HBVdb

Dataset for protein MHBs of genotype D

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  .                    *       *  *    *        
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTaSpiSSIFSRIGDPALNMENITSGFLGPLLVLQAGFFLLTRI
----ykn   a    k k   l     t eaa   l  v hll    k   lvq        l           s   k 
i                s                       t           p                          
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      *    .::            . .      * * ..                       .       :   .   
LTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
    k         s    n   r                          y               t        h    
                                                                           r    
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* *       ..                         *    . :   :***    .: . *        .  .  ..  
VCPLIP--GSSTTStGPCRTCtTpaQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWF
   ml         v s k  mitv  a  f     i  l r             a    a  l                
              a t      l                                                        
                       i                                                        

       250       260       270       280   
....:....|....:....|....:....|....:....|...
                 .                         
VGLSPTVWLSVIWMMWYWGPSLYsILSPFLPLLPIFFCLWVYI
a    i   l ml       n crt r  il     ls  a  
            s       r fn                   
                       t                   
© 1998-2022Legal notice