HBVdb

Dataset for protein HBSP of genotype B

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *    *     :      * .    :    :    :                     *   :          .  *. 
MPLSYQHFRKLLLLDeeAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQqPAPDHAkPAqLLLKEPLCFPHVAVQNLRT
      r  r    edd     d   h    d  h   de    dp  prp  r   eh rr  e   r        m
               kg                               r l      r      t               
               n                                  r                             
               q                                                                

        90       100       110 
....:....|....:....|....:....|.
    :*.*          *   * **   . 
ETAPVFPSHHLGLSQNTYGSGPQSVSLGSVY
 i        p     s         h   h
                               
                               
                               
© 1998-2021Legal notice