HBVdb

Dataset for protein HBc of genotype all

[Download (right click)] [Edit] [Sequences] [Repertoires]

11145 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KC774226_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFLFFQNLLNTPSA
MF488699_HBc_P-RF-DE      ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU964381_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964382_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964383_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964384_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964385_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964388_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964391_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964393_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964395_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964397_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964386_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964387_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964389_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964390_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964392_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964396_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668003_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRNLLDTANA
KU576713_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU668309_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRNLLDTANA
KU667987_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU576702_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU576707_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU667997_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU668332_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU576718_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU576501_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576496_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDLFPSIRDLLDTASA
KU576507_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011476_HBc_P-B          ------------MDIDPYKEFGASIELLS--FLPSDFFPSIRDLLDTASA
EU939635_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KU668014_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576303_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576299_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576308_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406186_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406187_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406188_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406189_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406192_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406194_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406195_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406197_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406198_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406199_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406200_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406203_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406208_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406210_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406214_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406216_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406217_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406219_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406190_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406191_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406193_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406196_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406201_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406202_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406204_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406205_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406206_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406207_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406209_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406211_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406212_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406213_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406215_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406218_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
EU158263_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB212626_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ562257_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AY220703_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AY220704_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU939639_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AY596112_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU576300_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670298_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU667473_HBc_P-B          ------------MDIDPYKESGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341466_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ361535_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY269109_HBc_P-B          ------------MDIDPYKEFRASVELLS--FLPSDFFPSIRDLLDTASA
KU668305_HBc_P-B          ------------VDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTATA
FJ562231_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406335_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB031267_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562253_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667968_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667481_HBc_P-B          ------------MDIDPYKESGASVELLS--FLPSDFLPSIRDLLDTASA
KU667740_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASA
MF568475_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASA
KU668304_HBc_P-B          ------------TDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASA
KU576924_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406164_HBc_P-B          ------------MDIDPFKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774397_HBc_P-B          ------------MDIDPYKEFGASIELLS--FLPSDFFPSIRDLLDTASA
AB014386_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU827630_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EF494381_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
AY206375_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562261_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276818_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTVSA
KU667993_HBc_P-B          ------------MDIDPYKESGASVELLS--FLPSDFFPSIRDLLDTASA
KU667647_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667640_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASA
KU576307_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576301_HBc_P-B          ------------MDIDPYKEFGAFVELLS--FLPSDFFPSIRDLLDTASA
KP406240_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KP406238_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KP406234_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JX429901_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040147_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667957_HBc_P-B          ------------MDIDPYKEFGASVGLLS--FLPSDFFPSIRDLLDTTSA
FJ562221_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939569_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670310_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668008_HBc_P-B          ------------MDIDPYKEFGASVELPS--FLPSDFFPSIRDLLDTASA
JQ341508_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ027333_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU522071_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668165_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASA
KU667768_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667701_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667506_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASA
KU667455_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASA
KU667447_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576638_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576297_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575940_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575938_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
KP406243_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406242_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406241_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406237_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406236_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406235_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406233_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406232_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406231_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406230_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406229_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406228_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406227_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406225_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406224_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406223_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406222_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406221_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406220_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM875417_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM875416_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341480_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504536_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276815_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASA
AB670242_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011469_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASA
KX276822_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASA
AY220697_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ787475_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU939663_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU939669_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ899779_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
HM011492_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406330_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406332_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406333_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406334_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964276_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964283_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964272_HBc_P-B          ------------MDIDPYKEFGASVELLF--FLPSDFFPSIRDLLDTASA
KU964273_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964274_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964275_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964277_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964278_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964279_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964281_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964282_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964284_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964285_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964280_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSMRDLLDTAAA
KU964286_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSMRDLLDTASA
KY470858_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPTDFFPSIQDLIDTATA
KY470871_HBc_P-RF-GC      ------------MDIDPFKEFGASVELLS--FLPTDFFPSIQDLIDTATA
KY470865_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPNDFFPSIQDLFDTATA
KU667834_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576876_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667668_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667773_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667835_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667825_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667801_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB368295_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KY363286_HBc_P-C          ------------MDIDLYKEFGASVELLS--FLPTDFFPSIRDLLDTATA
KY363287_HBc_P-C          ------------MDIDLYKEFGASVELLS--FLPTDFFPSIRDLLDTATA
DQ144596_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144559_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144589_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144606_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
DQ144600_HBc_P-B          ------------MDIGTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
DQ144592_HBc_P-B          ------------MDIDTYKEFEASVELLS--FLPSDFFPSIRDLLDTAAA
DQ144587_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144576_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB031264_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144543_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144544_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144545_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144546_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144548_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144551_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144552_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144554_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144555_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144556_HBc_P-B          ------------MDIDTYKEFEASVELLS--FLPSDFFPSIRDLLDTASA
DQ144557_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144558_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144565_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144567_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144574_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144575_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144578_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144579_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSGFFPSIRDLLDTASA
DQ144581_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144582_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144583_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144584_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144586_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144590_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144593_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144595_HBc_P-B          ------------MDIDTYKEFEASVELLS--FLPSDFFPSIRDLLDTASA
GQ377606_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144570_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667730_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP406256_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KP406259_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU939679_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ562246_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ386680_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
GQ377582_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ410502_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
JQ027334_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ562321_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ386669_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF324067_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668243_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU667828_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU667811_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLIDTASA
KU576614_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406258_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KY881853_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276797_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
KX276770_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964132_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ848339_HBc_P-C          ------------MDIDTYKEFGASGELLS--FLPSDFFPSVRDLLDTASA
MF674422_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KU576773_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU939660_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU916228_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FFASDLFPSVRDLLDTATA
AY641563_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964248_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667789_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576617_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576612_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT749851_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAFA
KP406317_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406298_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406293_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406289_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406288_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406287_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406286_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406285_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406284_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173419_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ173418_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX504543_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
JX026886_HBc_P-B          ------------MDIDTYKEFGASVELIS--FLPSDFFPSIRDLLDTASA
D00630_HBc_P-C            ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAFA
AB670259_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPADFFPSXRDLLDTATA
MF674464_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU964135_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964133_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964130_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964126_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964125_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSNFFPSIRDLLDTASA
KU964082_HBc_P-B          ------------MDIDTHKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964080_HBc_P-B          ------------MDIDTHKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU667637_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KU576879_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576877_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KU576809_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KU576807_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTVSA
KU576283_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU576277_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576064_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576046_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT749820_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFYPSIRDLLDTATA
KJ790200_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KC774405_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JX507213_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341474_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144585_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KJ803758_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KJ803755_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
JQ040138_HBc_P-B          ------------MDIDLYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
KR013943_HBc_P-C          ------------MDLDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KR013862_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLVDTASA
KJ598638_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLVDTASA
KJ598637_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLVDTASA
FJ562291_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
AB670275_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLVDTASA
AB105174_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLVDTASA
KY881825_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964394_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964256_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964255_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964245_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964137_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964136_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964134_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964131_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964129_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964128_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964127_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964124_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576808_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576803_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP036970_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KM875426_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429910_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX026887_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU589339_HBc_P-RF-CB      ------------MDINTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
MF674471_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ562340_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ562300_HBc_P-C          ------------MDIDTYKPFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ562272_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ562266_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU939643_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAFA
EU939543_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU916216_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAFA
D50520_HBc_P-C            ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
MF674450_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
LC416037_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964302_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964301_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964300_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964299_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964298_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964297_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964296_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964295_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964294_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964293_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964292_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964291_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964290_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964289_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964288_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964287_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KU964254_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964253_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964251_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964249_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964247_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964246_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964244_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964123_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964106_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964103_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964099_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964097_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964095_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964094_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964093_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667591_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576939_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576875_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576054_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576053_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774395_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774389_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774383_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774377_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774371_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774365_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ429082_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341471_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341460_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX660682_HBc_P-RF-DC      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLXDTASA
KU964092_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964091_HBc_P-B          ------------MDIDTYKEFGAYVELLS--FLPSDFFPSIRDLLETATA
KU964090_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964089_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964088_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964087_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964086_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964085_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964084_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964083_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964081_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964079_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
HM011494_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSXRDLLDTAXA
JQ040157_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTXXA
KF166001_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KX276813_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPSDFFPSIRDLLDTATA
KU576106_HBc_P-B          ------------MDIDPYNEFGASAELLS--FLPSDFFPSIRDLLDTASA
AF324070_HBc_P-B          ------------MDIDPYKEFGACVELLS--FLPYDFFPSIRELIDTASA
AY217361_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
AF323467_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELIDTASA
EU939541_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406311_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406296_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406300_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406302_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406297_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406305_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406306_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406307_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406308_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406309_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406310_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406312_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406313_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406314_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406315_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KP406316_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KJ803827_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
MG571351_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571336_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576114_HBc_P-B          ------------MDIDPYKQFGASVDLLS--FLPSDFFPSIRDLLDTASA
JQ341499_HBc_P-B          ------------MDIDPYKEFGASXELLS--FLPSDFYPSIRDLLDTASA
KP406301_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406304_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY206381_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU576107_HBc_P-B          ------------MNIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406303_HBc_P-B          ------------MDIDTYKEFGASVELLS--FXPSDFFPSVRDLLDTASA
KX276836_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPXDFFPSIRDLLDTATA
KY881799_HBc_P-B          ------------MDIDTYKEFGASVELLS--FFPSDFFPSIRDLLDTASA
KJ803756_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
Y18856_HBc_P-RF-CB        ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
GQ377556_HBc_P-RF-CB      ------------MDIDTYKEFGGSVELLS--FLPSDFFPSIRDLLDTASA
KJ803777_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
GQ924619_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTATA
FJ562293_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939586_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
AY167091_HBc_P-C          ------------MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASA
MG571375_HBc_P-B          ------------MDIGPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881869_HBc_P-B          ------------MGIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276781_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPHDFFPSIRDLLDTASA
KU667952_HBc_P-B          ------------VDIDPYKEFGASVELLS--FLSSDFFPSIRDLLDTASA
KU576621_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576111_HBc_P-B          ------------MDIDPYKQFGASVDLLS--FLPSDFFPSIRDLLDTASA
KU576084_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTTSA
KR013802_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
JQ801515_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
GQ377575_HBc_P-C          ------------MDIDPYKEFRASVELLS--FLPSDFFPSIRDLLDTATA
FJ751765_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFSSIRDLLDTASA
EU919165_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU547559_HBc_P-C          ------------MDIDPYKEFGASPKLLS--FLPSDFFPSIHDLLYTASA
DQ089773_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367413_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELIDTASA
KY881865_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881849_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881783_HBc_P-B          ------------MDIDKYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406267_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ803808_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KC774415_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470937_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803760_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ598662_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ904423_HBc_P-C          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
FJ562326_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ023652_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU547562_HBc_P-C          ------------MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASA
DQ089775_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF568491_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPPDFFPNIRDLLDTASA
KY689534_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KY689502_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689501_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689448_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KY353928_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276804_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406292_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ803822_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803788_HBc_P-RF-CB      ------------MDIDPYKEFGASVEIPF--FLPSDFFPSIRDLLYTTSV
KU964235_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964230_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ598737_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ598736_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ598730_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ598727_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF873514_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KC774296_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
JQ801499_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801472_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ429078_HBc_P-C          ------------MDIDPYKEFGASVELLP--FLPSDFFPSIRDLLDTASA
FJ715343_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386612_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ032338_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939648_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU939552_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ986376_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
DQ922651_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089803_HBc_P-C          ------------MDNDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089787_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089786_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB900115_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPNIRDLLDTASA
AB367420_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB113876_HBc_P-C          ------------MDIDTYKEFGASVELLS--FMPSDFFPSIRDLLDTASA
AB113875_HBc_P-C          ------------MDIDTYKEFGASVELLS--FMPSDFFPSIRDLLDTASA
MG571368_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571361_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
MF674396_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
MF568461_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC349879_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881950_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KY881947_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KY881946_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KY881945_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLFDTASA
KX276788_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576153_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576096_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576086_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576085_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011503_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JF828938_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
JF828936_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
JF828935_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
JF828934_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
JF828933_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
MK321266_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTAAA
MG893556_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881815_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFSSIRDLLDTASA
KY881814_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFSSIRDLLDTASA
KY881803_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964228_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964214_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU964076_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT366464_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ598671_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598665_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF485390_HBc_P-C          ------------MDIDPYKESGASVEILS--FLPSDFFPXIRDLLDTASA
JX026878_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
JQ801520_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040135_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
JF828937_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
GQ377599_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
FJ751764_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715403_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715383_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939567_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
EU796069_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
EU562216_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
EU554540_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTGSA
EF137803_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089784_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB300361_HBc_P-C          ------------MDIDPYKEFGGSVEPLS--FLPSDFFPSIRDLLDTASA
AB176643_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571360_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571339_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF621878_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTATA
KY881948_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KY881808_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881801_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881800_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881798_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881797_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881796_HBc_P-B          ------------MDTDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881794_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881793_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881791_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881790_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881787_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881786_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881784_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881782_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881781_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881780_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689468_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689402_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576778_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341509_HBc_P-B          ------------MDIDXYXXFGASVELLS--FLPSDFFPSIRDLLDTATA
MG893561_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803782_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC774485_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KY363253_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDAATA
KX276833_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPLDFFPSIRELLDTASA
KU679960_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KF214677_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAS
KC774221_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040139_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ855543_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AB670266_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
AB014361_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
MF674506_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
MF674414_HBc_P-B          ------------MDIDPYKEFGASVELLS--FXPSDFFPSIRDLLDTASA
KY881789_HBc_P-B          ------------TDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689555_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803781_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MK052968_HBc_P-RF-BD      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925389_HBc_P-RF-DC      ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
MF925381_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470893_HBc_P-RF-CB      ------------MDIDPYKEFGTSVELLS--FLPSDFFPSIRDLLDTASA
KX765835_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX660689_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX660677_HBc_P-RF-DC      ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
KU679953_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU679939_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KT991427_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT991424_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173280_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873521_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KF873519_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KF873518_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KF873517_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KF873515_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KF873511_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KC774414_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429896_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF436922_HBc_P-RF-CB      ------------MDIDPYKEFGASVELIS--FLPLDFFPSIRDLLDTASA
HQ684849_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
HM750142_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
GQ377594_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377590_HBc_P-RF-CB      ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
FJ715387_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386643_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916240_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871997_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY817513_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367800_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG893558_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571345_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925376_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674474_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279258_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279246_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470991_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470990_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470983_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470934_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470875_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470874_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470873_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363277_HBc_P-C          ------------MDIDPYKEFGASVELLP--FLPSDFFPSIRDLLDTASA
KY363260_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTAAA
KX765839_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765829_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964241_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964049_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964045_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU577055_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU051423_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT307719_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR819180_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013993_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRGLLDTASA
KR013974_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRGLLDTASA
KR013908_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRGLLDTASA
KR013871_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013856_HBc_P-C          ------------MDTDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013846_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KR013832_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KR013819_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013801_HBc_P-C          ------------MDIDPYIEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013796_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013793_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013789_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013788_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
KR013784_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLPDTASA
KR013781_HBc_P-C          ------------MDIDPYKEFGASVESLS--FLPSDFFPSIRDLLDTASA
KR013768_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148562_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148558_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148520_HBc_P-C          ------------MDIDPYKEFGVSVELLS--FLPSDFFPSIRDLLDTASA
KP148488_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148480_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDYFPSIRDLLDTASA
KP148475_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803815_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803814_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803774_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598733_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ598722_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ598672_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598661_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598657_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598654_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598653_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598651_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598650_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPLDFFPSIRDLLDTASA
KJ598649_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598639_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173432_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KJ173302_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173287_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214671_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214651_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC875273_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KC875268_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC875265_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC875264_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KC774338_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KC774331_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KC774306_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KC774182_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX870000_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429905_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX036339_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801495_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
JQ801487_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801480_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801473_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707774_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707773_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707772_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707771_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707770_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707769_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707768_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700522_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700516_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700506_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750141_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDAASA
HM011497_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924650_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPNIRDLLDTASA
GQ855528_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475326_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ475320_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
GQ377632_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
GQ377555_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
GQ358157_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715421_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715404_HBc_P-C          ------------MDIDPYKEFGASVELPS--FLPSDFFPSIRDLLDTASA
FJ715381_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715372_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715367_HBc_P-C          ------------MDIDPYKEFGASVELLS--FVPSDFFPSIRDLLDTASA
FJ715342_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562308_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562288_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
FJ386613_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386609_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
FJ386602_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ032355_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023640_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939612_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939603_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939597_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916213_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRGLLDTASA
EU570067_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU554541_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU554539_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU439005_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306727_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EF137802_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ478900_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
DQ377164_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ377163_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ377162_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ377160_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFLSIRDLLDTASA
DQ089782_HBc_P-C          ------------MDIDPYKEFGASVELLS--FWPSDFFPSIRDLLDTASA
DQ089766_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089759_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
D50518_HBc_P-C            ------------MDIDPYKEFGASVELLS--FMPSDFFPSIRDLLDTASA
D50517_HBc_P-C            ------------MDIDPYKEFGASVELLS--FMPSDFFPSIRDLLDTASA
AY862869_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY206389_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
AY206386_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF533983_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF324084_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB931171_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB931170_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670279_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670263_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670258_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367422_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
AB367421_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367395_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
AB111125_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
AB111117_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AB111116_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AB074756_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB026813_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014395_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014391_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
MG571367_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
MG571321_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674507_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
MF674473_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674462_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
MF674455_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674434_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674433_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674423_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
MF674419_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
MF674389_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
MF568485_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KY881958_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881956_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881955_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881951_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881949_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689500_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470961_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTAST
KY470960_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTAST
KY470954_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRGLLDTASA
KY417926_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341482_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341470_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011473_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPXDFXPSVRDLLDTASA
KU679946_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
JX661486_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK286461_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826136_HBc_P-C          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
KY881880_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881818_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881802_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363276_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964243_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964238_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963898_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDIASA
KR013771_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFLPSIRDLLDTASA
KP148546_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598720_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598678_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598677_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598676_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598674_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598673_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598670_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598669_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598668_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598667_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598666_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598664_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598663_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410498_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873516_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
JQ341517_HBc_P-C          ------------MDIDPYKEFXASVELLS--FLPSDFFPNVRDLLDTASA
JQ040129_HBc_P-C          ------------MDIDPYKEFGASSELLS--FLPSDFFPSIRDLLDTASA
GQ475325_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386652_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY167096_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674407_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674385_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276790_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ151413_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDLFPSIRDLLDTASA
KF873531_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY862866_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925378_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470888_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470886_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276840_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964191_HBc_P-C          ------------MDIDPYKEFGASVELLX--FLPSDFFPSIRDLLDTASA
KR013809_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873539_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
JQ341544_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040141_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN400089_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
JN400087_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
GQ924629_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023655_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916215_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF458664_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF223960_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670285_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670254_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670252_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571349_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571323_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674508_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674445_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341497_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK720628_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK720627_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK321265_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK052967_HBc_P-RF-BD      ------------MDIDPYKEFGASVELLS--SLPSDFFPSIRDLLDTASA
MH094410_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG893559_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG893555_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG893554_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826148_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826147_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826146_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826144_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC458432_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279267_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279266_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279265_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279264_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279263_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX660684_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX660680_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX660675_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX660674_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX354997_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964317_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964316_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964314_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964313_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964312_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964311_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964310_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964309_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964308_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964307_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964306_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964305_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964304_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964303_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964010_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964009_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964008_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964007_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964006_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964005_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964003_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964001_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963999_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963998_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963995_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963994_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963993_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963991_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963990_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963870_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963869_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963868_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963867_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963866_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963865_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963864_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963863_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963862_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963861_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963860_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963859_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963858_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963857_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963856_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU679942_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU679941_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU519423_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU519422_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT991421_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT003704_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013816_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP276256_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP276255_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP276254_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP276253_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148352_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148337_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803804_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803802_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803772_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410520_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173358_HBc_P-RF-CB      ------------MDIDPYKEFGAFVELLS--FLPSDFFPSIRDLLDTASA
KJ173350_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173349_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173330_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173329_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173326_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173325_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173322_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173320_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173300_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173299_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173279_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF917451_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873543_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873542_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873538_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873534_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873532_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873527_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873524_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873523_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873522_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774499_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774498_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774497_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774495_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774494_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774493_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774492_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774490_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774489_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774488_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774487_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774484_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774483_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774482_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774480_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774478_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774476_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774475_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774474_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774472_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774471_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774470_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774468_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774466_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774463_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774461_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774458_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774457_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774456_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774455_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774454_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774452_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774448_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774439_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774435_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774434_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774433_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774432_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774431_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774430_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774426_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774424_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774423_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774422_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774349_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774344_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774341_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774332_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774328_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774324_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774322_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774317_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774294_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774258_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774246_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774234_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774230_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774222_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774212_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774201_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774198_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774193_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774186_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774183_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661498_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661494_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661487_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661485_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429898_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801477_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801476_HBc_P-RF-CG      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ732168_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040175_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040174_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040146_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN400086_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
JN104442_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN104438_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF491456_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF491455_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF491451_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF491449_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF491448_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700547_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700526_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
HQ700521_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700508_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700507_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700505_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750150_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750149_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750147_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750146_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750145_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750144_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750143_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750133_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924618_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377635_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377634_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377633_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377630_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377626_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377614_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377613_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377611_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377607_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377602_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377596_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377595_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377581_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377573_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377565_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377564_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377560_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377549_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377548_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377544_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377539_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377534_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377522_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377520_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377516_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787480_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787446_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715414_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715413_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715412_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715411_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715385_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715384_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562314_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562294_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562271_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562247_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386649_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ349241_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032337_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916241_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916239_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916232_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU835240_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU787434_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU589337_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ478897_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ478892_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ478890_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ478889_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ478887_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144601_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY862865_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY817515_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY817512_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY817511_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY817510_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY800249_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY247030_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY167095_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY123424_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY123041_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY040627_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011108_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011105_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011104_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF330110_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB674504_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB241109_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195957_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195956_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195955_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195951_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195950_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195941_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195940_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195939_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB033557_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB031265_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN664919_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
X04615_HBc_P-C            ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
V00867_HBc_P-C            ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK628732_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MH887433_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MH220971_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
MH094411_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG893560_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG893557_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826135_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826134_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826133_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826131_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826128_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826127_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826123_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDFLDTASA
MG725248_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925410_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925409_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925408_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925406_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925377_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925375_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925365_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925359_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674502_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674501_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674494_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674486_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674484_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674472_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674468_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674454_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674444_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674442_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674435_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674429_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674418_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674412_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674408_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674402_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674399_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674398_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674388_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674386_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC373512_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC373511_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC318703_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC318702_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279276_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279275_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279274_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279262_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279260_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279259_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279257_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279256_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279255_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279254_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279251_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279250_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279249_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279248_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279247_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279245_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC090200_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881984_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881980_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881777_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881776_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881775_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881774_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881773_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881772_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881771_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881770_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881769_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881768_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881767_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881766_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881765_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881764_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881763_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881762_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881758_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881755_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881754_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881751_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881750_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881749_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881748_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881744_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881743_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881742_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881739_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881738_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881737_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881736_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689435_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY670782_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY629631_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470988_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470987_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470986_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470985_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470984_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470982_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470981_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470980_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470936_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470933_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470929_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470911_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470908_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470905_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470904_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470903_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470902_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470901_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470899_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470897_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470895_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470894_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470892_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470891_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470890_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470889_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470887_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470885_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470884_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470882_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470881_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470879_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470878_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470877_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470876_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363274_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY022423_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX774506_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX774504_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765855_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765853_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765852_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765850_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765848_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765847_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765846_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765845_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765844_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765843_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765840_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765838_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765837_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765836_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765834_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765833_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765832_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765831_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765830_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765827_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765826_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765825_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765824_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765823_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765821_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765820_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765819_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765818_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964348_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964347_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964346_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964345_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964344_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964342_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964341_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964340_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964339_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964338_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964337_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964336_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964334_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964240_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964239_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964237_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964234_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964233_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964232_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964231_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964229_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964225_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964224_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964218_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964216_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964199_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964198_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964197_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964196_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964195_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964194_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964193_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964192_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964188_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964187_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964184_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964183_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964181_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964178_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964176_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964174_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964171_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964170_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964169_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964078_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964077_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964075_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964074_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964073_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964072_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964071_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964070_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964069_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964068_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964067_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964066_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964065_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964064_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964063_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964062_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964061_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964060_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964059_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964058_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964057_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964056_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964055_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964054_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964053_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964052_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964051_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964050_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964048_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964047_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964046_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964044_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964043_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964042_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964041_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964040_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964039_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964038_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964037_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964036_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964035_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964034_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964033_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964032_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964031_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964030_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964029_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964028_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964027_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964026_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964025_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964024_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964023_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KU964022_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964021_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964020_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964004_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963914_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963913_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963912_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963911_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963910_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963909_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963908_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963907_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963906_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963905_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963904_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963903_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963902_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963901_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963900_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963899_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963897_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963896_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963895_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963894_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963893_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963892_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963891_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTTSA
KU963890_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963889_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963888_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963887_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963886_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963873_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963872_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU051427_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU051426_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU051425_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU051424_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT987426_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT987425_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT987424_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT987423_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT366463_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT364752_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT364751_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT364721_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT364720_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT364719_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT364718_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT307718_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT284756_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT284755_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT284754_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT284753_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR014006_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013998_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013984_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013961_HBc_P-C          ------------MDIDPYKKFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013909_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013904_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFLPSIRDLLDTASA
KR013877_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013875_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013873_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013858_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013857_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLGTASA
KR013854_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013853_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013852_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013837_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDILDTASA
KR013834_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013831_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013830_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013829_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013828_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013827_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013825_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013823_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013822_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013815_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013813_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013812_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013811_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013810_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013808_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013803_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013799_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013798_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013794_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013791_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013790_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013787_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013786_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013785_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013783_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013782_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013780_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013779_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013776_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013774_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013773_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013772_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013767_HBc_P-C          ------------MDIDPYKEFGAPVELLS--FLPSDFFPSIRDLLDTASA
KR013763_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013762_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013761_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP784761_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148574_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148573_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148572_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLGTASA
KP148571_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148570_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148568_HBc_P-C          ------------MDIDPYKAFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148566_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148564_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148561_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148560_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148559_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148557_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148555_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148554_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148551_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148549_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148548_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148547_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148545_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148540_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148538_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148535_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148532_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148531_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148529_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148528_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148526_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148524_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148523_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148521_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148517_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148513_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148512_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148493_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148492_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148489_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148487_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148482_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148481_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148476_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148474_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148473_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148471_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148469_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148468_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148466_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148465_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148464_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148463_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148315_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP027477_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM526746_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM526745_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM526744_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM359441_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KM229703_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM213037_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803818_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803813_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803811_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803809_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803799_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803793_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803792_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803766_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803765_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KJ803761_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803759_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ790199_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598753_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598749_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598740_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598739_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598738_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598735_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598734_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598732_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598731_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598729_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598728_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598725_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598724_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598723_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598716_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598710_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598701_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598699_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598698_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598696_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598695_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598694_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598691_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598690_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598689_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598688_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598681_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598660_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598659_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598656_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598655_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598652_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598648_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598647_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598645_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598642_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598641_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598640_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598636_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598635_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410519_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410513_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410504_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410501_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410496_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410495_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173446_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173444_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173443_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173442_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173441_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173440_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173439_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173438_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173437_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173436_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173435_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173434_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173433_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173431_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173430_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173429_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173428_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173427_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173426_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173396_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173395_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173394_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173393_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173392_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173391_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173336_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173335_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173333_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173332_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173331_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173328_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173327_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173324_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173321_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173317_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173315_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173314_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173313_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173312_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173311_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173310_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173309_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173308_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173307_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173306_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173305_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173304_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173303_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173301_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173296_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173294_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173293_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173292_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173291_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173289_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173288_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173286_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173284_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173283_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173282_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173281_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873526_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF779300_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF495606_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF485389_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214673_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214672_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214668_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC875272_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC875270_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC875267_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC875263_HBc_P-C          ------------MDIDPYKEFGAPVELLS--FLPSDFFPSIRDLLDTASA
KC875262_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC875261_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774360_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774359_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774356_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774352_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774351_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774348_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774347_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774345_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774343_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774342_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774339_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774337_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774336_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774335_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774334_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774333_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774330_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774329_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774327_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774326_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774325_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774320_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774318_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774316_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774315_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774314_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774312_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774310_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774309_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774308_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774304_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774303_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774300_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774299_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774298_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774295_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774293_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774292_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774290_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774289_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774287_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774286_HBc_P-C          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
KC774285_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774283_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774281_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774280_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774277_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774276_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774274_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774272_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774271_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774270_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774268_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774267_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774266_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774265_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774264_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774262_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774261_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774260_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774257_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774256_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774255_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774254_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774252_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774251_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774250_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774249_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774248_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774247_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774244_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774242_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774241_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774239_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774238_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774237_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774236_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774235_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774233_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774232_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774231_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774229_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774228_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774224_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774223_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774220_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774219_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774217_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774216_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774215_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774214_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774213_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774210_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774209_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774208_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774206_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774205_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774204_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774203_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774202_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774200_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774197_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774196_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774192_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774191_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774190_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774189_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774187_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774185_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774184_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774181_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774180_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661496_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661495_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661492_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661491_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661490_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661489_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661488_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX560520_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504546_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504545_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504544_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504537_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504534_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429917_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429916_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429915_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429913_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429909_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429907_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429906_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429904_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX036338_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX036337_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX036336_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX036335_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX026885_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801522_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801519_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801513_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801511_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801510_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801505_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801504_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801501_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
JQ801497_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801496_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801488_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801486_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801482_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801475_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801470_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ688404_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ688403_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040165_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLXSDFFPSIRDLLDTASA
JQ040163_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040162_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040154_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040145_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040133_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN827425_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN827424_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN827423_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN827422_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN827421_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN827420_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN827418_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN827417_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN827415_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN827414_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN400088_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDRLDTASA
JN315779_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN104440_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN104433_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN104432_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF899336_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828920_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828919_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828918_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828917_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828916_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828915_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828913_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700517_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750140_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750139_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750138_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750137_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750136_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750132_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750131_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011493_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
HM011489_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011486_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011465_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU721029_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU563561_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU434374_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924649_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924636_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924633_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924623_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924614_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924613_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924604_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ872210_HBc_P-C          ------------MDIDPYKKFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ855548_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ855544_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ855541_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ855534_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ855525_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ855523_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475350_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475348_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475347_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475346_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475345_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475339_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475334_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475333_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475332_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475331_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475330_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475329_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475328_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475327_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475322_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475321_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475319_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475317_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475316_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475315_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475314_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475313_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475312_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475311_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475310_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475308_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475307_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475306_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475305_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377642_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377640_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377637_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377636_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377631_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377624_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377619_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377618_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377617_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377616_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377615_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377605_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377603_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377601_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377600_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377598_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377591_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377585_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377584_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377583_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377580_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377579_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377578_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377577_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377576_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377574_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377572_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377571_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377570_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377563_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377562_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377559_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377554_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377553_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377551_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377546_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377541_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377540_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377538_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377536_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377535_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377533_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377531_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377529_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377528_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377527_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377524_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377523_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377521_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377517_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377515_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377514_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ358158_HBc_C-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ358154_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ899775_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ899763_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787479_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787461_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787454_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787453_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787449_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787447_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787441_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715409_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715407_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715406_HBc_P-C          ------------MDIDPYKEFGASVELPS--FLPSDFFPSIRDLLDTASA
FJ715405_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715402_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715400_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715398_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715397_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715395_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715389_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPFIRDLLDTASA
FJ715382_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715380_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715379_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715378_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715377_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715376_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTTSA
FJ715375_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715374_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715371_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715370_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715366_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715365_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715364_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715358_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715357_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSGFFPSIRDLLDTASA
FJ715355_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715353_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715352_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715344_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715341_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562332_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562327_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562323_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562320_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562304_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562298_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562297_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562295_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562290_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562285_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562283_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562282_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562281_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562276_HBc_P-C          ------------MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASA
FJ562275_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562274_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562269_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562268_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562258_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562255_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562245_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562244_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562242_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562233_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562218_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ518813_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386678_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386670_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
FJ386667_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386665_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386664_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386653_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386639_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386638_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDXLDTASA
FJ386637_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386630_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386627_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386626_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386623_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386619_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386618_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386611_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386607_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386601_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386598_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386597_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386595_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386591_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386588_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386587_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386577_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386576_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386575_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ349225_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032361_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032356_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLGTASA
FJ032351_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032350_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032345_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032341_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032340_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032339_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032336_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032334_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032333_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032332_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032331_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023658_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023657_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023656_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023654_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023653_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023650_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023649_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023648_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023647_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023646_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023644_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023643_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023642_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023641_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023571_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939652_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939619_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939604_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939583_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939580_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939578_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939549_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916238_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916237_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916229_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916225_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916224_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916223_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916217_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916214_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916212_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916211_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916210_HBc_P-C          ------------MDIDPYKEFGASVVLLS--FLPSDFFPSIRDLLDTASA
EU872010_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871982_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871977_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871975_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871971_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871969_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU670263_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU589345_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU579442_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU570074_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU570073_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU570068_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU562218_HBc_P-C          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
EU562217_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU562215_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU560440_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU554542_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU554538_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU554537_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU554535_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU410081_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU410080_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306729_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306725_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306722_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306721_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306720_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306719_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306714_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306713_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306694_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306691_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306690_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306689_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306688_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306687_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306685_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306673_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU305542_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU305541_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU305540_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EF688062_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ993693_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ993690_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ980550_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ975273_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ922650_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ922649_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ536414_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ536410_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ478885_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ377161_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ315783_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ315781_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ246215_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144604_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144603_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144553_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089793_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089789_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089783_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089781_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089780_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089779_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089770_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089769_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089765_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089764_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089763_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089760_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089758_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
D50519_HBc_P-C            ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
D23680_HBc_P-C            ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
D12980_HBc_P-C            ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY641561_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY641560_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY641558_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDRLDTASA
AY596108_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY596107_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY247032_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY247031_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY206384_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY167099_HBc_P-C          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
AY057947_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011107_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011106_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011101_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011100_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011099_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011098_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011097_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AJ748098_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF473543_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF461363_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF461357_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF384367_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF384366_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF384365_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF384364_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF363961_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF324081_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF286594_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF241411_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF223959_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF223958_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF223957_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF223956_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF223955_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF223954_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF182805_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF182803_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF182802_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF068756_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB900116_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB697500_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB697490_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB675677_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB675675_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB675674_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670311_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670307_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670306_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670305_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670297_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670294_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670292_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670287_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670283_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670282_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670273_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670267_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670265_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670253_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670247_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670243_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670240_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670239_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670238_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB642100_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB642099_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB640730_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB485808_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB471853_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB471852_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB471851_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB471850_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB471849_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB471848_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB426467_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367434_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367427_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367417_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367411_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367409_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367404_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367403_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367399_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367397_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367396_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367394_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB362932_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB300365_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB300363_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB300362_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB300359_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB299858_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB250109_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB247916_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB246346_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB246345_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB246344_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
AB241111_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB241110_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB222715_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB222714_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB205124_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB205123_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB202071_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB198083_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB198082_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB198081_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB198080_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB198079_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB198078_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB198077_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB198076_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195954_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195953_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195949_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB113879_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB112472_HBc_P-C          ------------MDIDPNKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB112471_HBc_P-C          ------------MDIDPNKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB112348_HBc_P-C          ------------MDIDPYKVFGASVELLS--FLPSDFFPSIRDLLDTASA
AB111124_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
AB111120_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB111119_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB106895_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB105173_HBc_P-C          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
AB050018_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB042283_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB033556_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB033553_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB033552_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB033551_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB033550_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB031262_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB026815_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB026814_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB026812_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB026811_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014398_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014385_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014377_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014376_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014374_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014368_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014362_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK075117_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK052965_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK052962_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MH663473_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MH061283_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826153_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571371_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571369_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571366_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571365_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571364_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571362_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571356_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571355_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571347_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571346_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571344_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571342_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571340_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571328_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571322_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674515_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674513_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674512_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674511_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674510_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674509_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674500_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674497_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674495_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674493_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674490_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674488_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674485_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674483_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674482_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674481_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674480_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674477_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674460_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674456_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674453_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674452_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674451_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674449_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674443_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674438_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674437_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674432_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674431_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674427_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674426_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674424_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674421_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674416_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674413_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674410_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674405_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674404_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674400_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674397_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674395_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674394_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674393_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674387_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674384_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674382_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
M54923_HBc_P-B            ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC349878_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC349873_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC349871_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689563_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689553_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KY689546_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689538_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689517_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689514_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689513_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689480_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689477_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689472_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689443_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689413_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689408_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY629636_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470962_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470956_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470953_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765856_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765841_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341472_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013996_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ751770_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964236_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT284757_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013797_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598726_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276823_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
KY689520_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
KY689525_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276854_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276835_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924609_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089801_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689414_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276824_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011495_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668171_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTAAA
KU668150_HBc_P-B          ------------MDIDPYKEFGASVGLLS--FLPTDFFPSVRDLLDTAAA
KU668195_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTAAA
JQ927384_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
KP168419_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
X80927_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPHDFFPSLRDLLDTASA
X80928_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPHDFFPSLRDLLDTASA
X97849_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPHDFFPSLRDLLDTASA
HM011481_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPPVRDLLDTASA
KX276839_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPPVRDLLDTASA
KU668369_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
AB674424_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
JN040768_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTATA
JF754594_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTATA
AF419528_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTAKA
KU667929_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KM875418_HBc_P-B          ------------MDIDLYKEFGASVELLS--FLPTDFFPNIRDLLDTATA
KJ803791_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG571354_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF674440_HBc_P-B          ------------MDIDPYKEFGASVPLLS--FLPADFFPSIRDLLDTATA
AB915180_HBc_P-E          ------------MDIDPYKEFGATVELIS--FLPSDFFPSVRDLLDTASA
AJ627219_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTATA
AF323463_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
KY689481_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB900109_HBc_P-C          ------------MDIDPYKEFGASSQLLS--FLPADFFPSVRDLLDTASA
KX276783_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFXPSVRDLLDTATA
KU668093_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSFRDLLDTASA
KP406277_HBc_P-B          ------------MDIDTYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406276_HBc_P-B          ------------MDIDTYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406275_HBc_P-B          ------------MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406264_HBc_P-B          ------------MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406257_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP406255_HBc_P-B          ------------MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406263_HBc_P-B          ------------MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406265_HBc_P-B          ------------MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406268_HBc_P-B          ------------MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406270_HBc_P-B          ------------MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406272_HBc_P-B          ------------MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406278_HBc_P-B          ------------MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
KP406279_HBc_P-B          ------------MDIDPYKEFGASVELLA--FLPSDFFPSIRDLLDTATA
GU456665_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ801517_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPDDFFPSVRDLLDTASA
AB697502_HBc_P-C          ------------MDIDPYKEFGASLELLS--FLPQDFFPSVRDLLDTASA
AB670261_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU668116_HBc_P-B          ------------MDIGPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668108_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668058_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667519_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASA
KU576292_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU576291_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KP406280_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP406271_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP406269_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP406260_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ027312_HBc_P-B          ------------MDIDPYKEFGASVELXS--FLPTDFFPXVRDLLDTASA
FJ386676_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881957_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KU576979_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576394_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576390_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU576105_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576101_HBc_P-B          ------------MDIDPYKQFGASVELLS--FLPADFFPSIRDLLDTASA
KP406261_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KP148433_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148418_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148407_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801474_HBc_P-B          ------------MDIDPYKEFGASIELLS--FLPSDFFPSVRDLLDTASA
JQ341486_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDSASA
KU577046_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPNDFFPNMRDLLDTATA
KU577048_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPNDFFPNMRDLLDTATA
KR013804_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF873520_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
KF166858_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
FJ032360_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
KY881954_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KU667784_HBc_P-B          ------------MDIDPYKEFGAPVELLS--FLPSDFFPSIRDLLDTASA
KU667672_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU667671_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU577088_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU577047_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPNDFFPNMRDLLDTATA
KU576290_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU576289_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KP406294_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP406281_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406262_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP148415_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP148410_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774362_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
KR013805_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC774353_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ089794_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF674499_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
MF674466_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
MF674446_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU668069_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668046_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668037_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU577089_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ803817_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939565_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF925395_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU576457_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ040143_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU939573_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRELLDTASA
AF384372_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF384371_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF674406_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX276773_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAXA
KU964122_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964121_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964119_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964118_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964116_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964114_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964112_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964110_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964109_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667493_HBc_P-B          ------------MDIDPYKEFEASVELLS--FLPSDFFPNIRDLLDTASA
KU576389_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP148437_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148416_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148413_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148405_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP148366_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ803797_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803784_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173379_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRELLDTASA
KJ803803_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ478886_HBc_P-RF-DC      ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
JN664920_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG826138_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF568467_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964019_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964018_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964017_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964015_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964014_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964013_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964012_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964011_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU576455_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KR013847_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KR013807_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX026884_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ801500_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ924620_HBc_C-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ899776_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ787486_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ386628_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ032359_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU919168_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU872008_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU560441_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EF494377_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881953_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTVSA
KY881952_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTVSA
KU964117_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963961_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963956_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576975_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148440_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148439_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148438_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148435_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148432_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148430_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148429_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148427_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148425_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148424_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148423_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148421_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLGTASA
KP148420_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148419_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148414_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148411_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148409_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148406_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148361_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148344_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148326_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148325_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148322_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148317_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173404_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173403_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774394_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801524_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013840_HBc_P-C          ------------MDIDPYKGFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ715416_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ715415_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ562324_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVQDLLDTASA
DQ993692_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ089797_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ341491_HBc_P-B          ------------MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTASA
JQ341489_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ027311_HBc_P-B          ------------MDIDPYKEFGASXXLLS--FLPADFFPSVHDLLDTATA
KM875422_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC774188_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF674403_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881997_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881878_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881875_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY689471_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY629637_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KR013814_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ803790_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ598697_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF214655_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC774357_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC774278_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX661493_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ475354_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ475342_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ475338_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ475324_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ787481_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ386647_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU939658_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU939537_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU589342_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU589341_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU589340_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ993691_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB670302_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB367410_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB014390_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB014367_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ341500_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ040166_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ341504_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341488_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSXRDLLDTASA
JQ341502_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341541_HBc_P-C          ------------MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTASA
DQ089792_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ341463_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSXXDLLDTASA
JQ040152_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSXRDLLDTASA
DQ298162_HBc_P-A          ------------MDIDTYKEFGATVELLS--FLPPDFFPSVRDLLDTASA
AY236166_HBc_P-A          ------------MDVDTYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
DQ298164_HBc_P-A          ------------MDVDTYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
AY230111_HBc_P-A          ------------MDIDTYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
AY236167_HBc_P-A          ------------MDIDTYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
AY236169_HBc_P-A          ------------MDIDTYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
DQ298161_HBc_P-A          ------------MDIDTYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
DQ298165_HBc_P-A          ------------MDIDTYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
AY236165_HBc_P-A          ------------MDIDTYKEFGATVELLS--FLPPDFFPSVRDLLDTASA
AY236168_HBc_P-A          ------------MDIDTYKEFGATVELLS--FLPPDFFPSVRDLLDTASA
DQ298163_HBc_P-A          ------------MDIDTYKEFGATVELLS--FLPPDFFPSVRDLLDTASA
EU564822_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
EU564823_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
EU564824_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
KP659255_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTAAA
AY206383_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
AB674417_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPAVRDLLDTASA
AB674418_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPAVRDLLDTASA
FJ904415_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857037_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
KF849713_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161773_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ161802_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MH724247_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491148_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC875326_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
EU726958_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726911_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
EU726860_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726850_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX357631_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX357629_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF471656_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC774477_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040822_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF754604_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GU456670_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ904421_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ904420_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726917_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726865_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH481860_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
LT623845_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X65258_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF754610_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726943_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257206_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257207_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ904396_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350164_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ904412_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257164_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF350183_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350166_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350160_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350159_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196227_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857053_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857047_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF471653_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875313_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875295_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707501_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GU456680_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GU456662_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726921_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU414056_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASX
EU414141_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASX
EU594382_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB674412_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JN664934_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAXA
EU726952_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
JN040774_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
FJ904408_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTARA
X85268_HBc_P-D            ------------MDISPYKEFGASVELLS--FLPVDFFPSVRDLHDTATA
KP856976_HBc_P-D          ------------MDIDLYKEFGASVELLS--FLPTDFYPSVRDLLDTAXA
KC875328_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
JX036343_HBc_P-D          ------------MDIDAYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN792911_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN792912_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456658_HBc_P-D          ------------MDIDPYKEFGASIELLS--FLPTDFFPSVRDLLDTASA
KJ470897_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
JN040803_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JF754613_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
MH724235_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
KJ647355_HBc_P-D          ------------MDIDPYKEFGASVQLLS--FLPADFFPSVRDFLDTATA
JX036344_HBc_P-D          ------------MDIDPYKEFGASAQLLS--FLPADFFPSVRDLLDTASA
JN257154_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
KF798305_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KF679991_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
EU239220_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPGDFFPSVRDLLDTATA
MH725125_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724230_HBc_P-D          ------------MDLYPYKEIGASGEFLL--FFPSDFFPSVRDLLDTASA
MG491188_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFTSVRDLLDTASA
KP857006_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDFFPSVRDLLDTASA
KM577670_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSLRDLLDTASA
JN642136_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPEDFFPSVRDLLDTASA
EU726884_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTAAA
KP857015_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
JN642147_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
AB274976_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
KX827302_HBc_P-RF-DE      ------------MDIDPYKEFGATLELLS--FLPSDFYPSVRDLLDTASA
FJ904404_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPVDFFPSVRDLLDTASA
HM363611_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPTDFYPSVRDLLDTASA
HM363609_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLVTAPA
KM606655_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KM524358_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726944_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040776_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491180_HBc_P-E          ------------MDLDPYKEFGASVELLS--FLPGDFFPSVRDLLDTASA
MG491187_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFTSVRDLLDTASA
MG491184_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KM359442_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPQDFFPSVRDLLDTASA
KJ470898_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
KF471643_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPQDFFPSVRDLLDTASA
MF772357_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
KP856973_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPQDFFPSVRDLLDTASA
HM363610_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPPDFFPSVRDLLDTAAA
X85264_HBc_P-D            ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
X85261_HBc_P-D            ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
X59795_HBc_P-D            ------------MDIDPYKEFGASMELLS--FLPSDFYPSVRDLLDTASA
MH725172_HBc_P-D          ------------MDLDPYKEFGGIVELLF--FLPSDFFPSVRDLLDTASA
MH725171_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
MH725135_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
MH724234_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857028_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
KP856997_HBc_P-D          ------------MDIDPYKEFGATVELVS--FLPTDFYPSVRDLLDTASA
KP856990_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JX036342_HBc_P-D          ------------MDIDPYKEFGASAQLLS--FLPADFFPSVRDLLDTASA
JF754614_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
FJ904438_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726932_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491144_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN688717_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FFPSDFFPSVRDLLDTASA
FJ904414_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPTDFYPSVRDLLDTASA
X85263_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAKA
KT749845_HBc_P-D          ------------MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLATAQA
KP857115_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDYFPSVRDLLDTARA
KM577669_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDYFPSVRDLLDTASA
KC875342_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX196229_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC875301_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707682_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707683_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707684_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707685_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707686_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707687_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707688_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707689_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707690_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707691_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707692_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707693_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707694_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707695_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707696_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707697_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707698_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707699_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707700_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707701_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707702_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707703_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707704_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707705_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ707706_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JN792905_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
JN688683_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
JN642158_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
FJ040872_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726973_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTGSA
EU726951_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726872_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
MG491147_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
MG491127_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFTSVRDLLDTASA
MG491134_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFTSVRDLLDTASA
MG491138_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFTSVRDLLDTASA
MG491168_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFTSVRDLLDTASA
MG491169_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFTSVRDLLDTASA
MG491182_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFTSVRDLLDTASA
MG491137_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFTSVRDLLDTASA
MH481862_HBc_P-RF-DE      ------------MDSDPYKEFGATMELLS--FLPSDFFPSVRDLLDTAAA
FJ349212_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF925366_HBc_P-D          ------------MDIDPYKEFGATVEILS--FLPSDFFPSVRDLLDTAAA
KM524340_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF679990_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN688708_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
JN664941_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLATASA
JN642157_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN040778_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
GU456660_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFYPSVRDLLDTASA
AB270546_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491167_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFTSVRDLLDTASA
X65259_HBc_P-RF-DA        ------------MDIDPYKQFGATVELLP--YLPSDFFLYVRDLLDTASA
MH724239_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX357626_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPQDFFPAVRDLLDTASA
KU668440_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM606751_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM577665_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
FJ904394_HBc_P-RF-DE      ------------MDIDPYKEFGATVQLLS--FLPVDFFPSVRDLLDTASA
DQ991753_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
AJ627221_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FN545823_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVXDLLDTASA
AF350215_HBc_P-E          ------------MDIDPYKEFGATVELLS--FWPSDFFPSVRDLLDTASA
AB915178_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
X97848_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724959_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY629634_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFYPSVRDLLDTASA
KT749828_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
KP857116_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
KP857035_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
KP856981_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KM606645_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFYPSVRDLLDTATA
KJ470893_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF471654_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
KC875308_HBc_P-D          ------------MDIDRYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
JQ687531_HBc_P-D          ------------MDIDPYAEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN792906_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
JN688679_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPVDFFPSVRDLLDTASA
JN664947_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
JN642154_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN642132_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPQDFFPSVRDLLDTARA
JN257211_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439695_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
EU726965_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY371917_HBc_P-D          ------------MDLDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
AB188241_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491143_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642139_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642137_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HQ700493_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
FJ904406_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
FJ882618_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ882612_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ562223_HBc_P-RF-CD      ------------MDIDPYKEFGATVELLS--FLPSNFFPSVRDLLDTASA
MH580645_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857010_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM363578_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725139_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH724226_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196233_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196221_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT749827_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857033_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
KP857004_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP856986_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPVDFFPSVRDLLDTASA
KM606698_HBc_P-D          ------------MDLDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KM606690_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KM606682_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KM606675_HBc_P-D          ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KM606654_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
KF779382_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KF779224_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875334_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875289_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
JN792907_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642151_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
JN642128_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN040809_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
MK541689_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF192837_HBc_P-RF-DE      ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF192839_HBc_P-RF-DE      ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF192840_HBc_P-RF-DE      ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF192841_HBc_P-RF-DE      ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MF618347_HBc_P-RF-DE      ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB716760_HBc_P-D          ------------LVMGHHKEFGATVELLS--FLPSDFFPSVRXLLDTASA
HE805987_HBc_P-D          ------------LVMGHHKEFGATVELLS--FLPSDFFPSVRXLLDTASA
KX357630_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KJ470891_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
JF440013_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
JF440012_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
JF440005_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440004_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439999_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ904444_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ315780_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AY341335_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857011_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSARDLLDTASA
HM363604_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
GQ491112_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161833_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350184_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
X85299_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X85260_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724252_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH724228_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDSASA
MF925379_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF488704_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KX260231_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPAVRDLLDTASA
KP857024_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KM606752_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
JN040784_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MG491175_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ692532_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
FJ692533_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
GQ205384_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
JN664932_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KC774436_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KC774460_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KJ470889_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MK516280_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MK516279_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MH481861_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MH481858_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KT366505_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KJ470890_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KJ470888_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KJ470887_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KJ470886_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KJ470884_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KC774450_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
JN664940_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700584_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700583_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700582_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700581_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700541_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700533_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700525_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700524_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700503_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700501_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700497_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
GU563560_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
GQ205387_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
GQ205378_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
GQ205377_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDFLDTAAA
DQ315779_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB033559_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF798275_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KU668433_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KM606744_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KM606644_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KM524361_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KJ470896_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KM524345_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KM606755_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KJ470892_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB048702_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB048703_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700500_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MF618346_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF192838_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF192836_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF192833_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
J02202_HBc_P-RF-DE        ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700540_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700539_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700535_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700537_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700538_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KX276857_HBc_P-D          ------------MDIDPYKEFGAXVELLS--FLPSDFFPSVRDLLDTAXA
GQ205379_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MN507835_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF925384_HBc_P-RF-DB      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX357641_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX357625_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524336_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF170740_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040798_HBc_P-RF-DE      ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HQ700536_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
FN594770_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ904447_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
FJ904430_HBc_P-RF-DE      ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
FJ904398_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPNVRDLLDTASA
AY233295_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB188243_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRALLDTASA
KP857001_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KF849720_HBc_P-E          ------------MVIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF170741_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363593_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726883_HBc_P-E          ------------MDIDAYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350208_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPNDFFPSVRDLLDTASA
AF350168_HBc_P-E          ------------MDIDSYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF350167_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350158_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350146_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350131_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350123_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350114_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350113_HBc_P-E          ------------MDIDSYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350107_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB274981_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X85298_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X85279_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAKA
X85259_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X02496_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDNASA
MK618436_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618435_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618434_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598664_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725204_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
MH725197_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
MH725196_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
MH725173_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725169_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725161_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725142_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725136_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725124_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725103_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDSFPSVRDLLDTASA
MH725100_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725099_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725098_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725097_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
MH725092_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPFDFFPSVRDLLDTASA
MH725091_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPFDFFPSVRDLLDTASA
MH725047_HBc_P-D          ------------MDIDPYKEFGATGELLS--FLPSDFFPSVRDLLDTASA
MH725022_HBc_P-D          ------------MDIDSYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725014_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725005_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFSSVRDLLDTASA
MH725001_HBc_P-D          ------------MDIDPYKEFGATVELLS--FSPSDFFPSVRDLLDTASA
MH724999_HBc_P-D          ------------MDIDPYKEFGATVELLS--FVPSDFFPSVRDLLDTASA
MH724984_HBc_P-D          ------------MDIDPYREFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724970_HBc_P-D          ------------MDIDSYKEFGATVELIS--FLPSDFFPSVRDLLDTASA
MH724233_HBc_P-D          ------------MDIXPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX827292_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX357638_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
KX196232_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196228_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
KX196226_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196225_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196224_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196220_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196217_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU668447_HBc_P-D          ------------MDIDPYKEFGVTVELLS--FLPSDFFPSVRDLLDTASA
KU668442_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU668439_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPPDFFPSVRDLLDTASA
KP857109_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857026_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP856978_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP090178_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524348_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524347_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798281_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779289_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779225_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFHSVRDLLDTASA
KF779218_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF018195_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875337_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875324_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875323_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875322_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875320_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875318_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875315_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875314_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPPVRDLLDTASA
KC875307_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875304_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875300_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875296_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
KC774459_HBc_P-D          ------------MDIDTYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC774445_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707530_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707529_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707528_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707527_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707526_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707525_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707524_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707523_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707522_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707521_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707520_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707519_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707518_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707517_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707516_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707515_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707514_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707513_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707512_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707486_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707483_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN697591_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664924_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN642167_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN642134_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN558564_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN558563_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN558562_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN558561_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257205_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN257186_HBc_P-D          ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491146_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH481859_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ700534_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MH580641_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580640_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF849718_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FN545821_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY269055_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AF350206_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350173_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350154_HBc_P-E          ------------MDIDPYKEFGATVESLS--FLPSDFFPSVRDLLDTASA
AF350137_HBc_P-E          ------------MDIDPYKEFGATEELLS--FLPSDFFPSVRDLLDTASA
AF350115_HBc_P-E          ------------MDIDPYKEFGATEELLS--FLPSDFFPSVRDLLDTASA
AF350112_HBc_P-E          ------------MDIDPYKEFGATVEILS--FLPSDFFPSVRDLLDTASA
AB205190_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB201290_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507837_HBc_P-D          ------------MDIDPYKEFGATVELLS--FFPSDFFPSVRDLLDTASA
MK693109_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598645_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724996_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724977_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724967_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDLFPSVRDLLDTASA
MH724966_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724965_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724961_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDLFPSVRDLLDTASA
MH724238_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH724232_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF925383_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX827300_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196234_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196222_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT749855_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KT749821_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366491_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KR905423_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857007_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP090179_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM606697_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KM606686_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KJ647353_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779220_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF679995_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF471660_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF471642_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875331_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC875317_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX310735_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664939_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491192_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491190_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491181_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491165_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491161_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491157_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491136_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440015_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440014_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440011_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440010_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440009_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440008_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440007_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440006_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440003_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440002_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440001_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440000_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439998_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439996_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439995_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ904441_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPXDFFPSVRDLLDTASA
LT623851_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
MN507852_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725148_HBc_P-D          ------------VDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725076_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725034_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725028_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU668437_HBc_P-D          ------------RDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT963508_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP995100_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPAVRDLLDTASA
KP857036_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857023_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857020_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779229_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF061170_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464847_HBc_P-D          ----------------PYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X80925_HBc_P-RF-DE        ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507850_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618445_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618442_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618439_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598656_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598654_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724222_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF925392_HBc_P-RF-DB      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF925388_HBc_P-RF-DC      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LK995391_HBc_P-RF-ED      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX357635_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX357633_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX357623_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736923_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736922_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736917_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736914_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU711666_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366504_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366503_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366492_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KR905422_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP995112_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP168418_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP168417_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP168416_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM606750_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM577664_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM577663_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524359_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524357_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524337_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875339_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875338_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898699_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898698_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898696_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898695_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898693_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898690_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898688_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898687_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898686_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ687532_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664925_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664915_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642160_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN257189_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ377627_HBc_P-RF-CD      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ183486_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161754_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161753_HBc_P-RF-AE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU594436_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU594435_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU594406_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EF103285_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ315777_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ111987_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY373430_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY236161_HBc_P-RF-DA      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY233293_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161146_HBc_P-RF-AD      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161145_HBc_P-RF-AD      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494716_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AJ344117_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB674433_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB583679_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725010_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798298_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798270_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798259_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494810_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494809_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494808_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350220_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350219_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350218_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350217_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350216_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350214_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350213_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350212_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350210_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350205_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350203_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350201_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350200_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350199_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350198_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350197_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350196_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350195_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350194_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350193_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350192_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350190_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350189_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350188_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350186_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350185_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350182_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350181_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350180_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350179_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350178_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350177_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350174_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350172_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350171_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350170_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350169_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350165_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350163_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350162_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350161_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350157_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350156_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350155_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350153_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350152_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350151_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350150_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350149_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350148_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350147_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350145_HBc_P-E          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
AF350143_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350142_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350141_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350140_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350139_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350138_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350136_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350135_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350134_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350133_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350132_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350130_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350128_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350127_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350126_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350125_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350124_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350122_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350121_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350120_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350119_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350118_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350116_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350109_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350108_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350106_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350104_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350103_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350102_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350100_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350099_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
Z35716_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
Y07587_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X85308_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X85297_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X85294_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X72702_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
V01460_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507853_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507851_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507839_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507838_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK693108_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK693107_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618443_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618437_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618433_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MK618432_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618431_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618430_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618429_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618428_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MK618427_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MK618426_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618422_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618421_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618420_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618419_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618418_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598679_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
MK598675_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598672_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598671_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598670_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598669_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598668_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598667_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598666_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598665_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598663_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598662_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598659_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598658_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MK598657_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598655_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598651_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598650_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598649_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598648_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598647_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MK598646_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MK598644_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598643_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598642_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598641_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598640_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598639_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598638_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598637_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598636_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK516278_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK507914_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK507913_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK507912_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK507911_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK507910_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK355500_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725211_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725208_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725207_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725206_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725205_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725198_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725195_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725193_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725191_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725190_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725188_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725187_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725185_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725184_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725182_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725181_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725180_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725179_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725178_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725176_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725175_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725174_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASP
MH725170_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725168_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725166_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725165_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725164_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725163_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725162_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725160_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725159_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725158_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725157_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725156_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725155_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725154_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725149_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725146_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725145_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725143_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725140_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725138_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725137_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725133_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725132_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725131_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725129_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725128_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725127_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725122_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725121_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725120_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725117_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725116_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725107_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725106_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725105_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725104_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725093_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725089_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725087_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725085_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725084_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725083_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725082_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725078_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725077_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725075_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725074_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725073_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725072_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725070_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725063_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725062_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725061_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725060_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725059_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725058_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725057_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725056_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725055_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725053_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725052_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725051_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725049_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725048_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725046_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725044_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725041_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725040_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725039_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725037_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725036_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725035_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725032_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725030_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725029_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725027_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725026_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725025_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725023_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725018_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725017_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725016_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725015_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725013_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725012_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725011_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725009_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725007_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725006_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725004_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725003_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725002_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724998_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724997_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724991_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724990_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724987_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724986_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724985_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724983_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724982_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724981_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724975_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724974_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724973_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724972_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724963_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724958_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724956_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724955_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724954_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724250_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724249_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724231_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724223_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724221_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724220_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724219_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724218_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724217_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724215_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724214_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464844_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464843_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG686619_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASP
MF925393_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF925391_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF925364_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF925363_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF925358_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF618349_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF618348_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF618343_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF618342_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF618341_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF618340_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF618339_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LT992454_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LT992439_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LT992438_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LK995395_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LK995394_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LK995390_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LC365689_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KY382414_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KY382412_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KY353921_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KY353920_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KY353914_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KY353911_HBc_P-D          ------------MDIDPYKEFGATVKLLS--FLPSDFFPSVRDLLDTASA
KX827301_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX827290_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSGFFPSVRDLLDTASA
KX196236_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX196231_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196219_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196216_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196215_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX196214_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736925_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736924_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU668449_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU668446_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU668441_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU668438_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU668436_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU668435_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366511_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366510_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366509_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366508_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366507_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366506_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366502_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366500_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366498_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366497_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366496_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366495_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366494_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366493_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366465_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT347090_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT151620_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KR905424_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857107_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857106_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857105_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857104_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857100_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857099_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857097_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857094_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857051_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857027_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857008_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857003_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671699_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671697_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671696_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671695_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671694_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671693_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671691_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671690_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671689_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671688_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671687_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671686_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671685_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP671684_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP322601_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP322600_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP322599_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP090180_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP090177_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM606753_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524355_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524354_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524353_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524352_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524351_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524350_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524349_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524346_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524341_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM524339_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM519455_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF922432_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF896606_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798307_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798306_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798299_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798283_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798282_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798273_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798260_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779377_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779376_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779341_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779340_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779318_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779303_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779302_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779301_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779296_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779292_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779288_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779285_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779230_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF779228_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779222_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779217_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779216_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779214_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779212_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779209_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF679998_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF679997_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF679996_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF679994_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF679993_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF679992_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF679989_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF584166_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF584164_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF584162_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF471652_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF471651_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF471650_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF471647_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF471645_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF061168_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF018194_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF018191_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF018190_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF018189_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF018187_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF018184_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF018180_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875336_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875332_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875325_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC875321_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875319_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875316_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875311_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875310_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875309_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875306_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC875297_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC875294_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875293_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875285_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875282_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875280_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875279_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC875278_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875277_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875276_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875275_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC774462_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC774444_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC774440_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC774437_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898697_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898694_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898692_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898691_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX898689_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX310734_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX310733_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX096958_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX096957_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX096956_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX096954_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707504_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707495_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707492_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707477_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287621_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287620_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287618_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287617_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287616_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287615_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287614_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287613_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287612_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287611_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287610_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287609_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287608_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287607_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287606_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287605_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287604_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287603_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287602_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ287601_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN792910_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN792909_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664938_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664937_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664936_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664931_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664930_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664927_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664917_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664914_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664913_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664912_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664911_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642166_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642142_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642138_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642131_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257203_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257201_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257200_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257199_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257196_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257194_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257193_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257188_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257187_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257185_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257182_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257181_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX357632_HBc_P-RF-DE      ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTAAA
MH464845_HBc_P-D          --------------IDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464831_HBc_P-D          --------------IDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KT366499_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP856989_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN642129_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH464835_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464836_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464852_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464846_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464854_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464834_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257178_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464832_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU667788_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667774_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667752_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667763_HBc_P-B          ------------MDIDPYKGFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667836_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667827_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPNIRDLLDTASA
KU667729_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667800_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
X85278_HBc_P-D            ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
EU726858_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
X80924_HBc_P-D            ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTATA
X80926_HBc_P-D            ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTATA
MK052973_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK052975_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881845_HBc_P-B          ------------MDINTYKEFRASVELLS--FLPSDFFPSIRNLLDTASA
EU547563_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
MK052947_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADSFPSVRDLLDTASA
MK052972_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPTVRDLLDTASA
KU576750_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576886_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576887_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576888_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576890_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576891_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576892_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576894_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576895_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576897_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576898_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576896_HBc_P-B          ------------MDIDTYKEFGASVVLLS--FLPSDFFPSIRDLLDTASA
HM011466_HBc_P-B          ------------MDIDTYKEFGASAELLS--FLPSDFYPSIRDLLDTATA
KJ803816_HBc_P-B          ------------MDIDTYKEFGASAELLS--FLPSDFYPSIRDLLDTATA
FJ562260_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTANA
KJ803771_HBc_P-RF-DB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTALA
GQ922005_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTAAA
AB555500_HBc_P-D          ------------KDLDPYKEFGASVTLLS--FLPAYFFPSVPDLLDTASA
HM011496_HBc_P-B          ------------MDIDTYKEFGASAELLS--FLPSDFFPNIRDLLDTANA
MG491172_HBc_P-D          ------------MDIDPYKEFGATVELIS--FLPADFFPSVRDLLDTASA
AB116550_HBc_P-F          ------------MDIDPFKEFGASEELLS--FLPLDFFPNVRDLLDTASA
EU939655_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
EU939656_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
AY800391_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTANA
AY800392_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTANA
HM011467_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KC774323_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC494399_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLIDTASA
GU456674_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPADFFPSVRDLLDTAAA
GQ477453_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
KX276791_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KP659250_HBc_P-B          ------------MDIDPYKEFGATAELLS--FLPLDFFPSARDLLDTAAA
KJ803824_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFLPSIRDLLDTASA
AB073841_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTATA
KJ647349_HBc_P-RF-DE      ------------MDLDPYKEFGASVELLS--FLPNDFFPSARDLLDTASA
FJ349221_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSISDLLATATA
MF772359_HBc_P-E          ------------MDIDPYKELGATVELLS--FLHNDFFPSLRDLLDTASA
KF018182_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
KF018181_HBc_P-D          ------------MDLDPYKEFGATVELLS--FLPHDFFPSVRDLLDTASA
JN040762_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
JF754602_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDFFPSVRDLLDTASA
GQ922000_HBc_P-D          ------------MDIDPYKEFGASAPLLS--FLPHDFFPSIRDLLDTATA
AF419538_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG826132_HBc_P-C          ------------MDIDPYIEFGASVEILS--FLPSAIFPSILDLLDTASA
KC774240_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803773_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTALA
FJ562312_HBc_P-B          ------------MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
AY206391_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB900110_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
AB073824_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPADFFPSIRDLLDTASA
EU919173_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
FJ032357_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
FJ032358_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AF480364_HBc_P-B          ------------MDIDPYIEFRASGELLS--FLPSDFFPSIRDLLDTASA
AF480340_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AF480352_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AF480354_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AF480358_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AF480346_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
AF480359_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
AF480360_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
AF480363_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
KJ638664_HBc_P-F          ------------MDIDPYKEFGASEELLS--FLPLDFFPSARDLLDTASA
FJ589066_HBc_P-F          ------------MDIDPYKEFGASVELLT--FLPSDFFPSIRDLLDTASA
EU366132_HBc_P-F          ------------MDIDPYKEFGASRELLS--FLPNDFYPSARDLLDTATA
MF772356_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPPDFFPSVKDLLDTASA
AB274977_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
KP857032_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
GU456682_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726979_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
MF488703_HBc_P-C          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLGTAAP
KU576449_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
EU939539_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPNDFFPSARDLLDTATA
KU667951_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRNLLDTATA
KU667859_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667528_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPNDFFPSIRDLLDTASA
KJ803768_HBc_P-B          ------------MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341492_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPADFFPSIRDLLDTASA
EU564825_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB073832_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPXVRDLLDTASA
DQ464165_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
DQ464166_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
KU576131_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576125_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576126_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576130_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG491149_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
MF488702_HBc_P-RF-DE      ------------MDIDTYKEFGATVEILS--FLSPDFFPSLRDLLDTASA
FJ904416_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
FJ904417_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JQ272888_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP856982_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
KT749823_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLRDTASA
JF754632_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTATA
AF419527_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KT347089_HBc_P-C          ------------MDIDTYKEFGASLELLS--FLPSDFFPSIRDLLDTATA
FJ386640_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
GQ924645_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
FJ386688_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
AY596103_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
FJ562237_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
AY269105_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU667539_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASA
KU576628_HBc_P-B          ------------MDMDTYKEFGASLELPS--FLPGDFYPSIRDLLDTASA
KU576145_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASA
KU576736_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASA
KU576749_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASA
KU667549_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASA
KU668293_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASA
FJ032342_HBc_P-B          ------------MDIDPYKEFGASAELIS--FLPSDFFPNIRDLLDTASA
FJ032343_HBc_P-RF-CB      ------------MDIDPYKEFGASAELIS--FLPSDFFPNIRDLLDTASA
MF925382_HBc_P-RF-CB      ------------MDIDPYKEFGATSELLS--FLPSDFFPSIRDLLDTANA
AB086397_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPLDFFPSARDLLDTASA
MH725068_HBc_P-D          ------------MDIDPYKEFGATAELLL--FLPYDFFPSVRDFIDTASA
MG491156_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
JN792908_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPIDFFPSIRDLLDTASA
JN688712_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
JN040771_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ904439_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
AF419537_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
AF419523_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB048701_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
JQ801508_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPQDFFPNVRDLLDTATA
FJ386616_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
MG571358_HBc_P-B          ------------MDIDPYKEFGASAELIS--FLPHDFFPSIRDLLDTASA
KX276789_HBc_P-B          ------------MDIDPYKEFGASSELLS--FLPSDFFPTIRDLLDTASA
KU668081_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU667517_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPNDFFPSIRDLLDTASA
KU576148_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPTDFFSSIRVLLDTASA
JQ341503_HBc_P-B          ------------MDIDPYKEFGGSVELLS--FLPSDFFPTIRDLLDTASA
DQ904357_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576848_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576856_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576854_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576765_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576754_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576637_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDAASA
KU576630_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576626_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDPLDTASA
KU576623_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576240_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576619_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576620_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576629_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576633_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576640_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576645_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576647_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLNTASA
KU576656_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576681_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576692_HBc_P-B          ------------MDIDPYKEFGASVELLS--LLPTDFFPSIRDLLDTASA
KU576698_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576703_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576704_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576714_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576738_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576748_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576751_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576766_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576843_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576845_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576874_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576641_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576693_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU668252_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASA
KU668241_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASA
KU576921_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPADFSPSIRDLLDTASA
KU668222_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASA
KU668270_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASA
KU668333_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASA
KU668342_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASA
KU668353_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASA
KU668232_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASA
MF925360_HBc_P-RF-DB      ------------MDIDPYKEFGATVELLS--FLPADFFPSVRALLDTASA
KX357628_HBc_P-RF-DE      ------------MDIDPYKEFGASVQLLS--FLPADFFPSVRDLLDTASA
KJ647351_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPTDFYPSVRDLLDTASA
HQ700554_HBc_P-RF-CB      ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KT749841_HBc_P-E          ------------MDIDLYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
KP857055_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FN594766_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVKDLLDTASA
FN594748_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
KP857029_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTAFA
KF018177_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
JN257153_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN257195_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JF754593_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTATA
GU456646_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPVDFFPSVRDLLDTASA
EU726901_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
EU726848_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
DQ464181_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
AB555496_HBc_P-D          ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KR013872_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KC836842_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089804_HBc_P-C          ------------MDIDPYKEFGCSAQLLS--FLPSDFFPSIRDLLDTATA
AY220702_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTAAA
KX276800_HBc_P-B          ------------MDIDTYKEFGASVELXS--FLPXDFFPSIRDLLDTATA
KU668277_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU668261_HBc_P-B          ------------MDIDPYKEFRASMELLS--FLPADFFPSIRDLLDTASA
KU668258_HBc_P-B          ------------MDTDPYKEFGAPVELLP--FLSSDFFPSIRDILDTASA
KU667420_HBc_P-B          ------------MDIDPYEEFGASVELLS--FLPTDFFPSIRDPLDTASA
KU576522_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU576287_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDVFPSIRDLLDTAAA
KU576280_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDVFPSIRDLLDTAAA
KU576127_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTRDLLDTASA
KP148459_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ803775_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
KC774419_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
EF473973_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDSFPSIRDLLDTASA
MG491162_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPHDFFPSIRDLLDTASA
FN594758_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVKDLLDTASA
FN594760_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FN594759_HBc_P-E          ------------MDIDPYKEFGASVZLLS--FLPSDFFPSVRDLLDTASA
MK052970_HBc_P-RF-BD      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MH368022_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
KY363272_HBc_P-RF-CB      ------------MDIDPYKEFGASAELLS--FLPTDFFPSIRDLLDTASA
KY363273_HBc_P-RF-CB      ------------MDIDPYKEFGASAELLS--FLPTDFFPSIRDLLDTASA
FJ349207_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
MG098569_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPHDFYPSIRDLLDTAAA
MH580648_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPPDFFPSVKDLLDTISA
HM363606_HBc_P-E          ------------MVIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161786_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTGPA
MH725199_HBc_P-D          ------------MELDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTATA
KP857031_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTVSA
KP857018_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
JN688678_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN642140_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN040765_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JF754631_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFYPSVRDLLDTASA
JF754622_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JF754592_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPNDFFPSARDLLDTASA
AB555501_HBc_P-D          ------------MDIDPYIRIGATVELLS--FLPSDFFPSVRDLLDTASA
KJ410511_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
JX507212_HBc_P-C          ------------MDIDPYKEFGASAQLLS--FLPSDFFPSIRDLLDTAAA
D23682_HBc_P-C            ------------MDIDPYKEFGASVELVS--FLPSDFFPSIRDLLDTAAA
D23683_HBc_P-C            ------------MDIDPYKEFGASVELVS--FLPSDFFPSIRDLLDTAAA
KX276825_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276802_HBc_P-B          ------------MDIDLYKEFGASVELLS--FLPTDFFPSVRDLLDTAXA
KX276776_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668357_HBc_P-B          ------------MDIDQYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU668302_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPTDFFPSIRDLLDTASA
KU668278_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDPLDTATA
KU668259_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KU668238_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KU668229_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KU668019_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU668060_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU667680_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDLFPSVRDLLDTASA
KU576383_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576381_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576306_HBc_P-B          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341479_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU919175_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
EU919176_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
DQ993683_HBc_P-B          ------------MDIDPHQEFGSSVELLS--FLPSDFFPSIRDLLDTASA
AY269108_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRELLDTASA
MG491170_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFTSVRDLLDTASA
JQ027330_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSXRDLLDTASA
JQ027331_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSXRDLLDTASA
MG571333_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FN594751_HBc_P-E          ------------MDIDPYKEFGAXVELLS--FLPSDFFPSVRDLLDTASA
FN594763_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF925396_HBc_P-RF-DC      ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
AB674436_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTATA
JN792919_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN688720_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTAXA
HM363601_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
HM363598_HBc_P-E          ------------MDIDPYKEFGGTVELLS--FLPSDFFPSVRDLLDTASA
HM363565_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPLDFFPSVKDLLDTASA
MH725126_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KP857046_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPNDFFPSVRDLLDTASA
KP857005_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KP856993_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPEDFFPSVRDLLDTASA
KP856975_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPQDFYPSVRDLLDTASA
KJ470894_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
JN642164_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
JN642161_HBc_P-D          ------------MDIDLYKEFGASVELLS--FLPADFFPSVRDLLDTASA
JN257183_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSIRDLLDTAAA
JN040795_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
JN040761_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
GU456666_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
GU456657_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
GQ184322_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ904429_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDFFPSVRDLLDTASA
EU726933_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPHDFFPSVRDLLDTASA
EU726864_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
AB674419_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
AB674415_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPENFYPSIRDLLDTASA
AB119255_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013876_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KR013874_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KC774321_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774361_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562329_HBc_P-C          ------------MDIDPYKEFGAPVDILF--FFPSDFFPSIQDLLDTAWP
EU939548_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
EU717214_HBc_P-C          ------------MDIDPYKEFGASRELLS--FLPSDFFPSIRDLLDTASA
AB115418_HBc_P-C          ------------MDIDPNKEFGASTELLS--FLPSDFFPSIRDLLDTASA
X98077_HBc_P-B            ------------MDIDPYKEFGASVELLS--FLPSDFFPAVRDLLDTASA
MF674478_HBc_P-B          ------------MDIDPYKEFGASAELVS--FLPNDFFPSVRDLLDTASA
KX276809_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPNDFFPSMRDLLDTASA
KU668193_HBc_P-B          ------------MDIDPYKEFGTSVELLS--FLPTDFFPSIRDLLDTASA
KU576495_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU576385_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406299_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPPDFFPSIRDLLDTASA
KM875427_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KM526755_HBc_P-B          ------------MDIDLYKEFGASEELLS--FLPSDFFPSIRDLLDTATA
KM526749_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410500_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPQDFFPSVRDLLDTASA
JQ801506_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341469_HBc_P-B          ------------MDIDPYKEFGASIELLS--FLPSDFFPSIRDLLDTASA
HM011487_HBc_P-B          ------------MDIDPYKEFGATTELVS--FLPSDFFPSIRDLLDTASA
GQ377644_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562224_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU522072_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR014099_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU576611_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KU576613_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KU576616_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KU576622_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KU668202_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KU668249_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KU668290_HBc_P-B          ------------MDIDPYKEFGASVELLS--LLPSDFFPTIRDLLDTATA
HQ700580_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HQ700520_HBc_P-RF-CB      ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ023665_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939623_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
EU939620_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPTDFYPSVRDLLDTAAA
AB274979_HBc_P-E          ------------MDIDPYKEFGATVQLLS--FLPGEFFPSVRDLLDTASA
AB219529_HBc_P-E          ------------MDIDPYKEFGATLQLLS--FLPGDFFPSVRDLLDTASA
X85270_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MH725153_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPEDFFPSVRDLLDTASA
KX357622_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTAAA
KP857030_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
KM577671_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
JN642159_HBc_P-D          ------------MDLDPYKEFGASVELLS--FLPGDFFPSIRDLLDTASA
JN040766_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDFFPSVRDLLDTASA
JF754611_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456635_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
FJ904426_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU921418_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726969_HBc_P-D          ------------MDIDPYKEFGATTELLS--FLPSDFFPSVRDLLDTASA
EU726873_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF043594_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPHDFFPSVRDLLDTASA
MK598678_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPHDFFPSVRDLLDTASA
AB119253_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPQDFFPAVRDLLDTASA
AB119252_HBc_P-D          ------------MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTASA
KY363267_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ924643_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPADFFPSIRDLLDTASA
GQ377552_HBc_P-C          ------------MDIDPYKEFGGSEELLS--FLPSDLFPFIRDILDRGDA
FJ562337_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ023651_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU872013_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASA
AB176642_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
MG826152_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTTAA
MG571326_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
MG571329_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KX276812_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
KX276806_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU668170_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDPLDTASA
KU667777_HBc_P-B          ------------MDIDPYKEFGASVELLS--FSPSDFFPSIRDLLDTASA
KU577107_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576753_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPGDFYPSIRDLLDTASA
KU576380_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576302_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTRDLLDTASA
KU576146_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011477_HBc_P-B          ------------MDIDTYKEFGASVXLLS--FLPSDFFPSXXDLLDTASA
FJ562259_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939674_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ899790_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ899791_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB241116_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
AB241117_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
AB212625_HBc_P-B          ------------MDIDTYKEFGASAELLS--FLPSDFFPTIRDLLDTATA
AB205122_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
MH724243_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU695745_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214680_HBc_P-RF-GC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSVRDLLDTASA
GQ377592_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
FJ904403_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ386586_HBc_P-RF-CB      ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
DQ464164_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
AB210819_HBc_P-RF-DE      ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
MF772355_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FN594762_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857110_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPPDFFPSVRDLLDTASA
KP857017_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFYPSVRDLLDTASA
JN688695_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN040804_HBc_P-D          ------------MDIDPYKEFGATVELIS--FLPSDFFPSVRDLLDTASA
JN040796_HBc_P-D          ------------MDIDPYKELGATVELLS--FLPSDFFPSVRDLLDTASA
JN040781_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456664_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ922004_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTATA
GQ167302_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ167301_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726938_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB674427_HBc_P-D          ------------MDXDPYKEFGAXVELLS--FLPLDFYPSVRDLLDTASA
MG571332_HBc_P-C          ------------MDIDPYKEFGASSELLS--FLPSDFFPSIRDLLDTASA
MF925403_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
KX276838_HBc_P-C          ------------MDIDPYKEFGASAXLLS--FLPSDFFPSVRDLLDTASA
KU679957_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU668271_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU577024_HBc_P-C          ------------MDIDPYKKFGASVELLS--FLPADFFPSVRELLDTASA
KU576453_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ410521_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX504535_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ801498_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
GQ924642_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPNDFFPSMRDLLDTASA
GQ227695_HBc_P-C          ------------TDIDHYKEFGASVELLS--FLPSDFFPSTRDLLDTASA
FJ787487_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRGLLDTASA
FJ562273_HBc_P-C          ------------MDIDTYKEFGASAELLS--FLPSDFFPSIRDLLDTATA
DQ890381_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
DQ361526_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY220700_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY220699_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF182804_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
AB670295_HBc_P-C          ------------MDLDPYKEFGASAELVS--FLPSDFFPSIRDLLDTASA
AB014394_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF674492_HBc_P-B          ------------MDIDPYKEFGASIELVS--FLPGDFFPSIRDLLDTASA
KY689453_HBc_P-B          ------------MDIDPYKEFGASTELIS--FLPSDFFPSIRDLLDTAFA
KX276793_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276774_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPXDFFPSIRDLLDTASA
KU964258_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU668287_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668265_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668173_HBc_P-B          ------------MDIDPYKESGASVELLS--FLSPDFFPSIRDLLDTASA
KU667944_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KU576397_HBc_P-B          ------------MDIGSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576304_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406175_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803805_HBc_P-B          ------------MDIDPYKEFGASMDLIS--FLPSDFFPNIRDLLDTASA
JX504538_HBc_P-B          ------------MDTDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011484_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPADFFPSVRDLLDTAXA
HM011478_HBc_P-B          ------------MDIDPYKEFGASXZLLS--FLPSDFFPSIRDLLDTASA
FJ562303_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
AY517620_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY167100_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AF324066_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
DQ336680_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ336682_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ336684_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU522073_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
EU522075_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
KU679950_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU576384_HBc_P-RF-CB      ------------MDIDVYKEFGASVELLS--FLPSDFFPSIRDPLDTASA
EF494378_HBc_P-RF-CA      ------------MDIDPYKEFGASVQLLS--FLPSDFFPSIRDLLDTASA
DQ089798_HBc_P-RF-CB      ------------MDIDPYKELGASGELLS--FWPSDFFPSIRDLLDTASA
HM363600_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FN594761_HBc_P-E          ------------MDIDPYKEFGAXXELLS--FLPSDFFPSVRDLLDTASA
KY629633_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857039_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP856977_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDFFPSIRDLLDTASA
KJ647350_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF471641_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642162_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPPVRALLDTAQA
JN257202_HBc_P-D          ------------MDIDLYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
JN040775_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF754633_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF754590_HBc_P-D          ------------MDIDPYKEFGASVDLLS--FLPSDFFPSVRDLLDTASA
JF754588_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HQ700463_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456655_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456650_HBc_P-D          ------------MDLDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ904422_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSLRDLLDTASA
AJ627222_HBc_P-D          ------------MDIDPYKEFGASVQLLS--FLPADFFPSVRDLLDTASA
AB674420_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB270542_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU668181_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU667964_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSGFFPSIRDLLDTASA
KU667576_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KR014098_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP148525_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDYFPSIRDLLDTASA
KJ410518_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774319_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KC315399_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ227696_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSTRDLLDTASA
GQ227694_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSTRDLLDTASA
FJ787471_HBc_P-C          ------------MDIDHYKEFGASVELLP--FLPSDFFPSIRDLLDTASA
FJ562228_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ386617_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPFDFFPSIRDLLDTASA
FJ023566_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939605_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU939568_HBc_P-C          ------------MDIDHYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
EU916227_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871973_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
EU871972_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
EU871970_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
EU717215_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
DQ089785_HBc_P-C          ------------MDIDPYKEFGASQELIS--FLPSDFFPTIRDLLDTASA
AB900113_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB670262_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB074755_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571352_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASA
MF674439_HBc_P-B          ------------MDIDPYKEFGASSQLLS--FLPSDFFPSVRDLLDTASA
KY881838_HBc_P-B          ------------VDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689444_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASA
KY689406_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSVRDLLDTATA
KX276828_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
KX276810_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276795_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX276772_HBc_P-B          ------------MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTASA
KU964120_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU964115_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU964113_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU964111_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU668124_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667649_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFLPSIRDLLDTASA
KU576653_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576639_HBc_P-B          ------------MDMDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576391_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576295_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576288_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPPIRDLLDTASA
KU576132_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576051_HBc_P-B          ------------MDIDTYKAFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406273_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ803821_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPHDFFPSIRDLLDTASA
KJ803789_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504532_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
JQ341495_HBc_P-B          ------------MDIDPYKEFGASXELLS--FLPSDFFPTIRDLLDTASA
JQ341493_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU487256_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925401_HBc_P-RF-DB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX660686_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM606741_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFYPSVRDLLDTASA
FJ882614_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ882610_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562287_HBc_P-RF-CB      ------------MGLDPYKEFGAFGELLF--FLPFDFFPSIRDLLDTASA
FJ023666_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
JN688709_HBc_P-F          ------------MDIDPYKEFGASVELXS--FLPSDFFPSVRDLLDTASA
HM363587_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161831_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350110_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598677_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPHDFFPSVRDLLDTASA
KP857049_HBc_P-D          ------------MDIDPYKEFGASVQLLS--FLPSDFFPSIRDLLDTAAA
KF471659_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875333_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN664926_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
JN642148_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040819_HBc_P-D          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
JN040750_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ477454_HBc_P-D          ------------MDIEPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ349231_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU921419_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726941_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF419542_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
AF419540_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
AB270537_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB120308_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB110075_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH818373_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KY881999_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881971_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLIDTASA
KY881960_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881884_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY363266_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964213_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964212_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964211_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964210_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964209_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964208_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964207_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964206_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964205_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964204_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964203_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964202_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964201_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964200_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KU964190_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KU964189_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KU964186_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KU964185_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KU668135_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU576688_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KR013851_HBc_P-C          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KR013764_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ803823_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ803770_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPADFFPSIRDLLDTASA
KJ803762_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KJ598762_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410510_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTANA
KF779327_HBc_P-C          ------------MDIDTYKEFEASWELLS--FLPSDFFPSIRDLLDTASA
GQ184326_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAFA
FJ899768_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
FJ562264_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
FJ386673_HBc_P-C          ------------MDIDTYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ386644_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPFEFFLSIRDLLDTASA
EU939617_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939595_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670255_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB300373_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPHDFFPSIRDLLDTASA
AB074047_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB014364_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG372436_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
MF674415_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KY881831_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881828_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881827_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881826_HBc_P-B          ------------MDIDTYKEFGASVESLS--FLPSDFFPSIRDLLDTASA
KY881795_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689433_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KX276796_HBc_P-B          ------------MDIDPYKEFGASXXLLS--FLPSDFFPSIRDLLDTASA
KX276792_HBc_P-B          ------------MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTXSA
KX276786_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
KX276784_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX276775_HBc_P-B          ------------MDIDPYKEFGASAELXS--FLPSDFFPSIRDLLDTASA
KU964168_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668366_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU668157_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDPLDTASA
KU667874_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU667780_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU577003_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576989_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576988_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576618_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576609_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576606_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576598_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576597_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU576279_HBc_P-B          ------------MDIDPYKEFGASAELVS--FLPSDFFPSIRDLLDTASA
KU575977_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575927_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406266_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP406254_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP406253_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP406252_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP406251_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP406250_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP406249_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP406248_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP406247_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP406246_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP406245_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP406244_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP148332_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KJ843165_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIQDLLDTASA
KJ803819_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803752_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF165906_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF164967_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707739_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707738_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707737_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707735_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707734_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ341490_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF436921_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011490_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924625_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
AF233234_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB713528_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB073837_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
AB031268_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964257_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964259_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964260_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964261_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964262_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964263_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964264_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964265_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964266_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964267_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964268_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964269_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KU964270_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIQDLLDTATA
KU964271_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTATA
KY470856_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
KY470855_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
KY470854_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
KY470853_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
KY470850_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
KY470849_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
KY470847_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
KY470846_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
KY470844_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
KY470843_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
KR013948_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KR013843_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013806_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KF873530_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475335_HBc_P-RF-CB      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
FJ562336_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLVDTATA
FJ562317_HBc_P-RF-CB      ------------MDIDPYKEFGASAQLLS--FLPTDFFPSIRDLLDTAQA
FJ386674_HBc_P-RF-BC      ------------MDIDPYKEFGASAELIS--FLPSDFFPNIXDLLDTASA
FJ386635_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ361772_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KF849724_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724237_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN040830_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN040780_HBc_P-D          ------------MDIDPYKEFGASVQLLS--FLPVDFFPSIRDLLDTASA
FJ904432_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
FJ904424_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726926_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726912_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU155895_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY090453_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
X52939_HBc_P-C            ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MK720630_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTAAA
MK720629_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTAAA
MG826140_HBc_P-C          ------------MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826122_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTAQA
MF674430_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY470976_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU964343_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964215_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KU668050_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
KU577056_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576919_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576580_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KJ803779_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ803776_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ410515_HBc_P-C          ------------MDIDPYKEFGAYQELLS--FLPSDFFPTIRDLLDTASA
KC774288_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661497_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JX507211_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX026877_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
JQ801489_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ027332_HBc_P-C          ------------MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475351_HBc_P-C          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
GQ475318_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
GQ377623_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ899783_HBc_P-C          ------------MDIDPYKEFGATAELLS--FLPSDFFPSIRDLLDTASA
FJ787485_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTVSA
FJ562284_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
FJ562238_HBc_P-C          ------------MDIDLYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ518810_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIQDLIDTASA
FJ032346_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
EU939641_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSXRDLLDTASA
EU939601_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU579443_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ980551_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ478901_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
DQ089756_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPNDFFPSIRDLLDTASA
AF411412_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB642097_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPXDFFPSIRDLLDTAAA
AB485810_HBc_P-C          ------------MDIDPYKEFGASSELLS--FLPSDFFPSIRDLLDTASA
AB367392_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPPDFFPSVRDLIDTASA
AB115417_HBc_P-C          ------------MDIDPNKEFGASVELLS--FLPSDFFPSMRDLLDTASA
AB111118_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
AB014383_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
MF674448_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRELLDTASA
MF568474_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTATA
KY881861_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881850_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY689562_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY689479_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689417_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KX276817_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276807_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRELLDTASA
KX276805_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTXSA
KX276803_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276801_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276799_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPXDFFPSVRDLLDTASA
KX276782_HBc_P-B          ------------MDIDPYKEFGASXELLS--FLPADFFPSVRDLLDTASA
KU964104_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU668316_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668306_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668012_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDIASA
KU667448_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPNIRDLLDTASA
KU576600_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576467_HBc_P-B          ------------MDIDPYKEFGASVELPS--FLPSDFFPSIRDLLDTASA
KU576402_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576395_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576386_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLHDTASA
KU576018_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575979_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575966_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU575959_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406166_HBc_P-B          ------------MDIDPFKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406163_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
KM875420_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KM213035_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ803820_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
JQ027325_HBc_P-B          ------------MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTATA
FJ592177_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK052976_HBc_P-RF-BD      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826141_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX660685_HBc_P-RF-DC      ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU964351_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KM213033_HBc_P-RF-CB      ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ562227_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939630_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU939577_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU919167_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
EU787435_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
EU660227_HBc_P-RF-BC      ------------MDIDPYKEFGASAPLLS--FLPSDFFPSIRDLLDTATA
EF103284_HBc_P-RF-AD      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY206374_HBc_P-RF-CB      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
AY057948_HBc_P-RF-DC      ------------MDIDPYKEFGASVEVLS--FLPSDFFPSNRDLLDTASA
AF461361_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB198084_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FMPSDFFPSIRDLLDTASA
KJ638660_HBc_P-F          ------------MDIDPYKEFGASLELLS--FLPXDFFPSXRDLIDTASA
AF350187_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM577668_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF471655_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
JN040779_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
FJ904433_HBc_C-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726868_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
MG826124_HBc_P-C          ------------MDIDTYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KY881992_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470978_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470925_HBc_P-C          ------------MDIDTYKEFRASVELLS--FLPSDFFPSIRDLLDTASA
KY470918_HBc_P-C          ------------MDIDPYKEFGVSVELLS--FLPSDFFPSIRDLLDTASA
KY470900_HBc_P-C          ------------MDVDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363282_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363275_HBc_P-C          ------------MDLDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363264_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964363_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU964358_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU964349_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU964242_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964223_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
KU964016_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFSSVRDLLDTASD
KU668018_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667969_HBc_P-C          ------------MDIDPYKEFGASVELLP--FLPSDFFPSIRDLLDTASA
KU577062_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU577057_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU577052_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU577051_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU577049_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576643_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KR014059_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLVDTASA
KR013942_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013861_HBc_P-C          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
KP148563_HBc_P-C          ------------MDIDPYKEFGASVELLP--FLPSDFFPAIRDLLDTASA
KM875425_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRALLDTASA
KJ803754_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPQDFFPSIRDLLDTASA
KJ598772_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ598721_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ598686_HBc_P-C          ------------MDIDTYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ598679_HBc_P-C          ------------MDIDTYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ410499_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ410494_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ410492_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ410491_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ410489_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ173319_HBc_P-C          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KJ173290_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF165568_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC875271_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504539_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDLRDTASA
JX026880_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ801491_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
JQ707708_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040168_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ040167_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPLDFFPSIRDLLDTASA
JQ027317_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
HQ700578_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700490_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700456_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750135_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011500_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011468_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
GQ377586_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
GQ377545_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ259588_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSTRDLLDTASA
GQ227693_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSTRDLLDTASA
FJ899788_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ899771_HBc_P-C          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
FJ899770_HBc_P-C          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRELLDTASA
FJ899765_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
FJ899764_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
FJ899761_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
FJ787489_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ787488_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ562306_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562279_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562251_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
FJ562250_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
FJ562239_HBc_P-C          ------------MDIDLYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562230_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ386689_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
FJ386679_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ386672_HBc_P-C          ------------MDIDPYKEFGSSVELLS--FLPSDFFPSIRDLLDTASA
FJ386579_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPLDFFPSIRDLLDTASA
FJ032347_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
EU939647_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939642_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPLDFFPSIRDLLDTASA
EU939599_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU939593_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939591_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
EU939590_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
EU939587_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAFA
EU939574_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU939570_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
EU939562_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939556_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPADFFPSVRDLLDTASA
EU919169_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU916234_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916233_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916226_HBc_P-C          ------------MDIDIYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871976_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU589336_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU522069_HBc_P-C          ------------MDIDPYKEFGASVELLT--FLPSDFFPSIRDLLDTASA
DQ980549_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLIDTASA
DQ536413_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ536411_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ377165_HBc_P-C          ------------MDIDPYKEFGASVELLP--FLPSDFFPSIRDLLDTASA
DQ089778_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSXRDLLDTASA
DQ089768_HBc_P-C          ------------MDIDPYKEFGASSELLS--FLPSDFFPSIRDLLDTASA
D23684_HBc_P-C            ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
D23681_HBc_P-C            ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB697510_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
AB670308_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLIDTASA
AB670304_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
AB670272_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB642095_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367803_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367423_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
AB365451_HBc_P-C          ------------MDIDPYKEFGASAELIS--FLPSDFFPSIRDLLDTASA
AB111122_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB042284_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLXTASA
AB014392_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
AB014371_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPHDFFPSIRDLLDTASA
MG571370_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571327_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
MF674505_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC349869_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689423_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
KX276811_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276777_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276771_HBc_P-B          ------------MDIDPYKEFGASAQLLS--FLPSDFFPSIRDLLDTASA
KU964158_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
KU964108_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668358_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU668289_HBc_P-B          ------------MDIDPYKEFGTSVELLS--FLPSDFFPNIRDLLDTASA
KU668103_HBc_P-B          ------------MDVDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU668099_HBc_P-B          ------------MDIDPYKEFGASVELLP--FLPSDFFPSIRDLLDTASA
KU667794_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDSFPSIRDLLDTASA
KU667787_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLSSNFFPSIRDLPDTASA
KU667700_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667619_HBc_P-B          ------------MDVDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU576970_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRGLLDTASA
KU576466_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576411_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576398_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576387_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU576331_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576155_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576100_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTTSA
KU576042_HBc_P-B          ------------MDIDPYREFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576026_HBc_P-B          ------------MDIDPYEEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576015_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575983_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575971_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSMRDLLDTASA
KP406185_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406184_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406183_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406182_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406181_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406180_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406179_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406178_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406177_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406176_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP406162_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148579_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDAASA
KP148452_HBc_P-B          ------------MDTDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148392_HBc_P-B          ------------MDIDPYKEFGASVESLS--FLPSDFFPPIRDLLDTASA
KP148382_HBc_P-B          ------------MDIDPYKEFGASVELLP--FLPSDFFPSIRDLLDTASA
KM526752_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM213036_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173373_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774410_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774400_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504531_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
JQ801516_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
JQ040169_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341473_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU439013_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLETASA
MG826150_HBc_P-RF-BC      ------------MDIDPYKEFGASAELIS--FLPSDFFPTIRDLLDTASA
KY363263_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363262_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU679955_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPXDFFPSIRDLLDTAAA
KC774481_HBc_P-RF-DC      ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KC774447_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HQ684848_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU385774_HBc_P-RF-CB      ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
EU939668_HBc_P-RF-CB      ------------MDIDLYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939551_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU882006_HBc_P-RF-CB      ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU871995_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB642096_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
AB300369_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668434_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
GU456644_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF488701_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPKDFFPSVRDLLDTASA
LC279261_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC279253_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
LC279252_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KY882001_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881994_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881991_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881983_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881974_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881972_HBc_P-C          ------------MDIEPYKEFGASVKLLS--FLPSDFFPSVRDLLDTASA
KY881961_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881937_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881928_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881920_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881885_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881874_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881871_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY689518_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470975_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPADFFPSIRDLLDTASA
KY470974_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470969_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470965_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470916_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363285_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363283_HBc_P-C          ------------MDIDPYKELGASVELLS--FLPSDFFPSIRDLLDTASA
KU964002_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KU963996_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KU668197_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU667914_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU576920_HBc_P-C          ------------MDIDPYKEFGASVELLS--FSPSDFFPSIRELLDTASA
KU576581_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576284_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU576196_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU576193_HBc_P-C          ------------MDIDPYKEFGASGELLS--FLPSDFFPSVRDLLDTASA
KR013855_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPYDSFPSIRDLLDTASA
KR013850_HBc_P-C          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
KP148534_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KM875404_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803810_HBc_P-C          ------------MDIDPYNEFGASVELLS--FLPSDFFPSIRDLLDTATA
KJ598780_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ341545_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040144_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700504_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700502_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700496_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700495_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924615_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ872211_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
GQ475355_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ377620_HBc_P-C          ------------MDLDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ899789_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ899774_HBc_P-C          ------------MDIDPYKESGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787483_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ787482_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ787470_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787455_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSTRDLLDTASA
FJ562335_HBc_P-C          ------------MDIDPYKEFGASLQLLS--FLPADFFPSVRDLLDTAIA
FJ562301_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
FJ562248_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386687_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386596_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939657_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPADFFPSIRDLLDTASA
EU939653_HBc_P-C          ------------MDIDPYKEFGASAELIS--FLPNDFFPSIRDLLDTASA
EU939592_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU939584_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939558_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU939546_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU916218_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU872005_HBc_P-C          ------------MDIDPYKEFGASRELLS--FLPSDFFPPVRDLLDTASA
EU871974_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU717217_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU570072_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU560439_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EF384201_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ975274_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ975272_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
DQ361534_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089791_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
DQ089790_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089788_HBc_P-C          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLETASA
AY306136_HBc_P-C          ------------MDIGPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY269099_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY167092_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670301_HBc_P-C          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
AB670278_HBc_P-C          ------------MDIDPYKEFGASLELLS--FLPSDFFPSIRDLLDTASA
AB670256_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB670246_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
AB367433_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367425_HBc_P-C          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AB367398_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB182589_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB014397_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014387_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB014372_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB014363_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK818222_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPXIRDLLDTAXA
MG571373_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571372_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571325_HBc_P-B          ------------MDIDPYKEFGAPVELIS--FLPXDFFPSARDLXDTASA
MF674496_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KY881856_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881851_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDAASA
KY881843_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881842_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881841_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881839_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881836_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881835_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881833_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881830_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881829_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881824_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881823_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881822_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881821_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881820_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881788_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689483_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSXRDLLDTATA
KY689476_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
KY689419_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470840_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470832_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765854_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276830_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
KX276814_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964167_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964166_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964163_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964162_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964161_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964160_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964159_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964157_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964156_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964154_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KU964153_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667551_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
KU667540_HBc_P-B          ------------MDIDPYKEFEASVELLS--FLPSDFFPNIRDLLDTASA
KU576969_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576968_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576624_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576460_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU576255_HBc_P-B          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576254_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576251_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576191_HBc_P-B          ------------MDIDPYKEFGASLELIS--FLPSDFFPSIRDLLDTASA
KU576154_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576151_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576150_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576149_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576020_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575984_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575982_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575980_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575978_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575976_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575975_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575974_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575973_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575953_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575945_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575942_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU575941_HBc_P-B          ------------MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575937_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575928_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575922_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148391_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP148345_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDIFPSIRDLLDTASA
KM213034_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM213032_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ803825_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803795_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ803783_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ173386_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
KJ173383_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ173380_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ173377_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ173298_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF167010_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPPDFFPSVRDLLDTASA
KC836872_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KC774412_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
KC774396_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KC774376_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC774367_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
JX870001_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX661480_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
JQ429081_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
JQ341501_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPTDFFPSIRDLLDTASA
JQ027316_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU939665_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700476_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSXRDLLDTASA
HQ700577_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSXRDLLDTASA
KY881840_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY670781_HBc_P-RF-DC      ------------MDIDXYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KX096713_HBc_P-RF-CA      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU577083_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576837_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KT991419_HBc_P-RF-DC      ------------MDIDHYEEFGASVELLS--FLPSDFFPAIRDLLDTASA
KJ598675_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410497_HBc_P-RF-BC      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774453_HBc_P-RF-DC      ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KC315400_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504540_HBc_P-RF-CB      ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF436919_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
HM750148_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
FJ715347_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715346_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715345_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU522070_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF411409_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367400_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
JN688701_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
S75184_HBc_P-C            ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
MG826139_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826137_HBc_P-C          ------------MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASA
MF925367_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
MF674489_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
MF674463_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
MF674458_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVHDLLDTASA
MF674428_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674425_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVHDLLDTASA
MF674417_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
MF674390_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881968_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881888_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881812_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881810_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881807_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470979_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470977_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470973_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470972_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFSPSIRDLLDTASA
KY470971_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFSPSIRDLLDTASA
KY470970_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470968_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470967_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470966_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KY470883_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276846_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964226_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
KU964222_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
KU963885_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU963882_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU963880_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU963878_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU963877_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU963871_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU668000_HBc_P-C          ------------MDTDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667409_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRELLDTASA
KU577106_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576951_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576941_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576937_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576899_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576858_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576838_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576835_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576833_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576763_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576752_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576697_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576696_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576677_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIWELLDTASA
KU576644_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576642_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576635_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576631_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576627_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576615_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576588_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576585_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576584_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576503_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576422_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576144_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576143_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576124_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576123_HBc_P-C          ------------MDINPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576122_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576121_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576120_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576119_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576118_HBc_P-C          ------------MDIDPYKGFGASVELLS--FLPSDFFPSIRELLDTASA
KU576117_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576116_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU576115_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KT284758_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR014060_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR014055_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013870_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013868_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013860_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KR013859_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KR013849_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013848_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013845_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013844_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013824_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KM875412_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803826_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KJ598658_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173295_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214669_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KF214652_HBc_P-C          ------------MDIDPYKEFGASVQLLS--FLPTDFFPSIRDLLDTAAA
KC774358_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774269_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KC774225_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
JX504541_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
JX429918_HBc_P-C          ------------MDIDPYEEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX026888_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801503_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801493_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801483_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
JQ801481_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
JQ040156_HBc_P-C          ------------XDIDPXKEFGASSELLS--FLPSDFFPSIRDLLDTASA
JQ040151_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
JQ040131_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPPDFFPSIRDLLDTASA
JN827416_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
HQ700575_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924655_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924612_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
GQ475337_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377628_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
GQ377518_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ715418_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLQSDFFPSIRDLLDTASA
FJ715392_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715391_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLQSDFFPSIRDLLDTASA
FJ715390_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLQSDFFPSIRDLLDTASA
FJ715368_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLQSDFFPSIRDLLDTASA
FJ715359_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ715351_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLQSDFFPSIRDLLDTASA
FJ562319_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ562249_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ562220_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRELLDTASA
FJ386677_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPNDFFPSIRDLLDTASA
FJ386663_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
FJ386645_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386620_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ023639_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU939607_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939600_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939596_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPNIRDLLDTASA
EU939554_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939550_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU881996_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU717212_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU439015_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
DQ683578_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
DQ478899_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
DQ089802_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089777_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089762_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
DQ089761_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
D28880_HBc_P-C            ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AY641559_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY206382_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AY206378_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY167090_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670300_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB670291_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB670276_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670274_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670237_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB485809_HBc_P-C          ------------MDIDPYKEFGASSELLS--FLPSDFFPSIRDLLDTASA
AB367804_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367802_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB367432_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367429_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB367408_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
AB367402_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB367401_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB195952_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB117758_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB112408_HBc_P-C          ------------MDIDPYKEFGASEELLS--FLPSDYFPSIRDLLDTASA
AB049610_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
AB014393_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014373_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571348_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674498_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674491_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
MF674479_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674476_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674465_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
MF674392_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
MF674383_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC349875_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC349872_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC349870_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KY881912_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881779_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881778_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881761_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881760_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881759_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881757_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881756_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881753_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881752_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881747_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881746_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881745_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881741_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881740_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881735_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881734_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881733_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881732_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881731_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881730_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881729_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881728_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881727_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881726_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881725_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881724_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881723_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881722_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881721_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689551_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689507_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689506_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689505_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689410_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470839_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470838_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470836_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470835_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470833_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470830_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276820_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
KU964107_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU964105_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU964102_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU964101_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU964100_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU964098_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU964096_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KU668337_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668324_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668318_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPNIRDLLDTDSA
KU668297_HBc_P-B          ------------MDIDPYKEFGASVELLS--LLPSDFFPSIRDLLDTASA
KU668274_HBc_P-B          ------------MDIDPYKEFEASVELLS--SLPSDFFPSIRDLLDTASA
KU668256_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668105_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
KU667605_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667520_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576499_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576493_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576470_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576419_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576412_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576408_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576406_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576401_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576400_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576399_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU575981_HBc_P-B          ------------MDIDPYKEFGASVVLLS--FLPTDFFPSIRDLLDTASA
KU575921_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406329_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406328_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406327_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406326_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406325_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406324_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406322_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406321_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406320_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406319_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406318_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803786_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EF197911_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
Y18857_HBc_P-RF-CB        ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
MG826151_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826149_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826142_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925370_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC416040_HBc_P-RF-CB      ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY629632_HBc_P-RF-DC      ------------MDIDLYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX774505_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964315_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU963944_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963943_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963942_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963941_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963940_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963939_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963938_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963936_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963935_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963934_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963933_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963932_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963931_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963930_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963883_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
KU679958_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSXFFPSIRDLLDTASA
KU679948_HBc_P-RF-CB      ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KU679940_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
KT991423_HBc_P-RF-DC      ------------MDIDHYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KT991420_HBc_P-RF-DC      ------------MDIDHYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KT991417_HBc_P-RF-DC      ------------MDIDHYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KJ803753_HBc_P-RF-CB      ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774479_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774449_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774443_HBc_P-RF-DC      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774442_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774428_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774425_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774420_HBc_P-RF-DC      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774364_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774307_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774305_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774291_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774178_HBc_P-RF-BC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707714_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040130_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN664935_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF436923_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700485_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
HQ700462_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU357843_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562328_HBc_P-RF-CB      ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTVSA
FJ562305_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562302_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562278_HBc_P-RF-DC      ------------MDIDHYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
FJ562267_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562263_HBc_P-RF-DC      ------------MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTASA
FJ562229_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562226_HBc_P-RF-CB      ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386633_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
FJ386593_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386585_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386581_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
FJ386578_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939629_HBc_P-RF-BC      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939621_HBc_P-RF-CB      ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
EU939606_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939589_HBc_P-RF-CB      ------------MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939581_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU919166_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU872015_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU872014_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871999_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871996_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871993_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871992_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871991_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871990_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871989_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871988_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871987_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871986_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871985_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871984_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871983_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871981_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU717211_HBc_P-RF-CB      ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ478898_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY862864_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367393_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB270535_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB205152_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB049609_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM363597_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN664948_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
JN664921_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MH891502_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG893553_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826143_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571335_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925398_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925387_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925374_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674514_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674504_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674475_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674411_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY882000_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881998_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881996_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881995_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881986_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881985_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881982_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881979_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881977_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881976_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881975_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881970_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881969_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881967_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881965_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881964_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881963_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881959_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881943_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881942_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881941_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881940_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881939_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881938_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881936_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881935_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881934_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881933_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881932_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881931_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881930_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881929_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881927_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881926_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881925_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881924_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881923_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881922_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881921_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881919_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881918_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881917_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881916_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881915_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881887_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY470920_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470917_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470915_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470914_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470913_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470912_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470910_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470909_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470907_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470906_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470896_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470880_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363284_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363281_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363268_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363258_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363257_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363256_HBc_P-C          ------------MDIDPYKEFGASVELLS--SLPSDFFPSIRDLLDTASA
KX765842_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765828_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765822_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276855_HBc_P-C          ------------MDIDTYKEFGASVQLLS--FLPSDFFPNIRDLLDTASA
KU963937_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963929_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963928_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963927_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963926_HBc_P-C          ------------MDIDPYKEFGASVQLLS--FLPSDFFPSIRDLLDTASA
KU963925_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963924_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963923_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963922_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963921_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963920_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963919_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963918_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963917_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963916_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963915_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963884_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963881_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963879_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963876_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963875_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963874_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU668013_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667984_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576929_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576747_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KT284759_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013975_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013969_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013826_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013821_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013820_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013817_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KR013800_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
KR013777_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM875430_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM875424_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803812_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803780_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803769_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ803757_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598754_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598752_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598751_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598750_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598748_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598747_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598746_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598744_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598743_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598742_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598741_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598719_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598718_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598717_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598715_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598714_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598713_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598712_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598711_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598709_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598708_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598707_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598706_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598705_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598687_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598680_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598646_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ598644_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410508_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ410505_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173445_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173337_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173316_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KF873541_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214678_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214676_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214675_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774355_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KC774354_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KC774346_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774340_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774313_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774311_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KC774301_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774284_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774282_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774279_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774275_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774259_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774253_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774245_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774243_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774227_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774218_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774211_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774207_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774199_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774195_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774194_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX560519_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX507214_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504542_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX429903_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801509_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707733_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707732_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707731_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707730_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707729_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707728_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707727_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707726_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707725_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707724_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707723_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707722_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707721_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707720_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707719_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707718_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707717_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707716_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707715_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707713_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707712_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707711_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707710_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707709_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707707_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040164_HBc_P-C          ------------MDIDTYKEFGASXELLS--FLPSDFFPAIRDLXDTASA
JQ040132_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLIDTASA
JQ027321_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ027319_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN104435_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN104434_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828931_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828930_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828929_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828928_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828926_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828925_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828924_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828923_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828922_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828921_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF436920_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ638218_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM750134_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011491_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU827639_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924658_HBc_P-C          ------------MDIDPYKEFGASVELIS--FLPSDFFPSIRDLLDTASA
GQ924622_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924616_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475357_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475356_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475349_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475309_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377609_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
GQ377608_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
GQ377593_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377557_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377543_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377526_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ372968_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ358153_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ227697_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ227692_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ899777_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ899769_HBc_P-C          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
FJ787490_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSGFFPSIRDLLDTASA
FJ787469_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787468_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787465_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787464_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787463_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787462_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787458_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787457_HBc_P-C          ------------MDIDPYKEFGASVELFS--FLPSDFFPSIRDLLDTASA
FJ787452_HBc_P-C          ------------MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787443_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787442_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787439_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787437_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715424_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715422_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ715350_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562333_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562330_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562318_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562307_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562299_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562286_HBc_P-C          ------------MDIDXYKEFGASXELLS--FLPSDFFPSIRDLLDTASA
FJ562270_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562256_HBc_P-C          ------------MDLDTYKPFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562241_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562235_HBc_P-C          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
FJ562232_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386671_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386662_HBc_P-C          ------------MDIDLYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
FJ386661_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386632_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386631_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386629_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386625_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386624_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386605_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386604_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386594_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023645_HBc_P-C          ------------MDIDSYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939651_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939640_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939626_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939625_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939618_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939615_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939614_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939613_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939611_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939610_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939609_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939594_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939579_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939576_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939572_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939564_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939563_HBc_P-C          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
EU939561_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939560_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939553_HBc_P-C          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939545_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939544_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939540_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939536_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871998_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU871980_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU796072_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU796070_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU560438_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU554536_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU522068_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU498227_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EF494379_HBc_P-C          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
DQ089800_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089796_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089795_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089772_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089771_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTAAA
AY641562_HBc_P-C          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
AY269140_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY206392_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY206385_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY206379_HBc_P-C          ------------MDIDPYKEFGASMELIS--FLPSDFFPSIRDLLDTASA
AY206376_HBc_P-C          ------------MDIDPYKEFGASMELIS--FLPSDFFPSIRDLLDTASA
AY066028_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF458665_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF411411_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF411410_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF411408_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF241410_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB971715_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB971714_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670309_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670290_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670289_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670277_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670270_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLIDTASA
AB670269_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670249_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367431_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367430_HBc_P-C          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
AB367424_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367416_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367414_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367412_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367407_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB300372_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB300368_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB205125_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB202072_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195948_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195947_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195944_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195943_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195942_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195938_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195937_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195936_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB111123_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB111121_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB111114_HBc_P-C          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014399_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014388_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014384_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014382_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014380_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014379_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014378_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014365_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
X97850_HBc_P-B            ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MK052964_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571374_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571350_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
MG571338_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTSSA
MG571334_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674503_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674487_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674470_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674469_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674461_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
MF674420_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674401_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674391_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC349877_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881867_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689564_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689556_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KY689523_HBc_P-B          ------------MDIDXYKEFGFSVELLS--FLPSDFFPSIRDLLDTASA
KY689511_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689496_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689458_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689451_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689445_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
KY629635_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470841_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470837_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY470834_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
X75656_HBc_P-RF-CB        ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU679945_HBc_P-RF-CB      ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTALA
KJ803785_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040148_HBc_P-RF-CB      ------------MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTASA
HQ700560_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700557_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700523_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700515_HBc_P-RF-CB      ------------MDIYPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700509_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU881995_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367419_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
MF925369_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674467_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674457_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY882003_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY882002_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881993_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLIDTASA
KY881989_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881988_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881987_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881981_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLIDTASA
KY881978_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRGLLDTASA
KY881973_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881966_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLIDTASA
KY881892_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881891_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881890_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881886_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KY881883_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881882_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881879_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881877_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881876_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881873_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881872_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881870_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY363279_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY363278_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY353910_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU964227_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964221_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964220_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964219_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964217_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU963997_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KU963992_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KU576454_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
KR013866_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KR013818_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173285_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ801490_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040158_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ027323_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSXRDLLDTASA
JQ027320_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ027318_HBc_P-C          ------------MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTASA
JF828912_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828911_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828910_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828908_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828907_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828906_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JF828905_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700574_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700573_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700572_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700570_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700568_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700567_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700566_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700565_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700564_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700563_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700562_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700561_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700559_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700558_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700556_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700555_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700544_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011488_HBc_P-C          ------------MDIDPYKEFGASXELLS--FLPSDFFPSIRDLLDTASA
GQ475336_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ899778_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562334_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562325_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562243_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ386657_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386603_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ386574_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939659_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939644_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939588_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939585_HBc_P-C          ------------MDIDLYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939582_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939571_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU410079_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EF536066_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EF536065_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ315782_HBc_P-C          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ089757_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
AB367435_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367428_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB367418_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB298721_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB298720_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195946_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB112066_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB042282_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014396_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014381_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571341_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571324_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF674436_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPSDFFPNIRDLLDTASA
MF674409_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881914_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881913_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881911_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881910_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881909_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881908_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881907_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881906_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881905_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881904_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881903_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881902_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881901_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881900_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881899_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881898_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881897_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881896_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881895_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881894_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881893_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881868_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881866_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881863_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881862_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881860_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881859_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881858_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881857_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881855_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881854_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881852_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881848_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881847_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFYPSIRDLLDTASA
KY881846_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881844_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689557_HBc_P-B          ------------MDIDPYKXFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689484_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KY689426_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ429080_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPXDFFPSIRDLLDTASA
JQ341515_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341494_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341468_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSXRDLLDTASA
KU695746_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU695744_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU695743_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU695742_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU695741_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873537_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
KC774263_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700542_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700532_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700531_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700530_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700528_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700527_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700519_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700518_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700499_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700498_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ358156_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ358155_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939547_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011103_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AP011102_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB493847_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB493842_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB493840_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB493838_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB493837_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB105172_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
X75665_HBc_P-C            ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826129_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG826126_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881889_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
KY881881_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY881819_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY881806_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX774503_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765851_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX765849_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276852_HBc_P-C          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276847_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KM875428_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF214667_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC774302_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ801502_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ040149_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700576_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700571_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ475341_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787456_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIQDLLDTASA
FJ562252_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386685_HBc_P-C          ------------MDIDXYKEFGASXELLS--FLPSDFFPSIRDLXDTASA
FJ386659_HBc_P-C          ------------MDIDXYKEFGASXELLS--FLPSDFFPSIRDLLDTASA
FJ386651_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
FJ386589_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
EU939538_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU872004_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
EU872003_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
EU872001_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
DQ089776_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF223961_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB670281_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367405_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB300360_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTALA
AB112065_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
AB112063_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
AB111946_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
MK818225_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
LC349868_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276816_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276778_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ429079_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF873533_HBc_P-RF-CB      ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873513_HBc_P-RF-CB      ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
EU939627_HBc_P-RF-BC      ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670303_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014375_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276851_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
KX276841_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU679947_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU679936_HBc_P-C          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
JQ040172_HBc_P-C          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ027324_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700569_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700543_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562280_HBc_P-C          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU872002_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
EU872000_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
DQ089799_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670264_HBc_P-C          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670241_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB288026_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB195945_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571363_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689560_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689559_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689503_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLIDTASA
KY689490_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU679943_HBc_P-RF-BC      ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
KF873540_HBc_P-RF-CB      ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MF925405_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276853_HBc_P-C          ------------MDIDPYKEFGASXXLLS--FLPSDFFPSIRDLLDTASA
JQ341518_HBc_P-C          ------------MDIDXYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JQ027322_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB670268_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB111112_HBc_P-C          ------------MDIDPYKEFGASXELLS--FLPSDFFPSXRDLLDTASA
KY689488_HBc_P-B          ------------MDIDTYKPFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276785_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
KX276844_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964333_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964332_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964331_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964330_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964329_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964328_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964327_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964326_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964325_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964324_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964323_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964322_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964321_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964320_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964319_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964318_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU679937_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KF873544_HBc_P-C          ------------MDIDXYKEFGASXQLLS--FLPSDFFPSIRDLLDTASA
KF873536_HBc_P-C          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
HM011502_HBc_P-C          ------------MDIDPYKEFGASXELLS--FLPSDFFPSXRDLLDTASA
AB367801_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367426_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB367406_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014369_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
MG571357_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
MG571331_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY689404_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLXDTASA
JQ040127_HBc_P-C          ------------MDIDPYKEFGASXELLS--FLPXDFFPSIRDLLDTASA
JQ027313_HBc_P-B          ------------MDIDPYKEFGASXELLS--FLPXDFFPSXRDLXDTASA
KX276794_HBc_P-B          ------------MDIDPYKEFGASXELLS--FLPXDFFPSIRDLLDTASA
KU679956_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPXDFFPSIRDLLDTASA
JQ027310_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX276831_HBc_P-C          ------------MDIDVYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939557_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341487_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU679954_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KX276829_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU679951_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ707740_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707742_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707743_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707744_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707745_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707746_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707747_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707749_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707750_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707753_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707755_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707758_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707759_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707762_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707763_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707764_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707765_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707766_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
JQ707767_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KP148458_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KP148460_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
MG098583_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG098574_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG098577_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPNDFFPSARDLLDTASA
KY476330_HBc_P-F          ------------MDIDPYKEYGASAELLS--FLPTDFYPSVRDLLDTAQA
KP995115_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995101_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
MG098566_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
FJ904436_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPNDFYPPVRDLLDTAXA
KJ586805_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ586803_HBc_P-RF-AF      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FN594767_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPHDFFPSVKDLLDTASA
KP168421_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG098573_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPIDFFPSARDLLDTASA
KJ676694_HBc_P-F          ------------MDIDPYKEFGASLELLS--FLPSDFYPSVRDLIDTASA
AJ627217_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ904437_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EF103283_HBc_P-RF-AD      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX896129_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY476329_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KY476326_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995111_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPIDFFPSVRDLLDTATA
KC494400_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ589067_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ904400_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HQ285946_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM066946_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KT896494_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
KP718110_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
MF925397_HBc_P-RF-DC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KM386676_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161788_HBc_P-RF-AE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX896133_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX896128_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY090457_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB064315_HBc_P-H          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTATA
AB059661_HBc_P-H          ------------MDIDLYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ356716_HBc_C-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ356715_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPNDFFPSVRDLLDTASA
MG098579_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAXA
KJ843195_HBc_P-F          ------------MDIDPYKEFGASLELLS--FLPSDFFPSVRDLLDTASA
KJ586808_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF779236_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC494394_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
U95551_HBc_P-RF-DE        ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618444_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618440_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618438_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724240_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF967563_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF925402_HBc_P-RF-BD      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KJ586811_HBc_P-RF-DF      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDFLDTASA
HF571060_HBc_P-RF-AE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB270538_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995119_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
KP995095_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843167_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB365446_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPNVRDLLDTASA
KJ586807_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ586806_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF199901_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC494405_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC494404_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC494403_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC494402_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC494401_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC494398_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC494397_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC494395_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX079937_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX079936_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN811656_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN811655_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN792922_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN688699_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN688703_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX896126_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX896131_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN257216_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX264501_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC836867_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX915624_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX896134_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX896132_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX896125_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX896124_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM117851_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM117850_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU498228_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EF157291_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY090460_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY090454_HBc_C-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB818694_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB375164_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB375163_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB375161_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB375160_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB375159_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB353764_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB275308_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB266536_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB205010_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB179747_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ638662_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB375162_HBc_P-H          ------------MDIDPYKEFGASVELLX--FLPSDFFPSVRDLLDTASA
JX896130_HBc_P-H          ------------MDIDPYKEFGASVELLX--FLPSDFFPSVRDLLDTASA
JN257174_HBc_P-RF-DE      ------------MDIDXYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX896127_HBc_P-H          ------------MDIDPYKEFGASVEXLS--FLPSDFFPSVRDLXDTASA
KP995109_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995105_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
KJ843225_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN792920_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HE981180_HBc_P-RF-GF      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ161806_HBc_P-RF-EA      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ692536_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH051987_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG098565_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY476327_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPLDFFPSVRDLLDTASA
KX757672_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995106_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP718107_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843194_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843191_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843169_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843168_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
KJ638659_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995096_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP718113_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP718104_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG098570_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPPVRDLLDTASA
KY476331_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995107_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP718109_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HE981179_HBc_P-RF-FG      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
X75663_HBc_P-F            ------------MDIDPYKEFGASVELFS--FLASDFFPSVRDLLDTASA
X75658_HBc_C-F            ------------MDIDPYKEFGASVELFS--FLPSDFFPSIRDLLDTASA
X69798_HBc_P-F            ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MK058437_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH051986_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG098564_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLXTASA
KY476332_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY476324_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
KY476323_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY476322_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY458062_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY458061_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY382411_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX757665_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX264499_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX264498_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX264497_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KX264496_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995126_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995125_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995124_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995123_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995120_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995118_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995116_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995110_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995104_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995098_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995091_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP718112_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP718111_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP718103_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KM998715_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KM233681_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843226_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843224_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843223_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843222_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843221_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843220_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843219_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843213_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843212_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843211_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843210_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843209_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843208_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843207_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843206_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843205_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843204_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843203_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843202_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843201_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843200_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843199_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843198_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASP
KJ843197_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843196_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843193_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843190_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843189_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843185_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843181_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843180_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843179_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843178_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843177_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843176_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843175_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843174_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843171_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843170_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843164_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ843163_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995117_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
KJ638657_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY382417_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KY382416_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP718106_HBc_P-F          ------------MDIDXYKEFGASXELLS--FLPSDFFPSXRDLLDTASA
KY382415_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF779235_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX899374_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELXS--FLPSDFFPSVRDLLDTASA
HE981171_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB064312_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB056515_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439792_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439793_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439796_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439801_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707657_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB056513_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707436_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440019_HBc_P-RF-AG      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB933282_HBc_P-RF-AG      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440022_HBc_P-RF-AG      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB933283_HBc_P-RF-AG      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF440021_HBc_P-RF-AG      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB056514_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB064310_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB064311_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB064313_HBc_C-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB375165_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB375166_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB375167_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB375168_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB375169_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB375170_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF160501_HBc_C-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF405706_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ207798_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EF464097_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EF464098_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EF634480_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GU563556_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HE981172_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HE981174_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HE981175_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HE981176_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439779_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439780_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439781_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439782_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439784_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439785_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439786_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439787_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439788_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439789_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439791_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439794_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439795_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439797_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTTSA
JF439799_HBc_P-G          MDRITLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439800_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439802_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439803_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439804_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439805_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439806_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439807_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439808_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439809_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439810_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439811_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439812_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439813_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439814_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439815_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439816_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439817_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439818_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707660_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707666_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707668_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707671_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707673_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707677_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707678_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707679_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707680_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX899375_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF414679_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF767450_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF767451_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASX
KF767452_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779233_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF779357_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KJ194508_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM998716_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KR230749_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX264500_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
M74502_HBc_P-G            MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB933279_HBc_P-RF-AG      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB933280_HBc_P-RF-AG      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB933281_HBc_P-RF-AG      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EF464099_HBc_P-RF-AG      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU833889_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU833890_HBc_P-RF-GA      MDRITLPYGFFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KY004111_HBc_P-G          MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707473_HBc_P-RF-GA      MDRTTLPYGLFGLDIDSYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707426_HBc_P-RF-GA      MDRITLPYGLLGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ272887_HBc_P-RF-GF      MDSTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707463_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP274926_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707475_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707474_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707472_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707471_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707470_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707469_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707468_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707467_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707466_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707465_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707464_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707462_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707461_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707460_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707459_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707458_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707457_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707456_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707450_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707448_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707445_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707441_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707432_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707430_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707424_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ272886_HBc_P-RF-GF      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707421_HBc_P-RF-GA      MDRTTLPYGLFGLDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB365453_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLIDTATA
MG098575_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
AB059660_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
KP995113_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPPDFFPSVRDLIDTASA
KJ638663_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLXTASA
AB116654_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
KY476328_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPXDFFPSIRDLLDTAAA
KP995097_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPADFFPSARDLFDTASA
AF324143_HBc_P-F          ------------MDIDPYKEFGASMELLS--FLPSDFFPSVRDLLDTASA
MG098580_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP995114_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
JN792916_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
EF576808_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPTDFFPSARDLFDTASA
AB365449_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB166850_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
AB214516_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
HM585194_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
HM622135_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
JN792914_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
KJ638656_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JX899376_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPPDFFPSVRDLLDTASA
JN792917_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
EU185743_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ899146_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLFDTASA
KY476325_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTRDLLDTASA
KC494396_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY311370_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY090459_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG098578_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPXDFFPSVRDLLDTASA
AY254498_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036905_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036906_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036907_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036908_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036909_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036910_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036911_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036912_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036913_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036914_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036915_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036916_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036917_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036919_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB036920_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB064316_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB116549_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB116551_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB116552_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN688691_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JF439885_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JF439884_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HQ420166_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HQ420165_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HQ378247_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM590474_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM590473_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM590472_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM590471_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585200_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585199_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585198_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585197_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585196_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585195_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585193_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585192_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585191_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585190_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585189_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585188_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585187_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM585186_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HE981186_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HE981182_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HE981181_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ709494_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ709465_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ709464_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ709463_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ709462_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ709460_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ709459_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ709458_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ709457_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ657529_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ657528_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ657522_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ657519_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ589065_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU670262_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU670261_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU366133_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU366118_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU366116_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU185744_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EF576812_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ899150_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ899149_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ899148_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ899147_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ899145_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ899144_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ899143_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ899142_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ823095_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ823094_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ823093_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ823092_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ823091_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ823090_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ823089_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ823088_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ823087_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ823086_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ776247_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY311369_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY179735_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY090461_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY090458_HBc_C-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY090455_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF223965_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF223964_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF223963_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF223962_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN792921_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPXDFFPSVRDLLDTASA
JN792918_HBc_P-F          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
AB365450_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPXDXXPSVRDLLDTASA
HM627320_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB287318_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPNDFFPSVRDLLDTAAA
KP659219_HBc_P-B          ------------MDIDPYKEFGASSDLLS--FLPNDFFPSVRDLLDTAAA
GQ161825_HBc_P-E          ------------MDLDPYKEFGATVELLS--FLPGDFFPSVRDLLYTASA
DQ995804_HBc_P-B          ------------MDIDPYKEFGASAELIS--FLPADFFPSVRDLLDTASA
AB900106_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
DQ463790_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
JN792900_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
DQ463798_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN792899_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB900108_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTATA
KP659249_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPTDFFPSVRDLLDTAAA
DQ463795_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
KP659244_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFYPSVRDLLDTASA
KP659248_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
AB287319_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP659224_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ463800_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN792897_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN792898_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ463787_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
JN792896_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
DQ463797_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
JN792895_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
DQ463789_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
DQ463802_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
DQ463792_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB642093_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPXDFFPSVRDLLDTAXA
AB642101_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPQDFYPSVRDLLDTAAA
KP857070_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857071_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857091_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPHDFFPSIRDLLDTASA
FJ904410_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPHDFFPSVRDLLDTATA
FJ904409_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPHDFFPSVRDLLDTATA
FJ386648_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPSDFFPSIRDLLDTAAA
EU939636_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPPDFYPSIRDLLDTASA
AB287317_HBc_P-B          ------------MDIDTYKEFGATVELLS--FLPDDFFPSVRDLLDTAAA
KU576069_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU576070_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
AF324088_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
AB931168_HBc_P-B          ------------MDIDPYKEFGATGELLS--FLPRDFFPSAQDLLDTAAA
AB931169_HBc_P-B          ------------MDIDPYKEFGATGELLS--FLPRDFFPSAQDLLDTAAA
EU570075_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ032344_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
FJ386656_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
JN792901_HBc_P-B          ------------MDIDPYKEFGATTELLS--FLPSDFYPSVRDLLDTAAA
JN792902_HBc_P-B          ------------MDIDPYKEFGATTELLS--FLPSDFFPSVRDLLDTAAA
AB674416_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPDDFFPSARDLLDTATA
KP659221_HBc_P-B          ------------MDIDPYKEFGASEELLS--FLPSDFFPSARDLLDTASA
EU939678_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
EU939677_HBc_P-B          ------------MDIDTYKEFGASLELLS--FLPSDFFPSIRDLLDTATA
AP011094_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ477474_HBc_P-A          ------------MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTASA
KU576414_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTAAA
KU576415_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTAAA
KU576416_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTAAA
KU576417_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTAAA
KU576418_HBc_P-B          ------------MDIDPYKEFGASVELIS--FLPSDFFPSVRDLLDTAAA
FJ904435_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPFDFFPSVRDFLDSALA
GQ475343_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPPVRDLLDTASA
GQ475352_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPPVRDLLDTASA
AB302095_HBc_P-B          ------------MDIDPYKEFGATAELLS--FLPPDFFPSARDLLDTTAA
AB300371_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPPDFFPNIRDLLDTAAA
AB287324_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSARDLLDTASA
JF439821_HBc_P-A          ------------RDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494791_HBc_P-E          ------------MDIDPHKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494793_HBc_P-E          ------------MDIDPHKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725096_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
MH725110_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
MH725118_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
EU726929_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
AJ627215_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AJ627216_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AJ627218_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB674410_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ801518_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ562311_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB900103_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPHDFFPSARDLLDTAAA
AB287327_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTAAA
AB106884_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPPDFFPSARDLLDTAAA
AB073847_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTTAA
KP857088_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPLDFFPSVRDLLDTASA
KM606662_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPHDFFPSAPDLLDTAAA
GQ477493_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPTDFFPSARDLLDTASA
KC875298_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
KC875290_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
KX196209_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
KX196212_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
KU667678_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPADFFPSIRDLLDTATA
KU576860_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPADFFPSIRDLLDTATA
KU576863_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPADFFPSIRDLLDTATA
KU576864_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPADFFPSIRDLLDTATA
KU576865_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPADFFPSIRDLLDTATA
KU667741_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPADFFPSIRDLLDTATA
KU668127_HBc_P-C          ------------MDIDHYKEFGASVELLS--FLPADFFPSIRDLLDTATA
MH724960_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPHDFFPSIRDLLDTASA
MH724969_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPHDFFPSIRDLLDTASA
JN688689_HBc_P-RF-DE      ------------MDIDPYKELGASVELLS--FLPSDFYPSVRDLLDTASA
GQ377604_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--FLPNDFFPSARDLLDTASA
JF754626_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPDDFFPSVRDLLDATSA
GU456637_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDAASA
AY371915_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB330367_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
AB113878_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB195930_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB195931_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB195932_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
KP659239_HBc_P-B          ------------MDIDPYKEFGATAELLS--FLPLDFFPSVRDLLDTAAA
KP659223_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPHDFYPSVRDLLDTATA
EU579441_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU487257_HBc_P-B          ------------MDIDPYKEFGASVPLLS--FLPSDFFPSIRDLLDTATA
DQ995803_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDSFPSIRDLLDTASA
KP857068_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU660230_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU660231_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU660232_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU660233_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU306681_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306679_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306680_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF461360_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY800389_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306677_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU306678_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU815574_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU815577_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023617_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023618_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ358145_HBc_P-B          ------------MDIDPYKEFGASVEVLS--FLPSDFFPSIRDLLDTASA
GQ358146_HBc_P-B          ------------MDIDPYKEFGASVEVLS--FLPSDFFPSIRDLLDTASA
GQ358147_HBc_P-B          ------------MDIDPYKEFGASVEVLS--FLPSDSFPSIRDLLDTASA
MG491126_HBc_P-D          ------------MDIDPYKEFGASLELLS--FLPTDFYPSVRDLLDTASA
AB274975_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPVDFYPSVRDLLDTASA
X85273_HBc_P-D            ------------MDIDPYKEFGASVELLS--FLPVDFFPSVRDLLDTASA
JF754612_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPAVRDLLDTATA
GU456684_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPHDFFPSVRDLLDTASA
EU726891_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN040773_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ329356_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
AY741798_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPAVRDLLDTASA
KU667905_HBc_P-B          ------------MDIDPYKEFGASVELLS--FSPSDFFPSTQDLLDTAPA
KP659234_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
GQ924648_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EF494382_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTANA
DQ463799_HBc_P-B          ------------MDIDPYKEFGASVNLLS--FLPADFFPSVRDLLDTASA
AY596111_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
AY167093_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
AB828708_HBc_P-B          ------------MDIDPYKEFGATTELLS--FLPIDFFPSVRDLLDTAAA
AB219427_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB073858_HBc_P-B          ------------MDIDPYKEFGATAELLS--FLPADFYPSVRDLLDTATA
AB073853_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
GQ477477_HBc_P-A          ------------MDIDPYKEFGASASLLS--FLPHDFFPSVRDLLDTATA
AB116076_HBc_P-A          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
AF324122_HBc_P-A          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
AB076679_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB302942_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB302943_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB302944_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB302945_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576108_HBc_P-B          ------------MDIDPYKQFGASVELLS--FLPADFFPSIRDLLDTASA
KU576109_HBc_P-B          ------------MDIDPYKQFGASVELLS--FLPADFFPSIRDLLDTASA
KU576112_HBc_P-B          ------------MDIDPYKQFGASVELLS--FLPADFFPSIRDLLDTASA
MG491155_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPAVRDLLDTASA
AB059659_HBc_P-H          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
AB194948_HBc_P-E          ------------MDIDPYKEFGASVDLLS--FLPADFFPSVRDLLDTASA
X85276_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFLSVRHLLDTAKA
KF471640_HBc_P-D          ------------MDIDPYKEFGASVNLLS--FLPADYFPSVRDLLDTASA
GU456678_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU456669_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456647_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
GU456643_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPHDFFPSVRDLLDTASA
GU456639_HBc_P-D          ------------MDLDPYKEFGASVELLS--FLPQDFYPSVRDLLDTATA
GQ922003_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPQDFFPSVRDLLDTAAA
EU787439_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ464172_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTALA
AY236164_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSEFYPSVRDLLDTASA
DQ336689_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ486022_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSEFYPSVRDLLDTASA
KY689469_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPNDFFPNIRDLLDTAAA
KY689516_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPNDFFPNIRDLLDTAAA
JQ801494_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTISA
GQ924656_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ924641_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPTDFYPSVRDLLDTASA
GQ924638_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924637_HBc_P-B          ------------MDIDIYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ924630_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPVDFYPSIRDLLDTASA
FJ899786_HBc_P-B          ------------MDIDTYKEFGASVELLP--FLPSDFFPSVRDLLDTASA
D50521_HBc_P-B            ------------MDIDPYKEFGASVELLS--FLPADFFPSVHDLLDTASA
D50522_HBc_P-B            ------------MDIDPYKEFGASVELLS--FLPADFFPSVHDLLDTASA
AY269102_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
AB073852_HBc_P-B          ------------MDIDPYKEFGATVELIS--FLPSDFFPSVRDLLDTATA
AB073849_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPQDFFPSIRDLLDTAAA
AB073825_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN664933_HBc_P-RF-DA      ------------MDIDPYKEFGATVELLS--FLPPDFFPSVRDLLDTASA
KP857066_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVKDLYDTALA
KM606647_HBc_P-A          ------------MDIDHYKEFGATVELLS--FLPLDFFPSARDLLETASA
JF439767_HBc_P-A          ------------MDIDPYKEFGATVELLS--VLPCDFFPSVPDLLHAAST
GQ477499_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPLDFYPSVRDLLDTASA
GQ477480_HBc_P-A          ------------MDIDPYKEFGASTELLS--FLPSDFFPNVRDLLDTASA
GQ477473_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPLDFFPSARDLLDTASA
AB116088_HBc_P-A          ------------MDIDLYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG571353_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
MG571376_HBc_P-B          ------------MDIDHYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
AF157021_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF157022_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HQ700579_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPGDFFPSIRDLLDTAAA
HQ700585_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPGDFFPSIRDLLDTAAA
MF772358_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPADFYPSVKDLLDSATA
KP856998_HBc_P-E          ------------MDIDPYKEFGATIELLS--FLPSDFYPSVRDLLDTASA
HM363607_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDIIDTASG
AB219533_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
MH724245_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPFDFFPSVRDLLDTASA
MG491159_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG491158_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPADFFPSVRDLLDTASA
KX276856_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040818_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
JN040797_HBc_P-D          ------------MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTASA
JF754625_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTAKA
EU726947_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040799_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF324111_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB270541_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
AB042285_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPTDFFPAVRDLLDTASA
KU576087_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JN792894_HBc_P-B          ------------MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTAAA
GQ924646_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ386658_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ993684_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
AB555498_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB073839_HBc_P-B          ------------MDIDTYKEFGASVDLLS--FLPSDFFPSIRDLLDTASA
KY353919_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTSSA
GU563547_HBc_P-A          ------------MDIDPYKEFGATTDLLS--FLPSDFFPSVRDLRDTTSA
FJ692595_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPNDFFPSVRDLLDTATA
AB453989_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB246317_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB116087_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB116082_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP659245_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPIDFYPSVRDLLDTAAA
MH932712_HBc_P-B          ------------MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTAAA
AB900107_HBc_P-B          ------------MDIDPYKEFGATSELLS--FLPSDFFPSVRDLLDTAAA
AB900098_HBc_P-B          ------------MDIDPYKEFGATXELXS--FLPSDFFPSVRDLLDTAAA
D23678_HBc_P-B            ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTAAA
AB010290_HBc_P-B          ------------MDIDPYKEFGASTELIS--FLPADFFPSVRDLLDTAAA
AB010291_HBc_P-B          ------------MDIDPYKEFGATTELIS--FLPADFFPSVRDLLDTAAA
HM363575_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTGSS
HM363576_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTGSS
MH725095_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLHFDFFPSVRHLLDTASA
GQ477455_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRHLLDTASA
FJ904397_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRHLLDTASA
MH724968_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF849716_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161794_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494811_HBc_P-E          ------------MDVDPYKEFGATVELLS--FLPSDFFPSVRGLLDTASA
MH724216_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRHLLDTASA
MH725069_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRHLLDTASA
MH725067_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSLRNLLDTASA
MH725066_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSLRNLLDTASA
KP671692_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707511_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRHLLDTASA
JN792903_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM422939_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRGLLDTASA
AY233292_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRGLLDTASA
AY233294_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRGLLDTASA
AY233296_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRGLLDTASA
KX827299_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRHLLDTASA
KX357624_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRHLLDTASA
GQ161837_HBc_P-RF-AE      ------------MDIDPYKEFGATVELLS--VLPFGFFPSVRDXLDTASX
X85302_HBc_P-D            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598661_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK598660_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725209_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRHLLDTASA
MF925390_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRALLDTASA
KU668445_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HQ700455_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRXLLDTASA
KX357634_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRALLDTASA
AB188245_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRALLDTASA
AM494812_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRGLLDTASA
JN664928_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRALLDTASA
JN664918_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRALLDTASA
EU414059_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU414139_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257149_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRXLLDTASA
KF584161_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVXBLLBTASA
KF584163_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVXBLLBTASA
KF584165_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVXBLLBTASA
KU736921_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736926_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161838_HBc_P-RF-AE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDXLDTASX
JF754616_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
GQ161812_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDSASA
AM494792_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB274980_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPADFXPSVKDLLDTASA
AM494691_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPNDFFPSVRDLLDTASA
JN664943_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
HM363570_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363569_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494797_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPAVRDLLDTASA
AM494796_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
AB274972_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363567_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363568_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363586_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363588_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363589_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363590_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363591_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363592_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161782_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161792_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494692_HBc_P-E          ------------MDIDPYKEFGASVDLLS--FLPSDFFPSVRDLLDTALA
AM494787_HBc_P-E          ------------MDIDPYKEFGASVDLLS--FLPSDFFPSVRDLLDTALA
HM363594_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRALLDTASA
HM363596_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRALLDTASA
KP288875_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
MF772360_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF849719_HBc_P-E          ------------MDIDPYKEFGATVEFLS--FLPSDFFPSVRDLLDTASA
AB106564_HBc_C-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ000009_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507841_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736892_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LT623842_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494795_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY739675_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVKDLLDTASA
EU239217_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161758_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVKDLLDTASA
GQ161766_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVKDLLDTASA
GQ161774_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVKDLLDTASA
GQ161778_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161790_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161810_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363584_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HQ700551_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM606738_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LT623848_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161803_HBc_P-E          ------------MDIDPYKEFGATEELLS--FLPSDFFPSVRDLLDTASA
MH580650_HBc_P-E          ------------MDIDPYKEFGATEELLS--FLPSDFFPSVRDLLDTASA
EU726931_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP090181_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724989_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB091255_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB091256_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB194947_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB201287_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB201288_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB201289_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB205129_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB205189_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB205191_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB205192_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB274969_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB274970_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB274971_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB274974_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB274978_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB915175_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494689_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494690_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494693_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494694_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494696_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494697_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494698_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494699_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494700_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494701_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494702_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494704_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494705_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494706_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494707_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494708_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494709_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494710_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494711_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494712_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494713_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494715_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494717_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494788_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494789_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494790_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494794_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494798_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494799_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494801_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494802_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494804_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494805_HBc_P-E          ------------MDIDPYKEFGAAVELLS--FLPSDFFPSVRDLLDTASA
AM494806_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AM494807_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY738144_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY738145_HBc_C-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY738146_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY738147_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY739674_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ060822_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ060823_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ060824_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ060825_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ060826_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ060827_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ060828_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ060829_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ060830_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU239218_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU239219_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU239221_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU239222_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU239224_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU239226_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU620071_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ349226_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ349237_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ349238_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ349239_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FN545822_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FN545841_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161759_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161760_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161761_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161763_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161764_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161765_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161769_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161770_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161771_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161772_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161775_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ161776_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161777_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161779_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161780_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161781_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161784_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161785_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161787_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161789_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161791_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161793_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161798_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161800_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161804_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161808_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161815_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161816_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161817_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161819_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161827_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161828_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161829_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161832_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363571_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM363572_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363573_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363574_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363577_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363579_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363580_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363581_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363582_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363583_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363585_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HQ700550_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HQ700552_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ000008_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF170742_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF849714_HBc_P-E          ------------MDIDPYKEFGATVELXS--FLPSDFFPSVRDLLDTASA
KF849715_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF849717_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF849721_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF849722_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF849723_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF849726_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF849727_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF922438_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF922439_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KT192626_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736891_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736893_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736894_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507842_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF772354_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LT623849_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPXDFFPSVRDLLDTASA
LT623850_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LT623846_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507847_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFHSVRDLLDTASA
MN507844_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFHSVRDLLDTASA
GQ161820_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFHSVRDLLDTASA
GQ161836_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFHSVRDLLDTASA
KU736910_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KX186584_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X75657_HBc_P-E            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507848_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507846_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507845_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507843_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK720632_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK720631_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK321264_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH918655_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725114_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725042_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725021_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725020_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580652_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580651_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580649_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580647_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580646_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580644_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580638_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580637_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580636_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580635_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580634_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580633_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580632_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580631_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580630_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580629_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580628_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580625_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580624_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580623_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580622_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580621_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580620_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580619_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580618_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580617_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580616_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580615_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH580614_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464855_HBc_P-E          --------------IDPYXXFGATVELLS--FLPSDFFPSVRDLLDTASA
MH464856_HBc_P-E          ------------MDIDPYKGFGATVELLS--FLPSDFFPSVRDLLDTASA
MF772362_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KY271392_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736908_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736907_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736906_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736905_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736904_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736903_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736902_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736901_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736900_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736899_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736898_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736897_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736895_HBc_P-E          ------------MDIDPYKEFGATVELLX--FLPSDFFPSVRDLLDTASA
KU736896_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161141_HBc_P-RF-AD      ------------MDIDPHKEIGATVELLS--FLPSDFFPSARDLLDTASA
KP857086_HBc_P-A          ------------MDIDPYKEFGASAQLLS--FLPADFFPSVRDLLDTASA
KP857075_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857060_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPPDFFPSARDLLDTAAA
KM606649_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FN545830_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ692599_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ349296_HBc_P-A          ------------MDIDPYKEFGATGELLS--FLPSDFFPSVRDLLNTASA
EU304331_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPXDFFPSVRDLLDTASA
AJ627227_HBc_P-A          ------------MDIDLYKEFGASVELLS--FLPXDFYPSVRDLLDTAXA
AB116092_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTVAA
AY230115_HBc_P-RF-DA      ------------MDIDTYKEFGATVELLS--FLPGDFFPSVRDLLDTASA
HM363599_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
GQ161823_HBc_P-E          ------------MDIDPYEEFGATVELLS--FLPSDFFPSVRDLLDTASA
FN594749_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAST
FN545842_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPGDFFPSVRDLLDTAQA
EU726953_HBc_P-E          ------------MDIDPYKEFGASVQLLS--FLPSDFFPSIRDLLDTAAA
AB219534_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
MK355501_HBc_P-D          ------------MDIDPYKEFGASVKLLS--FLPSDFFPSVRDLLDTASA
MH724248_HBc_P-D          ------------MDLDPYKEFGAXVELLS--FLPSDFFPSVRDLLDTASA
KP856996_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
KJ470895_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTATA
JN257172_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN257173_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456679_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPVDFYPSVRDLLDTASA
GU456668_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456656_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ477456_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPTVRDLLDTASA
FJ904445_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLXVDFFPSVRDLLDTASA
EU726945_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726897_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
EU726893_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726861_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ486023_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ464173_HBc_P-D          ------------MDIDPYKEFGASVELLS--FSPSDFYPSVQDLLDTALA
DQ304548_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ304549_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY371909_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
AY090452_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSARDLLDTAAA
AF419539_HBc_P-D          ------------MDVDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF419529_HBc_P-D          ------------MDLDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB674423_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPVDFFPSVRDLLDTASA
EU939542_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ899767_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU668027_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341476_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011474_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM011471_HBc_P-B          ------------MDIDPYKEFGASIELLS--FLPSDFFPSVRDLLDTASA
GQ924635_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
GQ924632_HBc_P-B          ------------MDIDPYKEFGASVQLLS--FLPSDFFPSIRDLLDTASA
GQ924626_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPDDFFPSVRDLLDTASA
GQ855526_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
FJ751766_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
EU939675_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAAA
EU939661_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPTDFFPSIRDLLDTATA
EU939638_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU882002_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ995802_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ463796_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
AF480351_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSIRDLLDTASA
AB287325_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
AB287323_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPTDFYPSVRDLLDTASA
FJ899785_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ899787_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JF439921_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDSFPSVRDLLDTASA
JF439929_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDSFPSVRDLLDTASA
AB453985_HBc_P-RF-AC      ------------MDIDPYKEFGASVELIS--FLPPDFFPSIRDLLDTASA
JX026879_HBc_P-B          ------------MDIDPYKEFGASVELLSFFFLPSDFFPSIRDLLDTASA
MF925362_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPHDFFPNVRDLLDTASA
KP857081_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPADFFPSVKDLLDTASA
KP857073_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPADFYPSVRDLLDTATA
KF922429_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTALA
KF922431_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTALA
JF439932_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ477469_HBc_P-A          ------------MDIDPYKEFGATAELLS--FLPLDFFPSVRDLLDTASA
AY034878_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AJ627228_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPHDFFPSVRDLLDTASA
AB453986_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF772361_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363602_HBc_P-E          ------------MVIDPYKEFGASVELLS--FLPSDFFPSVRDLIDTASA
FJ349240_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPPDFFPSVRDLLDTAKA
JF754619_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPPDFFPSVRDLLDTASA
JF754617_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAG
JF754607_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GU456683_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456659_HBc_P-D          ------------MDIDPYKEFGASVELLS--FSPHDFFPSVRDLLDTASA
GQ477458_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDYFPSVRDLLDTASA
FJ899792_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ349213_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDFFPSVRDLLDTASA
EU726875_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
EU594404_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFYPSVRDLLDTASA
AY603433_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB674428_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB674403_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU667546_HBc_P-B          ------------MDIDPHKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576950_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU576113_HBc_P-B          ------------MDIDPYKQFEASVELLS--FLPSDFFPSIRDLLDTASA
KP659252_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPNDFFPSARDLLDTASA
KP659240_HBc_P-B          ------------MDIDPYKEFGASXELLS--FLPADFFPSVRDLLDTAXA
GQ924628_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPTIRDLLDTASA
FJ386600_HBc_P-B          ------------MDIDTYKENGASVELLS--FLPSDFFPSIRDLLDTASA
EU939671_HBc_P-B          ------------MDIDPYKEFGASLELLS--FLPSDFFPSVRDLLDTASA
AY167102_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNVRDLLDTASA
AY167098_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRELLDTASA
AB976562_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPAVRDLLDTASA
AB900112_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPQDFYPSVRDLLDTASA
AB287321_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFYPSVRDLLDTAAA
AB073854_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB023682_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTISA
AB023667_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
FJ692593_HBc_P-A          ------------MDIDLYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491174_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTARA
FJ349219_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491152_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB362933_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFYPSVRDLLDTAAA
AB900097_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTAAA
MH464838_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVHDLLDTAKA
KY353918_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KX357649_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPRDFYPSVRDLIDTASA
KR905427_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857085_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPIDFFPSVRDLLDTASA
KP857078_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPADFFPSTKDLLDTASA
KP857064_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
KF922437_HBc_P-A          ------------MDIDPYKEFGSTVELLS--FLPSDFFPSVRDLLDTASA
KF922430_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTALA
JF439926_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ692588_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ692586_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPADFFPSARDLLDTASA
EU366129_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
AJ627226_HBc_P-A          ------------MDIDPYKEFGATAELLS--FLPPDFFPSARDLLDTASA
AF537372_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB116086_HBc_P-A          ------------MDIDPYKEFGATADLLS--FLPSDFFPSVQDLLDTASA
FJ904399_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDVLDTASA
AB900111_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFYPSVRDLLDTAAA
KX357627_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KM577666_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
FR714496_HBc_P-RF-CB      ------------MDIDPYKEFGASVELLS--ILPSDFFPSTRDLLDTASA
FJ904428_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPQDFFPSVRDLLDTASA
FJ904405_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPQDFYPSVRDLLDTASA
FJ882613_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU833891_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFSPSVRDLLDTASA
FJ657525_HBc_P-F          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
MN507840_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPHDFFPSVRDLLDTASA
MH580626_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363605_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363603_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAQA
GQ161824_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ161814_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFHSVRDLLDTASA
GQ161783_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FN594753_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB205188_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724229_HBc_P-D          ------------MDIDPYKEFGAXVELLS--FLPSDFFPSVRDLLDTASA
KP857000_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
JN642149_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF754603_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPQDFFPSVRDLLDTASA
HQ700458_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
HQ236015_HBc_P-D          ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GU456675_HBc_P-D          ------------MDIDPYKEFGASIELLS--FLPSDFFPSVRDLLDTAAA
GU456673_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFYPSVRDLLDTASA
GU456654_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPAVRDLLDTASA
GU456642_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPNDFFPSLRDLLDTAAA
GU456636_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ904419_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726881_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
DQ399006_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ336683_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF419521_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB674431_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KU668059_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP659253_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
JQ027315_HBc_P-B          ------------MDIDLYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM011470_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU815578_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386615_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU919172_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ993687_HBc_P-B          ------------MDIDPYKEFGSSAELLS--FLPSDFFPSIRDLLDTASA
DQ463794_HBc_P-B          ------------MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTAAA
AY167101_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB900105_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTAAA
AB900104_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
AB073835_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
AB073823_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB014366_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
MG491186_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG491173_HBc_P-D          ------------MDIDPYKEFGASVQLLS--FLPTDFFPSVRDLLDTASA
GU456676_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857038_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KT151612_HBc_P-A          ------------MDIDPYKEFGATSELLS--FLPSDFFPSVRDLLDTASA
KT151617_HBc_P-A          ------------MDIDPYKEFGATSELLS--FLPSDFFPSVRDLLDTASA
KM606670_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
HQ700492_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPHDFYPSVRDLLDTAAA
EU726853_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MG491177_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FN545832_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
FN545839_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPXDFFPSVRDLLDTASA
MF772345_HBc_P-A          ------------MDIDPYKEFGATVDLLS--FLPSDFFPSIRDLLDTASA
KX357644_HBc_P-A          ------------MDIDPYKEFGATTELLS--FLPSDFFPSVRDLLDTASA
GQ477501_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPHDFFPSVRDLLDTASA
GQ477500_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVKDLLDTASA
GQ477466_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FN545829_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSARDLLDTASA
FJ692587_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPNDFFPSVRDLLDTAAA
FJ692567_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF419536_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPHDFFPSVRDLLDTVSA
AF324072_HBc_P-A          ------------MDIDPYKEFGATVELLW--FLPSDFFPSVRDLLDTASA
AB453983_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB453982_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB362931_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB194951_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB116091_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
AB116089_HBc_P-A          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
AB116081_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB116078_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB116085_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB205118_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB480036_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB480040_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB076678_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB116077_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB116079_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB116080_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB116090_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB116094_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB126580_HBc_P-A          ------------MDIDPHKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB241114_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB241115_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB246335_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB246337_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB246338_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB300366_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB300367_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB453979_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB453980_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB453981_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB453984_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB480038_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB480039_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB480041_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB549213_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FN594769_HBc_P-RF-DE      ------------MDIDPYKEFGAXVXLLS--FLPSDFFPSVRDLLDTASA
FJ882617_HBc_P-RF-GC      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
LT623847_HBc_P-E          ------------MDIDPYKEFGATVQLLS--FLPPDFFPSVRDLLDTASA
HM363608_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM363595_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLIDTASA
GQ161811_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
FN594765_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVKDLLDTASA
AF350176_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724962_HBc_P-D          ------------MDIDPYKEFGASVQLLS--FLPSDFFPSARDLLDTASA
KP857117_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857041_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
KP857034_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KF584078_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLGTASA
KC875330_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
KC875329_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFLSVRDLLDTATA
KX196235_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFLSVRDLLDTATA
KC875312_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KC875305_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
JQ687530_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642163_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JN257165_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN257166_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN132132_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN132128_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN132127_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040814_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTATA
JN040772_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF754634_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFYPSVRDLLDTASA
JF754606_HBc_P-D          ------------MDIDPYKEFGATSELLS--FLPSDFFPSVRDLLDTASA
JF754600_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JF439704_HBc_P-D          ------------MDIDPYKEFGAIVELLS--FLPSDFFPSVRDLLDTASA
JF439705_HBc_P-D          ------------MDIDPYKEFGAIVELLS--FLPSDFFPSVRDLLDTASA
HQ700481_HBc_P-D          ------------MDIDPYKEYGATVELLS--FLPSDFFPSVRDLLDTASA
HQ700478_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HQ700553_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HQ700472_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HQ641710_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
HM042266_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GU456681_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAPA
GU456672_HBc_P-D          ------------MDIDPYKEFGATTELLS--FLPMDFFPSVRDLLDTASA
GU456651_HBc_P-D          ------------MDIDPYKEFGASIELLS--FLPSDFYPSVRDLLDTASA
GU456638_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
GQ924652_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ904446_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
FJ904395_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
FJ349230_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
FJ349211_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ349208_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
EU726975_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
EU726970_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
EU726871_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726849_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726847_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU155893_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
DQ486021_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ336690_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ336686_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
AY741797_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY603439_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY371916_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY371913_HBc_P-D          ------------MDIDPYKEFGATVELVS--FLPADFFPSVRDLLDTASA
AF419532_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF419522_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTVSA
AF419512_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF121239_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB210820_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB119251_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPQDFFPSVRDLLDTASA
AB109479_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ801523_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSLLDPLYTASA
KU668216_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
KU667531_HBc_P-B          ------------MDIDTYKEFVASVELLS--FLPSDFYPNVRDLLDTASA
KU576648_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP659254_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
KP659251_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
KP406169_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406174_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406165_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
KP406167_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
KM526756_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JX504533_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ386660_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ386608_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939667_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EF134945_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ463791_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF480337_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSVRDLLDTASA
AB365445_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB300370_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPQDFFPSVRDLLDTAAA
AB287316_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB246343_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB073857_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
MG491183_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU667778_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFLPSVRDLLDTASA
KF849725_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FN594752_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
LT623844_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161768_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MF488705_HBc_P-RF-AD      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664946_HBc_P-RF-DA      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK512464_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF772348_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KY353915_HBc_P-A          ------------MDIDLYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857072_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSARDLLDTASA
KP857059_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439941_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439933_HBc_P-A          ------------MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTASA
GQ477502_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPADFFPNVRDLLDTASA
GQ477478_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPTDYYPSVRDLLDTASA
FN545828_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ692576_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
FJ692555_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPHDFFPSVRDLLDTASX
AB937797_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVKDLLDTASA
AB222707_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB116084_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB064314_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ995805_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDPLDTASA
JN040770_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
EU726910_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725123_HBc_P-D          ------------KGIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642150_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTATA
EU726859_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
EU726954_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
FJ904402_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
JN257159_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPXDFFPSVRDLLDTASA
KC875292_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ904442_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ882611_HBc_P-RF-GC      ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
DQ464167_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
X85274_HBc_P-E            ------------MDIDPYKEFGASVELLS--FLPNDFYPSVRDLLDTASA
GQ161807_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ161797_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB274984_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPADFYPSVKDLLDTASA
X85277_HBc_P-D            ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MK541688_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725189_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
MH724978_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPQDFFPAVRDLLDTASA
MH724242_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSLRDLLDTASA
MH724224_HBc_P-D          ------------MDIYPYKEFGATGELLS--FLPSDFFPSVRDLLDTASA
KX357639_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPPDFFPSIRDLLDTASA
KP857050_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857025_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ647352_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF471658_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN792904_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN688711_HBc_P-D          ------------MDIDPYKEFGATLELLS--FLPSDFXPSVRDLLDTASA
JN642156_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
JN642153_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642135_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
JN257170_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDFFPSVRDLLDTASA
JN040802_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN040792_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF754630_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF754627_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JF754623_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF754599_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF754595_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
GU456667_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDFFPSVRDLLDTASA
GU456652_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ904427_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ349235_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ349217_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU939681_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU787438_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726950_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPQDFFPSVRDLLDTASA
EU726906_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726856_HBc_P-D          ------------MDIHPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ336681_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AY796031_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDNASA
AJ344116_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF419530_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
AB270549_HBc_P-D          ------------MDIDSYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB222710_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB109478_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KR014041_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIQDLLDTASA
FJ023625_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU964142_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU964141_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU964140_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU964139_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU964138_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU668335_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAPA
KU667996_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667955_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667858_HBc_P-B          ------------MDIDPYKESGAPVELLS--FLPSDFSPSIRDLLDTASA
KU667840_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667739_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667555_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667508_HBc_P-B          ------------MDIDPYKEFEASVELLS--FLPSDFFPNIRDLLDTASA
KU667445_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576654_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KJ173368_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
HM011504_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU815712_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU815587_HBc_P-B          ------------MDIDPYEEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ899784_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ562296_HBc_P-B          ------------MDIDPYKEFGASXELLS--FLPSDFFPSXRDLLDTASA
FJ562254_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562236_HBc_P-B          ------------MDIDPYKEFGASTELLS--FLPSDFFPSIRDLLDTASA
FJ562234_HBc_P-B          ------------MDIDAYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386681_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ032353_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023633_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023631_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023629_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023620_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023608_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939673_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU939672_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU919171_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU796071_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU522066_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU439020_HBc_P-B          ------------MDIDPYKEFGASVEVLS--FLPSDFFPSIRDLLDTASA
D23679_HBc_P-B            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AM888201_HBc_P-B          ------------MDIDPYKEFGPSVELLS--FLPSDFFPSIRDLLDTASA
AJ627225_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AF480347_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AF335751_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF282917_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPTDFFPSIRDLLDTASA
AF157020_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF121250_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB287320_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
AB246340_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
AB205120_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB073845_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB073838_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB023677_HBc_P-B          ------------MDIDPYKEFGASVELLS--FWPSDFFPSIRDLLDTASA
KY353917_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857092_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF214666_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MG491191_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257176_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPXDFFPSVRDLLDTASA
JN257177_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPXDFFPSVRDLLDTASA
MK512475_HBc_P-A          ------------MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTASA
MH464825_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPPVRDLLGTAAA
KY353916_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KY353909_HBc_P-A          ------------MDIDPYKEFGATGELLS--FLPSDFFPSVRDLLDTASA
KP857089_HBc_P-A          ------------MDIDPYKEFGATTELLS--FLPSDFFPNIRDLLDTASA
KP857083_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857065_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFYPSVRDLLDTASA
KP857061_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPHDFFPSVRDLLDTASA
KM606688_HBc_P-A          ------------MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTASA
KM606671_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPHDFFPSVRDLLDTASA
JQ707598_HBc_P-A          ------------MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTASA
JQ707582_HBc_P-A          ------------MDIDPYKEFGATAELLS--FLPSDFFPSVRDLLDTASA
GQ477498_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ477476_HBc_P-A          ------------MDIDPYKEFGATAELLS--FLPTDFFPSVRDLLDTASA
GQ477475_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ692611_HBc_P-A          ------------MDIDTYKEFGASVELLS--FLPADFFPSVRDLLDTASA
FJ692597_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
FJ692561_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPXDFFPSVRDLLDTASA
FJ692559_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB194952_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTSAA
HM363612_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTSAA
HM363613_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTSAA
AB194950_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB014370_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY371911_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPYDFFPSVRDLLDTASA
FJ868011_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPYDFFPSVRDLLDTASA
KM577667_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPADFFPSVKDLLDTASA
KJ647356_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPQDFFPSVRDLLDTASA
JN642127_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161767_HBc_P-RF-AE      ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ904407_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB674434_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
KM606739_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
GQ161796_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161757_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
FN594756_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AM494695_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF350211_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
X85269_HBc_P-D            ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
X85254_HBc_P-D            ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725144_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
MH725054_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPHDFFPSARDLLDTASA
MH724236_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724225_HBc_P-D          ------------MDIDPYKEFGAXGELLS--FLPSDFFPSVRDLLDTASA
KP857048_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857042_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857022_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857021_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857019_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPTVRDLLDTASA
KP857016_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KM606664_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KJ470885_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTAAA
JQ707509_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN687947_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642146_HBc_P-D          ------------MDIDLYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN257190_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN132131_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040829_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040821_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040810_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN040769_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRALLDTASA
JN040755_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
JF754629_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JF754621_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GU456663_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456645_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ349220_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726977_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726922_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726904_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ464182_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY371912_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY371906_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY371904_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF419524_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB674413_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AB674408_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
AB355456_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB355452_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KJ410514_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPNVRDLLDTASA
FJ023677_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KU667879_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU667597_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASA
KP406170_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KP406168_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTRDLLDTASA
KM526757_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341475_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
JQ341462_HBc_P-B          ------------MDIDPYKEFXASVELLS--FLPSDFFPSIRDLLDTASA
GU815639_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ924660_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924639_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ377622_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ787477_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ562219_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
FJ386654_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023630_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939670_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPSIRDLLDTASA
EU330996_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU158262_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EF473974_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLHTASA
DQ995801_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ463788_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
DQ144602_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144598_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
DQ144561_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
D00329_HBc_P-B            ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTVSA
AY596104_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASD
AY269110_HBc_P-B          ------------MDIDPYKEFGASAELLS--FLPSDFFPNIRDLLDTASA
AF480361_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF480343_HBc_P-B          ------------MDIDLYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AF480341_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDFIDTASA
AF121251_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB287326_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB073856_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB073851_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFYPSVRDLLDTAAA
AB073844_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB073836_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU185765_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
JF439700_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439701_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ751769_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ867998_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867957_HBc_P-D          ------------MDIDRYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867963_HBc_P-D          ------------MDIDRYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867970_HBc_P-D          ------------MDIDRYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867979_HBc_P-D          ------------MDIDRYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867983_HBc_P-D          ------------MDIDRYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ868005_HBc_P-D          ------------MDIDRYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ868009_HBc_P-D          ------------MDIDRYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB274973_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVKDLLDTASA
AM494714_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ161826_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVKDLLYTASA
JF440017_HBc_P-RF-DA      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161140_HBc_P-RF-AD      ------------MDIDPHKEFGATVELLS--FLPSDFFPSARDLLDTASA
KY353926_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857080_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857077_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPIDFYPSVRDLIETASA
KP857074_HBc_P-A          ------------MDIDPYKEFGATAELLS--FLPNDFYPSVKDLLDTASA
KP857067_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVKDLLDTASA
KF922436_HBc_P-A          ------------MDIDPYKEFGSTVELLS--FLPSDFFPSVRDLLDTASA
KF922435_HBc_P-A          ------------MDIDPYKEFGSTVELLS--FLPSDFFPSVRDLLDTASA
JF439928_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439908_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439830_HBc_P-A          ------------MDVDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ477491_HBc_P-A          ------------MDIDPYKEFGASVDLLS--FLPSDFFPSVRDLLDTASA
FN545840_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ692607_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
FJ692566_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AY373429_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB453988_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB246336_HBc_P-A          ------------MDIDPYKEFGATGELLS--FLPSDFFPSVRDLLDTASA
AB116093_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439911_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439912_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439913_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439914_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439915_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439916_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439917_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439918_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439919_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439920_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439922_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439923_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439924_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439925_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439927_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF214656_HBc_P-RF-AC      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN664929_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
JN642152_HBc_P-RF-DE      ------------MDIDPYKEFGASVELLS--FLPFDFFPSVRDLLDTASA
HQ700494_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB674432_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB033558_HBc_P-RF-DE      ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
KF849728_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HM363566_HBc_P-E          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ161835_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161762_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFHSVRDLLDTASA
GQ161755_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350117_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF350101_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MN507836_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK618425_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTTSA
MK618424_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTTSA
MK618423_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTTSA
MK598676_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPHDFFPSVRDLLDTASA
MH725134_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
MH725101_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725090_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725033_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH725031_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724244_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MH724241_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP857114_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857045_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857043_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPAVRDLLDTASA
KP671700_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF471644_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF170739_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF018185_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
KC875302_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC875287_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC875284_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KC012652_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JX470760_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JQ707497_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDRLDTTSA
JN688713_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPXDFFPXVRDLLDTASA
JN688685_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642144_HBc_P-D          ------------MDIDPYKEFGATVQLLS--FLPSDFFPSVRDLLDTASA
JN642143_HBc_P-D          ------------MDLDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN642130_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257161_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN257160_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN132130_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040824_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040817_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040808_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040793_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040791_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JN040782_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
JN040758_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTALA
JF754635_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPGDFFPSVRDLLDTASA
JF754598_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPHDFFPSVRDLLDTASA
JF754597_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
HQ700474_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GU456677_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GU456661_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPAVRDLLDTASA
GU456640_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
GQ477452_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ205385_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ183475_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU939680_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726963_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726960_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726937_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726925_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU726892_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726886_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU726885_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTATA
EU726880_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
EU726855_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
EU594422_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRALLDTASA
EU594408_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EU185779_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EF103281_HBc_P-D          ------------MDIDRYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
EF103279_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ464178_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ464177_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ464176_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLHTASA
DQ464175_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ464174_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ336692_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFLPSVRDLLDTASA
DQ336691_HBc_P-D          ------------MDIDPYKEFGASVGLLS--FLPSDFYPSVRDLLDTASA
DQ336688_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFLPSVRDLLDTASA
DQ336687_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ336685_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ336679_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ336678_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ336677_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ336676_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ336675_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ329357_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
DQ315778_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSFRDLLDTASA
DQ304547_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
DQ178012_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVQDLLDTASA
AY945307_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY796030_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY741796_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY741795_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY603445_HBc_P-D          ------------MDIDPYKEFGATVELLS--FSPSDFFPSVRDLLDTASA
AY371919_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY371910_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPADFFPSVRDLLDTASA
AY236160_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
AY230114_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161158_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161157_HBc_P-D          ------------MDTDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161154_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161153_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161152_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161151_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY161150_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AJ627224_HBc_P-D          ------------MDIDPYKEFGASVELLS--FLPSDFFPNVRDLLDTASA
AF324110_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF121242_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AF043593_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB270540_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB270539_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB267090_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSLRDLLDTASA
AB119256_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB119254_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB109477_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AB090268_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPTDFFPSVRDLLDTASA
KX276849_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KF214670_HBc_P-C          ------------MDIDPYKEFGATVELLS--FLPSDFFPNVRDLLDTASA
FJ023589_HBc_P-C          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB900099_HBc_P-C          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
KX276821_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFXPSIRDLLDTASA
KX276808_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTAXA
KU668336_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU667972_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASA
KU667578_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASA
KU667570_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASA
KU667422_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPNIRDLLDTASA
KU576393_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLGTASA
KU576392_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSTQDLLDTASA
KU576322_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576189_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KU576090_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTATA
KP659220_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP406172_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KP406171_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC774406_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
KC492739_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU815710_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU815707_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU815706_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU815701_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GU815699_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
GQ924647_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPAIRDLLDTASA
GQ924605_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ386636_HBc_P-B          ------------MDIDXYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023637_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
FJ023606_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939637_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939634_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939633_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU939559_HBc_P-B          ------------MDIDTYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU882003_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EU660224_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
EF134946_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AY517488_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AJ298864_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
AF480356_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSVRDLLDTASA
AF480353_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF480344_HBc_P-B          ------------MDIDPYKEFGASGELLS--FLPSDFFPSVRDLLDTASA
AF335748_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPADFFPSIRDLLDTASA
AF324082_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AF233235_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB713532_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSIRDLLDTASA
AB219426_HBc_P-B          ------------MDIDPYKEFGASMELLS--FLPSDFFPSIRDLLDTASA
AB073850_HBc_P-B          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTAAA
AB073843_HBc_P-B          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTAAA
AB023663_HBc_P-B          ------------MDIDPYKEFGASVELLS--YLTSDFFPSIRDLLDTASA
FJ867986_HBc_P-A          ------------MDIDRYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
AY903452_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867953_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867964_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867965_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867966_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867968_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867972_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867973_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867974_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867975_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867977_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867981_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867982_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867984_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867996_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ867999_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ868004_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ868010_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ868012_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ868013_HBc_P-D          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161756_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KU736911_HBc_P-E          ------------MDIDPYKEFGATVZLLS--FLPSDFFPSVRDLLDTASA
FN594750_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ161795_HBc_P-E          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MK512458_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF925373_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF772347_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
MF772346_HBc_P-A          ------------MDIDPYKEFGATTELLS--FLPSDFFPSVRDLLDTASA
KX276769_HBc_P-A          ------------MDIDPYKEFGASAELLS--FLPSDFFPSVRDLLDTASA
KT749822_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPHDFFPSVRDLLDTASA
KR905429_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KP857087_HBc_P-A          ------------MDIDLYKEFGATVELLS--FLPHDFYPSVRDLLDTASA
KP168428_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPSDFFPSVRDLLDTASA
KM606693_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KM606658_HBc_P-A          ------------MDIDHYKEFGASVELLS--FLPSDFYPSVRDLLDTASA
KF922421_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF922418_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
KF798271_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439942_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439940_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439939_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439938_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439937_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439936_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439935_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439934_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439931_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439930_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439909_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439896_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439748_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439742_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439738_HBc_P-A          ------------MDIDPYREFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439737_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439733_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439732_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439731_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439728_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439725_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439722_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
JF439721_HBc_P-A          ------------MDIDPYKEFGATVELPS--FLPSDFFPSVRDLLDTASA
JF439720_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GU563551_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
GQ477494_HBc_P-A          ------------MDIDPYKEFGASVELLS--FLPTDFFPSVRDLLDTASA
GQ477488_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPADFFPSVRDLLDTASA
GQ477487_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPHDFYPSVRDLLDTASA
GQ477472_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPTDFFPGVRDLLDTASA
GQ477464_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPLDFFPSVRDLLDTASA
GQ477463_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FM199977_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ692613_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSIRDLLDTASA
FJ692608_HBc_P-A          ------------MDIDPYKEFGATVELLS--FLPSDFFPSVRDLLDTASA
FJ692606_HBc_P-A       &