HBVdb

Dataset for protein MHBs of genotype D

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                  .                    *          *    *        
MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTaSpiSSIFSRIGDPALNMENITSGFLGPLLVLQAGFFLLTRI
----ykn   a    k k   l       eaa   l  v hll    k   lvq        l           s   k 
i                s                       t           p                          
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      *    .::                     * * ..                       .           .   
LTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLP
    k         s    n   r                          y               t        h    
                                                                           r    
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
* *       ..                         *    . :   :***    .: . *           .  ..  
VCPLIP--GSSTTStGPCRTCTTpaQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFVQWF
   ml         v t k  mitv     f     i  l r             a    a  l                
              a s      l                                                        
                       i                                                        
                                                                                

       250       260       270       280   
....:....|....:....|....:....|....:....|...
                 .                         
VGLSPTVWLSVIWMMWYWGPSLYsILSPFLPLLPIFFCLWVYI
a    i   l ml   c   n cnt r  il     l   a  
            s       r fr                   
                    x  t                   
                       x                   
© 1998-2022Legal notice