HBVdb

Dataset for protein MHBs of genotype A

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                      . *         .               .      .                     :
mQWNSTAFHQALQDPRVRGLYfPAGGSSSGTvNPaPNIASHISSISaRTGDPvtNMENITSGFLGPLLVLQAGFFLLTRI
---tc t   t    k k   l        il  vqttv     t sti   apt       l r             k 
t c-                                                 l                          
v                                                    s                          
i                                                    a                          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  :    .                * .   *   :  *  .    .   :  :   :    *   *    *   . :.  
LTIPQSLDSWWTSLNFLGGsPVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILL-LCLIFLLVLLDYQGML
              s   ep e r                  t                                c    
                   a                                                            
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 * .                     .:  .   *  *        *      .      *     . :       .:.  
PVCPLIPGSTTT--STGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLWEWASVRFSWLSLLVPFVQW
         a       t r        t  i        m                 f  g   a              
                                                             d                  
                                                                                
                                                                                

       250       260       270       280    
....:....|....:....|....:....|....:....|....
:                  .            :   *   *   
FVGLSPTVWLSaiWMMWYWGPSLYsIvsPFIPLLPIFFCLWVYI
 a        lvm  ilf   n cntlr  l   l  lf  a  
                s    r h                    
                     x f                    
                                            
© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice