HBVdb

Dataset for protein LHBs of genotype E

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
: *** ***.  ***  .    *  *:** ** * **:  .**: **  ::   ..:***.:* .* :. * .::* .* 
MGLSWTVPLE-WGKNHSTTNPLGFFPDHQLDPAFRANTRNPDWDHNPNKDHWTEANKVGVGAFGPGFTPPHGGLLGWSPQ
                s     l         k       l      d            l         s   
                                            n        a                          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  *         *         * . *:* .** .    :  :   *.:             .**    .      :   
AQGMLkTLPADPPPASTNRQSGRQPTPITPPLRDTHPQAMQWNSTTFHQALQDPRVRGLYfPAGGSSSGTVNPVPTTASL
   iqtmv tn      k                     i   yka  kt  n k k---l          s     v  
     q                                 v                    -                   
     n                                                                          

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 *.     *  .  :   .* :* *   :. **  : * * **:. *  ***  ::*  .   * . .     *   * *
ISSIFSRIGDPAPNMEsITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLGQNSQSPtSnHSPTSCP
          l    dg                                    s   es   r   l   i s  l    
                n                                         t   p                 
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .   *  * :    :* * ***    *    *:*  *.  * .. . :*  *: ** ..  *  *  *. :.:  *
PICPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGPCRTCTTLAQGTSMFPSCCCSKPSDGN
 tw                               h i      l                p              er 
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 ..  **** *  *:** **  *   :  **  ..**.*:.  . * . **** *.  *      *  *  *   **.: 
CTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWFAGLSPTVWLSVIWMMWYWGPSLYNILSPFIPLLPIFFCLWVYI
                 g                   v    i             rr   t r   l xl      a  
                 v                                       n                      
                                                         g                      
© 1998-2022Legal notice