLLEDGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845312_HBSP_P-B      MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW847941_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MW999602_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MW999603_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW999604_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW999608_HBSP_P-B      MPLSYQHFRKLLLLEDEAGPLEEELPRLADEGLNHRVAEDLNLGTLNDHQ
MW999610_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW999612_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLAEEGLNRRVAEDLGLGTLNDHQ
MW999613_HBSP_P-B      MPLSYQHFRKLLLLEDXAGPLEEELPRLADEGLNRRVAEDLNLGTLNDHQ
MW999615_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW999616_HBSP_P-B      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ439517_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439520_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439525_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHR
MZ439531_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHR
MZ439532_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGILNDHR
MZ439533_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439535_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439538_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGTLNDHR
MZ439541_HBSP_P-B      MPLSYQHFRKILLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGTLNDHR
MZ675794_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQ
MZ675798_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGFNHRVAEDLNLGNLNDHQ
MZ675799_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQ
MZ675800_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGFNHRVAEDLNLGNLNDHQ
MZ934423_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MZ934428_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MZ934429_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MZ934430_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
OM688316_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQ
ON402775_HBSP_P-B      MALSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
ON402778_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
ON402781_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADQGLNHRVAEDLNLGNINDHQ
X97850_HBSP_P-B        MPLSYQHFRKMLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDQQ
X98077_HBSP_P-B        MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB010291_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AB900102_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
AB368295_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
FJ023638_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674383_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674400_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674405_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674447_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674469_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674477_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674491_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674498_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674511_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MT426101_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
AB115551_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011088_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011089_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011090_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011091_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU330992_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU330994_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU330995_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU330996_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU330997_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU330998_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU330999_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU331000_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU331001_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ358140_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ358146_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ358149_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ358150_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ358151_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ358152_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924621_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924656_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HQ700549_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341604_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774418_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148457_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU234318_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881944_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674392_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674393_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674394_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674395_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674409_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674413_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674423_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674436_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674443_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674451_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674452_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674461_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674464_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674482_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674483_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674495_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674500_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674510_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534621_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534634_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534659_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845286_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ675796_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ675803_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073827_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073828_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073829_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073831_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073833_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073834_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073840_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB205119_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB300364_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB471854_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB471855_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB675676_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF100308_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF100309_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF121249_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF282918_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY167097_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY217356_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY293309_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ448620_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ448621_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ448623_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ448625_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ448626_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993697_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993703_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993705_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993708_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993709_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993710_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EF134945_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EF134946_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306700_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306701_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306702_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306703_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306705_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306706_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306708_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306709_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306710_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306712_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU350409_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU439018_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU439020_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU439021_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU439022_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU439023_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU487257_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU522067_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU522074_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU796068_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939663_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939664_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939666_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386583_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386584_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386668_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386684_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562231_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562253_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562289_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ787444_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377519_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377537_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377547_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377588_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377612_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377638_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377639_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377643_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ475340_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924603_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924627_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924644_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924653_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU434373_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU451682_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815579_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815581_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815583_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815584_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815585_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815586_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815587_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815588_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815589_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815590_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815591_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815593_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815594_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815595_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815596_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815597_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815598_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815599_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815600_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815601_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815602_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815603_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815604_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815605_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815606_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815607_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815608_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815609_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815610_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815611_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815612_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815613_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815614_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815617_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815618_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815619_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815620_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815621_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815622_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815623_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815624_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815626_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815632_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815633_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815639_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815646_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815647_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815648_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815649_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815651_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815652_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815653_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815654_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815656_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815657_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815658_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815659_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815660_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815661_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815663_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815664_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815665_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815666_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815667_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815668_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815669_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815670_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815672_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815674_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815675_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815676_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815677_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815678_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815713_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815716_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815717_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815718_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815719_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815724_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815725_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815729_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815733_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815739_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815747_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815748_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815749_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815750_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815751_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815752_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815753_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815754_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815757_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815759_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815761_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815762_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815764_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815766_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815767_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815768_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815769_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815770_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815771_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815773_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815775_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815776_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815777_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815778_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815779_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815780_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815781_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815782_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815783_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011480_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
HM011484_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JF412801_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JF899335_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JN406371_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ040173_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341550_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341558_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341568_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341570_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341573_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341574_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341591_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ688405_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ801479_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ801507_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ801514_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX429899_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX429900_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX429902_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661470_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661472_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661479_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661481_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661483_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510641_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510647_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510652_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510653_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510656_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510660_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774365_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774366_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774367_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774371_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774373_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774375_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774376_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774377_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774378_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774381_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774384_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774385_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774386_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774387_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774391_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774392_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774393_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774395_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774402_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774404_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774405_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774406_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774411_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774413_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774416_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792667_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792756_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792951_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792982_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KF053192_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173339_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173340_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173345_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173351_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173352_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173353_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173354_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173355_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173356_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173357_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173359_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173361_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173365_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173366_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173367_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173368_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173369_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173370_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173373_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173374_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173376_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173380_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173381_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173382_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173405_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173406_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173407_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173408_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173409_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173410_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173411_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173412_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173413_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173414_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173415_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173416_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173417_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ410490_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ410516_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ410517_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ717796_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ803763_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KM392083_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KM875416_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KM875417_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KM875421_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP036970_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148317_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148318_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148319_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148320_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148321_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148322_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148324_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148327_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148329_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148330_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148331_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148332_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148333_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148357_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148359_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148360_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148361_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148362_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148363_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148364_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148365_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148366_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148579_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148580_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148582_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148583_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406165_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406171_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406173_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406276_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406277_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406281_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406285_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406287_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406289_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406292_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406293_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406306_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406307_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406308_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406309_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406310_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406313_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406315_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406316_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406317_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KR232337_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963976_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963977_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963978_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963979_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963980_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963981_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963982_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963983_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963984_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963985_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963986_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963987_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963988_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963989_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964093_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964095_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964096_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964097_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964099_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964100_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964101_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964102_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964103_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964104_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964105_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964106_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964107_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964117_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964246_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX765856_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470953_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470954_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470956_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470960_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470961_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881826_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881844_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881847_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881848_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881852_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881854_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881855_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881856_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881857_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881858_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881859_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881860_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881863_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881866_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881868_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881893_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881894_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881895_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881896_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881897_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881898_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881900_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881901_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881902_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881903_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881904_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881905_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881906_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881907_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881908_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881909_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881910_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881911_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881912_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881914_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC677084_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674427_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674480_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674485_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674512_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571342_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571356_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571362_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571365_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK052962_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK052964_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK075117_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534572_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534573_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534576_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534599_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534600_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534601_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534602_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534693_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534711_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534732_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534733_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT111595_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426891_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427016_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427017_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427018_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427020_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427021_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427022_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427023_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427024_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427025_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427026_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427027_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427028_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427029_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427030_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427031_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427032_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427033_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427034_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427035_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427036_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427037_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427038_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427039_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427040_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427041_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427042_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427043_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427044_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427045_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427046_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427047_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427048_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427049_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427050_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427051_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427052_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427053_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427054_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427055_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427056_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427057_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427058_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427059_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427060_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427061_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427062_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427063_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427065_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427066_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427068_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427069_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427072_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427074_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427075_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427076_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427077_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427078_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427079_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427082_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427083_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427084_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427085_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427086_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427087_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427088_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427089_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427091_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427092_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427093_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427094_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427095_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427096_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427098_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427099_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427100_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427101_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427102_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427103_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427104_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427107_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427108_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT645041_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT645058_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW310262_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW310264_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845308_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW999606_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW999607_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ934438_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
OK106254_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
OM688314_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
OM688315_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
X97851_HBSP_P-B        MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386582_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562236_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924611_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661480_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792798_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881833_HBSP_P-B      MPLSYQRFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
D00330_HBSP_P-B        MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674426_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993681_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993683_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993684_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB246340_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB073845_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB073854_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB106884_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
D23678_HBSP_P-B        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB205121_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB246341_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB246342_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
AB900103_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
LC279268_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
LC279269_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
LC279270_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
LC279271_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
LC279272_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
LC279273_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
MH932712_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
MW887648_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
DQ993686_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
AP011084_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939635_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562259_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377561_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341575_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406220_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406221_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406222_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406223_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406224_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406225_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406226_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406227_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406228_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406229_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406230_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406231_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406232_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406233_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406234_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406235_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406236_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406237_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406238_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406239_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406240_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406241_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406242_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406243_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB195935_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MT757436_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757437_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757440_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757441_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757444_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757446_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757450_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757454_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757456_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC349869_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC349875_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB241117_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB287328_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
AB287315_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
AB287318_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
AB287319_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
DQ463787_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
DQ463790_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
DQ463798_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
DQ463802_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
JN792899_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659219_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659224_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659237_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659246_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659247_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659248_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
KP659252_HBSP_P-B      MPLSYQYFRKLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
AB555498_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF121250_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY206375_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY596102_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY766463_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ448619_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EF494380_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU522066_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939672_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386615_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386636_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386658_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ899784_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ899785_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ899786_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377582_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377610_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815679_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815680_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815681_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815683_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815684_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815685_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815686_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815687_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815688_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815689_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815691_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815692_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815693_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815694_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815695_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815696_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815697_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815698_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815699_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815700_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815701_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815702_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815703_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815704_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815705_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815706_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815707_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815708_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815710_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815711_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815721_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815730_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815731_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815732_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815735_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815737_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815740_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815742_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815755_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ040138_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341584_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341593_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661471_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661474_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX978431_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510644_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510649_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510650_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774363_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774399_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774403_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173422_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173423_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ410502_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406262_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406266_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406272_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406273_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406275_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406318_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406319_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406320_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406321_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406322_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406323_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406324_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406325_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406326_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406327_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406328_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406329_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406330_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406332_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406333_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406334_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406335_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963816_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963828_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963829_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963830_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963831_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963832_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963833_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963834_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963835_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963836_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963837_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963838_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963839_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963840_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963841_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963855_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964138_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964139_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964140_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964142_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964143_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964144_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964145_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964146_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964147_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964148_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964149_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964150_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964151_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964152_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964244_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964247_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964248_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964249_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964251_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964253_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964254_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964255_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964256_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964394_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881780_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881781_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881783_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881784_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881785_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881786_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881788_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881789_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881791_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881793_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881796_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881797_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881798_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881799_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881800_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881801_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881823_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881824_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881825_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881827_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881828_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881829_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881830_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881831_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881834_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881836_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881838_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881839_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881842_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881843_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881850_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534627_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426100_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426104_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT645025_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW497299_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW999614_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ934426_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ934427_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ934435_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ934436_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ934437_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ934439_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ934440_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB302943_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB302944_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB713532_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011085_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924625_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ027316_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ429081_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ429082_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276830_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC349871_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC349878_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC349879_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC416037_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674479_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534626_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW999609_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY596106_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AF121244_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
AF121245_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
AF121246_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KJ717805_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KJ717806_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KJ803795_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
AY217361_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY220703_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY220704_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU919173_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ801524_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661478_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510651_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792948_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173347_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173348_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148325_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406288_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406296_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406299_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406300_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406301_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406303_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406311_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674391_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MH663473_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ671237_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ671238_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924631_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341579_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276773_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011095_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AP011096_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674515_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY163870_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDHQ
AY596109_HBSP_P-B      MPLSCQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341563_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792945_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC793132_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276808_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571350_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX504538_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306679_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306680_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173418_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173419_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406282_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406283_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674506_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY217358_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
AY596110_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
AY596112_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
EU570070_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
EU570071_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KC774374_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KC774388_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963945_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963947_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963949_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963950_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963951_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963952_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963953_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963954_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963956_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963957_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963958_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KU963959_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
AY220697_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939633_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU939634_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815650_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX507215_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173363_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173364_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964123_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964124_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964125_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964126_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964127_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964128_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964129_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964130_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964131_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964132_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964133_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964134_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964135_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964136_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964137_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EF473974_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ032349_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386675_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571327_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571328_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571344_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774362_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AY800392_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC603638_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHQ
EU306695_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
EU306697_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
EU306698_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MK534696_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQ
FJ032357_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ463796_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHQ
DQ463797_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQ
JN792895_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQ
JN792896_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADDDLNRRVAEDLNLGNPNDHQ
JN792897_HBSP_P-B      MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
JN792898_HBSP_P-B      MPLSYQHFRKLLLLDSDAGPLEEELPRLADEDLNHRVAEDLNLGNPNDHQ
JN792893_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNLRVAEDLNLGNPNDHQ
DQ993699_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
DQ993701_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
DQ993702_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JX661482_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173297_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406163_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571371_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534575_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534709_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU487256_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU306678_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ801512_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148356_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU330990_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU522073_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU522075_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
EU564824_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KP406162_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
KP406166_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDHQ
EU589335_HBSP_P-B      MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDRR
FJ386656_HBSP_P-B      MPLSYQHFRNILLLDKDAGPLEEELPRLADQGLNRRVAEDLGLGNLNDRR
EU796071_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571346_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534603_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427080_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148336_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148338_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148339_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148340_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148342_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148343_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148344_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148345_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148346_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148347_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148348_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148349_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276788_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470830_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470832_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470833_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470834_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470835_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470836_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470837_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470838_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470839_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470840_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY470841_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534570_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534578_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534581_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534591_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534629_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534705_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534707_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ386642_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ801471_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ562237_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774400_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406261_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU434372_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815715_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815722_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815726_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815728_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815734_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815736_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815738_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815744_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815745_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815746_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX504532_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510657_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571322_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276784_HBSP_P-B      MPLSYQHFRKLLLLEEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674422_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964157_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ899790_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
FJ899791_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
FJ386634_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377550_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
FJ349236_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707734_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707735_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707737_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707738_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707739_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707742_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707743_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707744_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707746_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707749_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707753_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707755_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707758_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707759_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707762_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707763_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707764_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707765_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707766_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
JQ707767_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674384_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674387_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674410_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674416_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674421_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674424_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674431_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674438_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674453_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674470_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674481_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674487_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674490_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674497_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MF674509_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MW847940_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MW999605_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
MW999611_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
FJ032354_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534554_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964094_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571373_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774398_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148367_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148368_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148369_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148370_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148371_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148372_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148375_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148376_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148378_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148379_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148380_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148382_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148383_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148384_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148385_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148386_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148388_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148389_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148390_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148391_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148392_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148394_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148395_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148396_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148397_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148400_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148402_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148403_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148419_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148427_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148451_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK534697_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GQ924610_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341566_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341598_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX507210_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510655_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510658_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774383_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774389_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173424_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173425_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ410507_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KM359440_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881820_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881821_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674449_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ671236_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ671239_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ675786_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377569_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ377568_HBSP_P-B      MPLSYQHFRKLQLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815756_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173387_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173388_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924634_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173371_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173372_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534658_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX429897_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX504531_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510642_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510648_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC510659_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774368_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC774396_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ717831_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ803817_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KM392072_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963960_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963961_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963962_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963963_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963964_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963965_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963966_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963967_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963968_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963969_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963970_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963971_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963972_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963973_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963974_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963975_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964153_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964158_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964159_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964160_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964163_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964164_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KX276781_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924660_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406244_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406245_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406246_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406247_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406248_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406249_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406250_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406251_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406252_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406253_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406254_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GQ924654_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534611_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MN689120_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MN689121_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815549_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815551_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815552_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815553_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815555_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815556_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815557_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815558_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815559_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815560_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815561_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815562_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815563_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815564_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815565_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815566_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815567_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815568_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815569_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815570_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815572_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815575_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815576_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
JX661475_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC774408_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MT427019_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815577_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GU815625_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815627_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815628_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815629_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815630_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815631_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815634_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815635_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815636_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815637_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815638_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815640_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815642_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815643_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815644_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
GU815645_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964108_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964111_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964113_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964115_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX661476_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148326_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571355_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881867_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX870001_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEEPPRLADEGLNRRVAEDLNLGNLNDHQ
KJ717807_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ803796_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
LC349870_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ027331_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KJ173386_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JQ341583_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNDHQ
JQ341555_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173362_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881835_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792885_HBSP_P-B      MPLSYQYFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JX504533_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845309_HBSP_P-B      MPLSYQHFRKLLLLDXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674414_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MF674499_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
JQ341599_HBSP_P-B      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674432_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
MK534694_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148314_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
KP148323_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
KP148334_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
MF674450_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
KJ173377_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963842_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963843_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963844_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963845_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963846_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963847_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963848_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963849_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963850_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963851_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963852_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963853_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MG571372_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173389_HBSP_P-B      MHLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173390_HBSP_P-B      MHLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534702_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KC792994_HBSP_P-B      --LSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KF053165_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KJ803755_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KJ803758_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
KJ803756_HBSP_P-B      MPLSYQHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ803764_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADKGLNRRVAEDLNLGNLNDHQ
KJ803768_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHQ
KJ803773_HBSP_P-B      MPLSYPHFRRLLLLDQEAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQ
KJ803775_HBSP_P-B      MPLSYPHFRKLLLLDQEAGPLEEELPRLADEGLNRRVAEDLGLGNLNDHQ
KF053194_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KJ803781_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KJ803783_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVADDLNLGNLNDHQ
KJ803784_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173342_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173398_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDHQ
KJ173400_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDHQ
KJ173402_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173404_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ173421_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ803787_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRFAEDLNLGNLNDHQ
KJ803789_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ803797_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRFADDLNLGNLNDHQ
KJ803801_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ803805_HBSP_P-B      MPLSYQHFRKLVLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
KJ803808_HBSP_P-B      MPLSYQHFRKLLLLDKDAGPLEDELPRLADEGLNRRVAEDLTLGNLNEHQ
KJ803816_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRFAEDLNLGTLNDHR
KJ803819_HBSP_P-B      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ803820_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEHQ
KJ803821_HBSP_P-B      MPLSYQRFRKLLLLDTDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KJ803824_HBSP_P-B      MPLSYQHFRKLLLFDNAAGPLEEELPRLADEGLNRRVAEDLNLGNLDDHQ
KJ803825_HBSP_P-B      MPLSYQRFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534704_HBSP_P-B      MPLSYQHFRKLPLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148398_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPR
KP148409_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148410_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148411_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148413_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148414_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148415_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148421_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148423_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148424_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148425_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148430_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148432_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148435_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148439_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148440_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148416_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148418_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP148433_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KY881946_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881949_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881950_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881955_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674433_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674434_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674445_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674448_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674466_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK534680_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148455_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148456_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148458_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148460_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP148461_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406169_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KP406264_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406270_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406278_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406259_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KP406263_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964292_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964296_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
MT622522_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KP406260_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNINDHQ
KP406271_HBSP_P-B      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406286_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406294_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406305_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406312_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KP406314_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963800_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963801_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963802_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963803_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963804_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963805_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963806_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963807_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963808_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963809_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963810_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963811_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963812_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963813_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963817_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963818_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963819_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963820_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963821_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963822_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963823_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963824_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963825_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963826_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU963827_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964080_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964081_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964082_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964083_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964084_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964085_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964086_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964087_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964088_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964089_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964090_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964091_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964092_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964110_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964112_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964114_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964116_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964118_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964119_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964121_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964122_HBSP_P-B      MPLSYQHFRKLLLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964162_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964167_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964161_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964166_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964168_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964260_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964261_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964262_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964263_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964264_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964266_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964268_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964269_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964270_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964271_HBSP_P-B      MPLSYQHFRKLLLLDEGAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964288_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964289_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964290_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964291_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964294_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964295_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964297_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964298_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964299_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964300_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964301_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KU964382_HBSP_P-B      MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964383_HBSP_P-B      MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964384_HBSP_P-B      MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964385_HBSP_P-B      MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964388_HBSP_P-B      MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964391_HBSP_P-B      MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964393_HBSP_P-B      MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964395_HBSP_P-B      MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KU964397_HBSP_P-B      MPLSYQHFRNVLLLGEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845293_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MF674476_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MW845300_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ675802_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881722_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881723_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881724_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881725_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881726_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881727_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881728_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881729_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881730_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881731_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881732_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881733_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881734_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881735_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881740_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881741_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881745_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881746_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881747_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881752_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881753_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881756_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881757_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881759_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881760_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881761_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881778_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881779_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY881947_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881948_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881951_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881958_HBSP_P-B      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KY881953_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
KY881954_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
MF674493_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEELNLGNLNDHQ
MK052965_HBSP_P-B      MPLSYQHFRKLLLLDKEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426860_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426861_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426862_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426867_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426868_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426869_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426871_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426872_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426873_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426874_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426875_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426876_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426877_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426879_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426880_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426881_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426883_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426884_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426885_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426886_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426887_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426888_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426892_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426893_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426894_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426895_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426898_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426899_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426900_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426901_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426902_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426903_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426904_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426905_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426864_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426865_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426866_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426870_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426878_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426882_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426889_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426896_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426897_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDHQ
MT426907_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426908_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426910_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426913_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426914_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426915_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426916_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426918_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426919_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426920_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426921_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426922_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426923_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426924_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426925_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426926_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426927_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426928_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426929_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426930_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426931_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426932_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426933_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426934_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426935_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426936_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426937_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426938_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426939_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426941_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426943_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426944_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426945_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426946_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426947_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426948_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426949_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426950_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426952_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426953_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426954_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426955_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426957_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426958_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426961_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426962_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426963_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426964_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426966_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426967_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426968_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426969_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426971_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426972_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426973_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426975_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426977_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426978_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426979_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426980_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426981_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426982_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426983_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426984_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426985_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426986_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426987_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426988_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426989_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426990_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426991_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426992_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426993_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426994_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426996_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426997_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426998_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426999_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427000_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427001_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427003_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427004_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427005_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427006_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427007_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427008_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427010_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427011_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427012_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427013_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427014_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427015_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426911_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426912_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426917_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426959_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426960_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426970_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT426995_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHR
MT427002_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRIADEGLNRRVAEDLNLGNLNDHR
MT427105_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427106_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT427109_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757451_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757452_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757449_HBSP_P-B      MPLSYPHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757453_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MT757457_HBSP_P-B      MPLSYPHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ675785_HBSP_P-B      MPLSYQHFRKLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MZ439518_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439519_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439521_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439522_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439523_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439524_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439527_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439529_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439530_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439536_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439537_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439542_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439543_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439545_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439546_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439549_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439550_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439551_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDHR
MZ439526_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHR
MZ439528_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHR
MZ439534_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNPNDHR
MZ439539_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGTLNDHR
MZ439540_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGTLNDHR
MZ439544_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGTLNDHR
MZ439548_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGTLNDHR
MZ439547_HBSP_P-B      MPLSYQHFRKILLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGTLNDHR
MZ675795_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQ
MZ675797_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQ
MZ675805_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQ
MZ675806_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQ
MZ675807_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQ
MZ675804_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGFNHRVAEDLNLGNLNDHQ
MZ675801_HBSP_P-B      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNINDHQ
                         *    *     :      * .    :    :    :            

KP659240_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
EU660224_HBSP_P-B      -PAPDHAKPAQLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
AB010289_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
AB010290_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB010292_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
AB014366_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
AB031266_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB031267_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB033555_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB048705_HBSP_P-B      PPARDLAEPARSLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNSYGS
AB073821_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073822_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073823_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNPYGS
AB073824_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073825_HBSP_P-B      QPAPDHAKPAQRLLKEPLCFPHVAVQNLRTETAPVFPSHRPGLSQNTYGS
AB073826_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
AB073830_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETALVFPSHHLGLSQNTYGS
AB073832_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073835_HBSP_P-B      PPAPDPAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
AB073836_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB073837_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHHGLPQNTYGS
AB073838_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073839_HBSP_P-B      QPAPDHARPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073841_HBSP_P-B      QPAPDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073842_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHAAVQNLRTETAPVFPSHHLGLSQNSYGS
AB073843_HBSP_P-B      PPARDHARPAPLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073844_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073846_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
AB073847_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETALVFPSHHLGLSQNTYGS
AB073848_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
AB073849_HBSP_P-B      PPARXHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073850_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
AB073851_HBSP_P-B      PPARDHARPAQLLLKETLRFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073852_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB073853_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
AB073855_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB073857_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB073858_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB100695_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB117759_HBSP_P-B      PPARDHARPAQLLLETPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB195933_HBSP_P-B      QPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB195934_HBSP_P-B      QPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB205120_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLPQNTYGS
AB205122_HBSP_P-B      PPAPDHAEPARLPLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB212625_HBSP_P-B      PPAPDHAEPARLLLEEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB219427_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPPVAVQNLRKETAPVFPSHHLGLSQNTYGS
AB219428_HBSP_C-B      PPAPDHAEPARLLLKEPLCFPPVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB219430_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB231909_HBSP_P-B      PPALDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB241116_HBSP_P-B      PPAPDHAEPARLLLKEPLRFPPVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB246339_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSRHLGLSQNTYGS
AB246343_HBSP_P-B      PPARDHARPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB287314_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB287316_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB287317_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB287320_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB287321_HBSP_P-B      PPARDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB287322_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB287323_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB287325_HBSP_P-B      PPAPDHAKPARLLLKGPLCFPHVVVQNLRTETAPVFPSHHLGLSQNTYGS
AB287326_HBSP_P-B      PPARDHARPAHLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB287327_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB287329_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB300370_HBSP_P-B      PPARDHARPAQLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB300371_HBSP_P-B      QPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSRHLGLSQNTYGS
AB302095_HBSP_P-B      PPARDHARPAQLLLKETLRFPHVAVQNLRMETAPVFPSHRHGLSQNTYGS
AB302942_HBSP_P-B      PPAPEHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB302945_HBSP_P-B      PPAPEHAKPARLLFKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB362933_HBSP_P-B      PQARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB365445_HBSP_P-B      QPARDHAKPAQRLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB493833_HBSP_P-B      PPAPDPAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB555499_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB642093_HBSP_P-B      PPARDHAKXAQLLLKEPLCFPHAXVQNLRTETAPVFPSHXLGLSQNTYGS
AB642094_HBSP_P-B      RPAPDHAKPAXLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB713527_HBSP_P-B      PPAPDHAKPARLLLMEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB713528_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPPVAVQNLWTETAPVFPSHHLGLSQNTYGS
AB713529_HBSP_P-B      PPAPDHAKPARLLLKETLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB713530_HBSP_P-B      PPAPDHAKPARLLLKETLCFPHGAVQNLRTETAPVFPSHHLGLSQNTYGS
AB713531_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB900095_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AB900096_HBSP_P-B      PPARDHARPAQLLLKATLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB900097_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB900098_HBSP_P-B      PPAPDHARPAQLLLKEPLCFPHAAVQNLRTETAPVFPSHHLGLSQNTYGS
AB900104_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB900105_HBSP_P-B      PPARDHARPARLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
AB900106_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB900107_HBSP_P-B      PPAPDPARPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
AB900108_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB900110_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB900112_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB931168_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AB931169_HBSP_P-B      PPARDHARPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
AF121243_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AF121247_HBSP_P-B      QPAPDHAKPAXLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSXNTYGS
AF121248_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AF121251_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
AF282917_HBSP_P-B      RPALDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
AF461360_HBSP_P-B      RPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AF461362_HBSP_P-B      QPALDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AF479684_HBSP_P-B      QPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AJ627225_HBSP_P-B      QPAPDHAKPAQLLLKAPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AP011086_HBSP_P-B      PPAPDHAEPARLLLKEPLYFPHVAVQNLRTEIAPVFPSHRLGLSQNTYGS
AP011087_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHRLGLSQNTYGS
AP011092_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPPVAVQNLRTETAPVFPSHHLGLSQNTYGS
AP011093_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
AP011094_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNSYGS
AY033072_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLWTETAHVFPSHHLGLSQNTYGS
AY033073_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLWTETAHVFPSHHLGLSQNTYGS
AY163869_HBSP_P-B      QPAREHAKPARLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
AY167089_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY167093_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY167094_HBSP_P-B      QPAPDHAKPAXLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY167098_HBSP_P-B      RPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY167100_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY167101_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY167102_HBSP_P-B      QPAPDHAKPARRLLKEPLCFPHVAVQNLRTETAPVFPSHYLGLSQNTYGS
AY206383_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY206387_HBSP_P-B      QPAPEHAKPARLLLKEPLCFPHVAVQNLRTQTAPVFPSHHLGLSQNSYGS
AY206390_HBSP_P-B      QPAPDHAKHAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
AY206391_HBSP_P-B      QPAPDHAKPARLLLKAPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY217357_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY217359_HBSP_P-B      QPAPDHAKPARLLFKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY217360_HBSP_P-B      QPAPDHAKPARLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY217362_HBSP_P-B      QPAPDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY217364_HBSP_P-B      RPAPDHAKPARLLLNEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY217368_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
AY220698_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
AY518556_HBSP_P-B      QPAPDHAKPAQRLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY596103_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGG
AY596104_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY596105_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY596111_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
AY800389_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
AY800391_HBSP_P-B      PPAPDHAEPARRLLKETLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
D00329_HBSP_P-B        PPARDHARPAQLLLKEPLCFPHVAVQNLWMETAPVFPSHHLGLSQNTYGS
D00331_HBSP_C-B        PPAQDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
D23679_HBSP_P-B        PPARGHARPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
D50521_HBSP_P-B        PPARDHARPAQLLLETPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
D50522_HBSP_P-B        PPARDHARPAQLLLKAPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
DQ361535_HBSP_P-B      PPAPDHAEPARLLLKETLRFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
DQ377158_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ448622_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ448624_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHAAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ448627_HBSP_P-B      QPVPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ448628_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
DQ463788_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
DQ463789_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
DQ463791_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
DQ463792_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
DQ463793_HBSP_P-B      PPAPDHAKLARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
DQ463794_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
DQ463795_HBSP_P-B      PPAPDRARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
DQ463799_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLPQNTYGS
DQ463800_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
DQ463801_HBSP_P-B      PPAPDHAKLARLLLKEPLCFPHVVVQNLRTEIAPVFPSHHLGLSQNTYGS
DQ904357_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
DQ993680_HBSP_P-B      PPAPDPAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
DQ993685_HBSP_P-B      PPAPDPAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
DQ993687_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFASHHLGLSQNTYGS
DQ993696_HBSP_P-B      QPAPDHGIPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ993698_HBSP_P-B      QPAPDHAEAAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ993700_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHAAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ993704_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ993706_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ993707_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ993711_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ995801_HBSP_P-B      QPAPDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ995802_HBSP_P-B      QPAPDHAKPAQLLLKESLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ995803_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
DQ995804_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
EF473971_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EF473972_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EF473973_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EF473975_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EF473976_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EF473977_HBSP_P-B      PPAPDHAEPAQLLLKESLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EF494382_HBSP_P-B      QPARDHAKPARVLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU139543_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGG
EU158262_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNSYGS
EU158263_HBSP_P-B      QPAPDHAKPAQLLLKAPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU305547_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU305548_HBSP_P-B      RPASDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU306677_HBSP_P-B      QPAPDHAKPAHLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU306681_HBSP_P-B      QPAPDHAKPAHLLLKEPLCFPHAAVQNLRTETAPVFPSHHLGLSQNTYGS
EU306696_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGR
EU306699_HBSP_P-B      QPAPDHAEPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU306704_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNAYGS
EU306707_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNAYGS
EU306711_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU330989_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPRVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU522072_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
EU547563_HBSP_P-B      QPAPDHAKPARLLLEEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU564822_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHRLGLSQNTYGS
EU564823_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU564826_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU570069_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTGTAPVFPSHHLGLSQNTYGS
EU570075_HBSP_P-B      QRAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
EU579441_HBSP_P-B      QRAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
EU595031_HBSP_P-B      QPVPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU660231_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU796066_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
EU796067_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
EU881997_HBSP_P-B      QPAPDHARPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNSYGS
EU881998_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
EU882002_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLWTETAPVFPSHHLGLSQNTYGS
EU882004_HBSP_P-B      QPAPDHARPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU919171_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU919172_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSHNSYGS
EU919175_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU919176_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939559_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939636_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939637_HBSP_P-B      QPAPDHAKSAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLPQNTYGS
EU939638_HBSP_P-B      QPAPDHARPAQLLLKEPLYFPHVAVQNLRTATAPVFPSHHLGLSQNTYGS
EU939639_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939660_HBSP_P-B      QPAPDHAKPARLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939661_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939665_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939667_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939669_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPPVAVQNLRTETAPVFPSHHLGLSQNSYGS
EU939670_HBSP_P-B      QPARDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
EU939673_HBSP_P-B      QPAPDHARHAHLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939674_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
EU939675_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939676_HBSP_P-B      LPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939677_HBSP_P-B      QPARDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
EU939678_HBSP_P-B      QPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHRLGLSQNTYGS
FJ023631_HBSP_P-B      QPAPDHAKLARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ023632_HBSP_P-B      QPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ023633_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNXYGS
FJ023634_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLWTETAPVFPSHHLGLSQNTYGS
FJ023635_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ023636_HBSP_P-B      PPAPDHAEPARLLLKEPLYFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ023637_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ032342_HBSP_P-B      QPAPDHAKPARLLLKETLRYPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ032344_HBSP_P-B      QPAPDHAKPARLLLKETLRFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ032352_HBSP_P-B      QPAPDHAKPAQLLLKEPLRFPHVAVQNLRTETAPVFPSHRLGLSQNIYGS
FJ032353_HBSP_P-B      QPAPDHAKPAQLLLKEPLRFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ032358_HBSP_P-B      QPVPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ386600_HBSP_P-B      QPAPDHAKPARLLLKEPLRFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ386608_HBSP_P-B      QPALDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHRLGLSQNSYGS
FJ386610_HBSP_P-B      RPAPDHAKPAQLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ386648_HBSP_P-B      LPARDPAKPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLSQDTYGS
FJ386654_HBSP_P-B      QPAPGHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ386655_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGG
FJ386660_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ386666_HBSP_P-B      QPAPDHAKPAQLLLKEPLYFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ386669_HBSP_P-B      QPAPDHAKPAQLLLEEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ386676_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ386681_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
FJ386682_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
FJ386683_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ386688_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ518811_HBSP_P-B      QPAPDHARPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLRLSQNTYGS
FJ518812_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
FJ562219_HBSP_P-B      QPAPDHAKPARLLLKEPLRFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562222_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562224_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562234_HBSP_P-B      QPAPDHAKPARLLLEEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562240_HBSP_P-B      LPAPDHAKPAQLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
FJ562246_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562254_HBSP_P-B      QPAPDHAKPARLLLEEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562257_HBSP_P-B      QPASDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
FJ562260_HBSP_P-B      QPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
FJ562262_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562296_HBSP_P-B      QPVPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562303_HBSP_P-B      QPAPDHAKPARLLLKEPLCFHHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562311_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562312_HBSP_P-B      QPAPDHARPAHLLLKEPLCFPHVAVQNLRTETAPVFPSRHLGLSQNTYGS
FJ562316_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ562322_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLWTEIAPVFPSHHLGLSQNTYGS
FJ787475_HBSP_P-B      QPAPDHAKPAQRLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGC
FJ787476_HBSP_P-B      QPAPDHAKPARRLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGC
FJ787477_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
FJ899779_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPPVAVQNLRTETALVFPSHHLGLSQNSYGS
FJ899787_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ358136_HBSP_P-B      PPAPDHAKPARLLLKEPLCSPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ358137_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
GQ358138_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ358139_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ358141_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ358142_HBSP_P-B      PPAPDHAEPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ358143_HBSP_P-B      PPAPDHAEPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ358145_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ358147_HBSP_P-B      PPAPDHAEPARLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ358148_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ377525_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
GQ377542_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ377558_HBSP_P-B      PPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ377566_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ377567_HBSP_P-B      QPPPDHAKPAQFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQDTYGS
GQ377587_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ377606_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ377622_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ377625_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ377629_HBSP_P-B      QPAPGHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ377641_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ377644_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
GQ924605_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924607_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924608_HBSP_P-B      QPAPDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924617_HBSP_P-B      PPAPDHAKPARRLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924624_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924626_HBSP_P-B      PPAPEHAEHARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924628_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924630_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
GQ924632_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924635_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
GQ924637_HBSP_P-B      PPAPDPAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924638_HBSP_P-B      PPAPDHAKPARLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924639_HBSP_P-B      PPAPDHAKPARLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924640_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETALVFPSHHLGLSQNTYGS
GQ924645_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924646_HBSP_P-B      QPAPDHAKPARHLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924647_HBSP_P-B      QPAPDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924648_HBSP_P-B      QPAPDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GQ924651_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815548_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815550_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815554_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHAAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815571_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815573_HBSP_P-B      QPAPDHAKPAQLLLKKPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815574_HBSP_P-B      QPAPDHARPAQLLLKEPPCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815578_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815616_HBSP_P-B      QPAPDHAKPARLLLEEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815641_HBSP_P-B      QPAPDHAKPARLLLEEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815662_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815673_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815709_HBSP_P-B      QPAPDHAKPARLLLKESLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815712_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815720_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHAAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815723_HBSP_P-B      QPAPDHAKPARLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815727_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGN
GU815741_HBSP_P-B      QPAPDHAKPARLLLTEPLCFPHVAVQNLRTETAPVFPSHHLRLSQNTYGS
GU815760_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFLHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815765_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815772_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
GU815774_HBSP_P-B      QPAPDHAKPAQLLLKESLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
HM011466_HBSP_P-B      QQARDHARPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
HM011467_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGXSQNXYGS
HM011469_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
HM011470_HBSP_P-B      QPAPDHAKPAQLLLKETLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
HM011471_HBSP_P-B      QPAPDHAKPAPLLLKAPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
HM011473_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVXNLRTETAPVFPSHHLGLSQNTYGS
HM011474_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
HM011475_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
HM011476_HBSP_P-B      QPAPDHAKXARLLLKEPLCFPHVAVQNLRTEXAPVFPSHHLGLSQNSYGS
HM011478_HBSP_P-B      QPAXDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHXLGLSQNTYGS
HM011482_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
HM011483_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
HM011487_HBSP_P-B      PPAPDHAEPARLLLXETLRFPHVAVQNLRTQTAPVFPSHHLGLSQNSYGS
HM011490_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
HM011492_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
HM011494_HBSP_P-B      QPAPDHAXPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
HM011496_HBSP_P-B      PPAXDHAEPARLLLKEPLCFPHVAVQNLRTETALVFPSHHLGLSQNTYGS
HM011499_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
HM011503_HBSP_P-B      XPAXDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
HM011504_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSXNTYGS
HQ700546_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
HQ700548_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLWTETAPVFPSHHLGLSQNTYGX
JN792894_HBSP_P-B      PPAPDHARLARLLLKEPLCFPHVVVQNLRTEIAPVFPSHHLGLSQNTYGS
JN792900_HBSP_P-B      PPAPDHARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLPQNTYGS
JN792901_HBSP_P-B      PPAPDHARPARLLLKTALRFPHVAVQNLRTEIAPVFPSHHLGLSQNSYGS
JN792902_HBSP_P-B      PPAPXHARPARLLLKATLRFPHVAVQNLRTEIAPVFPSHHLGLSQNSYGS
JN827419_HBSP_P-B      QPAPDHAEPAQLLLKGPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ027311_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLXQNTYGS
JQ027312_HBSP_P-B      QPAPDHAXPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ027313_HBSP_P-B      QPAPDHAKPARLLLKEPLXFPHVAVQNLRTETAPVFPSHXLGLXQNTYGS
JQ027315_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ027325_HBSP_P-B      QPAPDHAKPARLLLTEPLCFPHVAVRNLRTETAPVFPSHHLGLSQNTYGS
JQ027329_HBSP_P-B      QPAPDHAKPAQLLLXXPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ027330_HBSP_P-B      QPAPDHAKPAQLLLKATLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ027334_HBSP_P-B      PPARDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ040125_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ040128_HBSP_P-B      QPAPDHAKPAXLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ040147_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNSYGS
JQ040157_HBSP_P-B      LPARDHARPARFLLKAPLCFXHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ040170_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQXTYGS
JQ040171_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341549_HBSP_P-B      QPAPDHAKHAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341551_HBSP_P-B      QPAPDHAKPAQLLLKEXLXFPHVAVQNLRTETAPVFPSHHLGLSQNXYGX
JQ341552_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHAAVQNLRMETAPVFPSHHLGLSQNTYGS
JQ341553_HBSP_P-B      QPAPDHAKPAQLLLKEPLXFPHVAVQNLRTETAPVFPSHHLGLSQNXYGS
JQ341554_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341556_HBSP_P-B      XPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSXNTYGS
JQ341557_HBSP_P-B      QPAPXHAXPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341559_HBSP_P-B      QPAPDHAXPAQLLLKEPLCFPHVAVXNLRTETAPVFPSHHLGLSQNTYGS
JQ341560_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341561_HBSP_P-B      QPARDHAKPARLLLXXPLCFPHVAVQNLRTETAPVFPSHHLGLSQNXYGS
JQ341562_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341564_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341565_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341567_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
JQ341569_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341571_HBSP_P-B      PPARDHAKPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNXYGS
JQ341572_HBSP_P-B      RPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHPGLSQNTYGS
JQ341576_HBSP_P-B      QPALDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
JQ341577_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341578_HBSP_P-B      QPAPDHAKLAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341580_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341581_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
JQ341582_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341585_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHAAVQNLRTETAHVFPSHHLGLSQNTYGS
JQ341586_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNXYGS
JQ341587_HBSP_P-B      XPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341588_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341589_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341590_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNXYGS
JQ341592_HBSP_P-B      RPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNPYGS
JQ341594_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVVVQNLRTETAPVFPSXHLGLSQNTYGS
JQ341595_HBSP_P-B      RPAXDHAKPAXLLLKEPLCFPHVAVQNLRTETAXVFPSHHLGLXQNTYGS
JQ341596_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSXNSYGS
JQ341597_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341600_HBSP_P-B      QPAPDHAKPAQLLLKDPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341601_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVXNLRTETAPVFPSHHLGLSQNTYGS
JQ341603_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341605_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
JQ341606_HBSP_P-B      QPAPDHAKXARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341607_HBSP_P-B      PPAPDHAKPARLLLKGPLCFPHVAVQNLRTETAPVFPSHXLGLSQNXYGS
JQ341608_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ341609_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ429079_HBSP_P-B      PPARDHANPARLLLKEPLCFPHVAVQNLRTETAPVFPSRHLGLSQNTYGS
JQ429080_HBSP_P-B      PPAPDHAKPARLLLKEPLCLPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ707740_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ707745_HBSP_P-B      PPAQDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ707747_HBSP_P-B      PPAPDHAEPARILLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ707750_HBSP_P-B      PPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ801474_HBSP_P-B      QPAPDHARPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ801494_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSRHLGLSQNTYGS
JQ801506_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JQ801516_HBSP_P-B      RPVPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JX026879_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTDTAPVFPSHHLGLSQNSYGS
JX026881_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVHNLRTETAPVFPSHHLGLSQNTYGS
JX026883_HBSP_P-B      QPAPEHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHPGLSQNTYGS
JX026886_HBSP_P-B      LPAPDPAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JX429901_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
JX429908_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JX429910_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JX429911_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JX504543_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHRHGLSQNTYGS
JX507213_HBSP_P-B      RPARDHAKPAQLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNXYGS
JX661473_HBSP_P-B      QPAPGHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JX661484_HBSP_P-B      PPAPDHAKPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
JX869998_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
JX869999_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC492739_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC510643_HBSP_P-B      QPAPDHAKPARRLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC510646_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTQTAPVFPSHHLGLSQNTYGS
KC510654_HBSP_P-B      QPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774369_HBSP_P-B      PQAPGHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774370_HBSP_P-B      PQAPGHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774372_HBSP_P-B      QPAPDHAKPAQLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774379_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774380_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTQTAPVFPSHHLGLSQNTYGS
KC774382_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774390_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774394_HBSP_P-B      QPARDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KC774397_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774401_HBSP_P-B      PPARDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KC774407_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774409_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVRNLRTETAPVFPSHHLGLSQNTYGS
KC774410_HBSP_P-B      QPAPDHAKPAQLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774412_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGC
KC774415_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774417_HBSP_P-B      QPAPVHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC774419_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792652_HBSP_P-B      QPAPDHAKXAXLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792674_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNXYGS
KC792701_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEXAPVFPSHHLGLSQNTYGS
KC792712_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
KC792717_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792719_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETALVFPSHHLGLSQNTYGS
KC792742_HBSP_P-B      QPAPDHAEPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
KC792745_HBSP_P-B      QPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792748_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVXVQNLRTETAPVFPSHHLGLSQNTYGS
KC792765_HBSP_P-B      QPAPDHAKPAQLLLKEPLRFPHVAVQNLRTETAPVFPSHHLWLSQNTYGS
KC792767_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792777_HBSP_P-B      LPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGG
KC792779_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792780_HBSP_P-B      QPAXDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792786_HBSP_P-B      QPAPDHAKPAXLLLKEPLCFPHVAVQNLRTETAPVFPSHRLGLSQNTYGS
KC792800_HBSP_P-B      RPAXDHAKPAXLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
KC792801_HBSP_P-B      QPAPDHAXPARLLLKEPLXFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792811_HBSP_P-B      QPARDHAKPAQLLLKGPLCFPHVAVQNLRTETAPVFPSRHLGLSQNTYGS
KC792843_HBSP_P-B      QPAPDHARPARLLLKEPLCFPHVAVQNLRMETAPVFPSHRLGLSQNTYGS
KC792859_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792860_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792889_HBSP_P-B      QPAXDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792896_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792897_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792901_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRKETAPVFPSHHLGLSQNTYGS
KC792904_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792920_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
KC792935_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGX
KC792936_HBSP_P-B      QPAPDHAKPAXXLLKEPLCFPHVXVQNLRTETAPVFPSHHLGLSQNSYGS
KC792938_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792939_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETALVFPSHHLGLSQNTYGS
KC792947_HBSP_P-B      RPAPDHAKPAXLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGXXQNTYGS
KC792949_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792955_HBSP_P-B      QPAXDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792970_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHPGLSQNTYGS
KC792973_HBSP_P-B      QPAPDHAXXARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792974_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC792976_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLSQNTYGS
KC792985_HBSP_P-B      QPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC793004_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC793006_HBSP_P-B      QPAPDPAKPAXLLLKEPLCFPHVAVXNLRTETAPVFPSHHLGLSQNTYGS
KC793030_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC793042_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNXYGS
KC793061_HBSP_P-B      QPAPEHAKPARLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
KC793064_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC793069_HBSP_P-B      LPAPDHAKPARLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
KC793076_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC793125_HBSP_P-B      RPAPDHAKPAQLLLKEPLCFPHVVVQNLRTETAPVFPSHHLGLSQNTYGS
KC793139_HBSP_P-B      QPARDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC793141_HBSP_P-B      QPAPDHARPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC793168_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLSQNTYGS
KC793180_HBSP_P-B      RPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KC793189_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFLHVAVQNLRTETAPVFPSHRPGLSQNTYGS
KC793199_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVPNLRTETAPVFPSHHLGLSQNTYGS
KF053159_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KF053162_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KF053163_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHAAVQNLRTETAPVFPSHHLGLSQNTYGS
KF053171_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KF053174_HBSP_P-B      QPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KF053180_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
KF053182_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNSYGS
KF053189_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KF053190_HBSP_P-B      PPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLWLSQNTYGS
KJ173298_HBSP_P-B      QPAPDHAKPAQLLLKDPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KJ173341_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNLRTETALVFPSHHLGLSQNSYGS
KJ173360_HBSP_P-B      QPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLSQNTNGS
KJ173375_HBSP_P-B      QPAPDHAKPAQLLLKETLCFPHVAVQNLRTETAPVFPSHHLGLSQNTYGS
KJ173378_HBSP_P-B      QPAPDHAKPARLLLKEPLCFPHVAVQNL