HBVdb

Dataset for protein HBSP of genotype all

[Download (right click)] [Sequences] [Repertoires]

11594 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


FJ349213_HBSP_P-D          MPLSYQHFRRLVLLDN--DTGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP718102_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELXRLADADLNRRVAEDLNLGNLND
EU660224_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNQ
AB014370_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB064314_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGSLEEELPRLADADLNRRVAEDLNLGNLND
AB076678_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116076_HBSP_P-A          MPLSYQHFRKLLLLDAGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB116078_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB116081_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLND
AB116082_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116083_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116084_HBSP_P-A          MPLSYQHFRKLLLLDDATEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116086_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPND
AB116087_HBSP_P-A          MPLSYQHFRKLLLLDDESEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116088_HBSP_P-A          MPLSYQHFRKLLLLDNEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116089_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116090_HBSP_P-A          MPLSYPHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116091_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116092_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116093_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB116094_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB126580_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB194950_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB194951_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB194952_HBSP_P-A          MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB205118_HBSP_P-A          MPLSYQHFRKQLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB241114_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB241115_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB246317_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB246336_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB362931_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453982_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453989_HBSP_P-A          MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB697493_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697506_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697511_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB937795_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB937798_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF043560_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF090838_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNPND
AF090839_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF090841_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF143298_HBSP_P-A          MPLSYQQFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF143302_HBSP_P-A          MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLND
AF297622_HBSP_P-A          MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF297623_HBSP_P-A          MPLSYQHFRKLLLLDAETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF537371_HBSP_P-A          MPLSYQRFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLDD
AF537372_HBSP_P-A          MPLSYQHFRKLLLLDVGAEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ309369_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ309370_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEEPPRLADADLNRRVAEDLNLGNLND
AJ344115_HBSP_P-A          MPLSYHHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ627226_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ627227_HBSP_P-A          MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ627228_HBSP_P-A          MPLSYQFFRKLLLLDDETEVGPLEEELPRLADADLNRRVAEDLNLGNLND
AM180624_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGXLND
AM184125_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AM282986_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNE
AM410963_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AM494718_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY034878_HBSP_P-A          MPLSYQHFRKLLLLDNGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY152726_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY161138_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY161142_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEDSLRLADEDLNRRVAEDLNLGNLND
AY233274_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAGDLNLGNLND
AY233275_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233276_HBSP_P-A          MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233279_HBSP_P-A          MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233280_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY233281_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233284_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233285_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233286_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY233287_HBSP_P-A          MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233288_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233289_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY373428_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY373429_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLVEELPRLADEDLNRRVAEDLNLGNLND
AY738139_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY903452_HBSP_P-A          MPLSYQHFRKLLLLD--AEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934763_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY934764_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934765_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934767_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934768_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ020002_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ020003_HBSP_P-A          MPLSYQHFRKLLLLDDVTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ298161_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPND
DQ298162_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADFNRRVTEDLDLGDPND
DQ298163_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPND
DQ298164_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDPND
DQ298165_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPIEEELPRLADADPNRRVAEDLNLGDPND
DQ315784_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ315785_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ315786_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ788725_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEELNLGNLND
EF103278_HBSP_P-A          MPLSYQHFRRLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU185787_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU304331_HBSP_P-A          MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADZDLNRRVAEDLNLGNLND
EU366129_HBSP_P-A          MPLSYQHFRKLLLLDVESEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU414132_HBSP_P-A          MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADADLNRRVAEDLNLGNXND
EU594386_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594388_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU859912_HBSP_P-A          MPLSYQHFRKLLLVDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859934_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859944_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU859952_HBSP_P-A          MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAKDLNLGNLNE
EU859955_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FJ349296_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692554_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLND
FJ692558_HBSP_P-A          MPLSYQHFRKLLLLDDETVAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692559_HBSP_P-A          MPLSYQXFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGXLND
FJ692561_HBSP_P-A          MPLSYQHFRXLLLLDVEPEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692564_HBSP_P-A          MPLSYQHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692565_HBSP_P-A          MPLSYQHFRKLLLLDDEXEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692567_HBSP_P-A          MPLSYQHFRRLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNXND
FJ692570_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692571_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRHVAEDLNLGNLND
FJ692572_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692575_HBSP_P-A          MPLSYQHFRKLLLLDDETEXGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692576_HBSP_P-A          MPLSYQHFRKLLLLEDDPEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692577_HBSP_P-A          MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692578_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692586_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEXLNRRVAEDLNLGNLND
FJ692587_HBSP_P-A          MPLSYQHFRKLLLLDDATEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692590_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692592_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692593_HBSP_P-A          MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692595_HBSP_P-A          MPLSYQHFRKLLLLDNDTEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692596_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692597_HBSP_P-A          MPLSYQHFRKLLLLDXXSEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692599_HBSP_P-A          MPLSYRHFLKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692600_HBSP_P-A          MPLSYQHFRKLLLLDDXTEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692603_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEELNHRVAEDLNLGNLND
FJ692605_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDVLPRLADEDLNHRVAEDLNLGNLND
FJ692606_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692607_HBSP_P-A          MPLSYQHFRKLLLLDEETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692608_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692609_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDVLPRLADEDLNHRVAEDLNLGNLND
FJ692610_HBSP_P-A          MPLSYQHFRKLLLLDDEXEAGPLEDVLPRLADEDLNHRVAEDLNLGNLND
FJ692611_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEGLNRRVAEDLNLGNLND
FJ692612_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692613_HBSP_P-A          MPLSYQHFRRLLLLDDEIEAGPLEDELPRLADEDLNHRVAEDLNLGNLTD
FJ904411_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FJ904434_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FM199975_HBSP_P-A          MPLSXQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199976_HBSP_P-A          MPLSYQHFRKLLLLDDETEXGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199977_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNRRVAEDLNLGNLND
FM199980_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199981_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRXVAEDLNLGNLND
FN545825_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEXLNLGNLND
FN545826_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545828_HBSP_P-A          MPLSYQHFRKLLLLDEGTQAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545829_HBSP_P-A          MPLSYQHFRKLLLLDEGTELGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545830_HBSP_P-A          MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545831_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLND
FN545833_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545834_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545835_HBSP_P-A          MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545836_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLND
FN545837_HBSP_P-A          MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545838_HBSP_P-A          MPLSYQHFRKLLLLDYGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FN545839_HBSP_P-A          MPLSYQHFRKLLLLXVGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FN545840_HBSP_P-A          MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ331046_HBSP_P-A          MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNPNE
GQ331047_HBSP_P-A          MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAKDLNLGNPNE
GQ477462_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLHLGDLND
GQ477463_HBSP_P-A          MPLSYQLFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477465_HBSP_P-A          MPLSYQHFRKLLFVDDGSEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477468_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477469_HBSP_P-A          MPLSYQSFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477472_HBSP_P-A          MPLSYQYFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477473_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477475_HBSP_P-A          MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477476_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477477_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNE
GQ477478_HBSP_P-A          MPLSYQHFRKILLLDHGAEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477480_HBSP_P-A          MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477484_HBSP_P-A          MPLSYQHFRKLLLLDDSTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477488_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477491_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477493_HBSP_P-A          MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477494_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477495_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477496_HBSP_P-A          MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477497_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLTD
GQ477498_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477499_HBSP_P-A          MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADANLNRRVAEDLNLGNLND
GQ477501_HBSP_P-A          MPLSYQCFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477502_HBSP_P-A          MPLSYQHFRKLLLLDHETEAGPLEEELPRLADADLNRRVAEDLNLGDLND
GQ477504_HBSP_P-A          MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563547_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
GU563551_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
HE576988_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
HE576989_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
HM011485_HBSP_P-A          MPLSYQHFRKLLLLDDETKAGPLEEELPRLADEDLNRRVAEDLNLGNLND
HM363612_HBSP_P-A          MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
HM535205_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439720_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439721_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439725_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439739_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439747_HBSP_P-A          MPLSYRHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439748_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDPNLGNLND
JF439752_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439767_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439819_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439820_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439821_HBSP_P-A          MPLSYQHFRKLLLLDDGTDAGSLKEELPRLADADLNRRVAEDLXLGNLND
JF439822_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLND
JF439823_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439824_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439832_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439836_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439838_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439842_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439843_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439846_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439849_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439854_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439864_HBSP_P-A          MPLSYQHSRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439865_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439868_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439886_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439887_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439889_HBSP_P-A          MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439911_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439914_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439917_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439919_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439923_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439925_HBSP_P-A          MLLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439926_HBSP_P-A          MSLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439928_HBSP_P-A          MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439929_HBSP_P-A          MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439931_HBSP_P-A          MPLSYQHFRNVLLLDEGTRAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439932_HBSP_P-A          MPLSYQHFRNVLLLDEGTESGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439937_HBSP_P-A          MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439938_HBSP_P-A          MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439942_HBSP_P-A          MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439943_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439951_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439954_HBSP_P-A          MPLSYQHFRILLLLDDETEAGPLEEELPRLADADLNRRVAEDLDLGNLND
JF439963_HBSP_P-A          MPLSYQHFRKLLLLYDETEAGPLEEELPRLADADLNRRVAEDLNLGNFND
JF439965_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439966_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADPNRRVAEDLNLGNLND
JF439967_HBSP_P-A          MPLSYQHFRKLLLLDDETEARPLQQELPRLADADLNRRVAEDLNLGNLND
JF439969_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLHD
JF439970_HBSP_P-A          MPLSYQHFRKLLLLGDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439971_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEGLPRLADADLNRRVAEDLNLGNLND
JF439975_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELSRLADADLNRRVAEDLNLGNLND
JF439979_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439982_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNPND
JF439984_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439987_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF440018_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JN182318_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182334_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAVDLNLGNLND
JQ023660_HBSP_P-A          RPLSYQHFRKLLLLDDETEASPLEEELPRLADEDLNRRVAEDLNLGNLND
JQ023661_HBSP_P-A          RPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAKDLNLGNLND
JQ023662_HBSP_P-A          RPLSYQHFRKLLLFDDETEAGPLKEELPRLADENLNRRVAKDLNLGNLND
JQ023663_HBSP_P-A          RPLSYQHFRKLLLFDDETEAGPLKEELPRLANENLNRRVAKNLNLGNLND
JQ707299_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707300_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRIAEDLNLGNLND
JQ707305_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707306_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707308_HBSP_P-A          MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707324_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707325_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707327_HBSP_P-A          MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707329_HBSP_P-A          MPLSYQNFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707339_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707345_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707346_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707347_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707368_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGSLEEELPRLADADLNRRVAEDLNLGNLND
JQ707395_HBSP_P-A          MPLSYQHFRKLLLLDDGTAAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707397_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707398_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707401_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707407_HBSP_P-A          MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707419_HBSP_P-A          MPLSYQHFRKLLLLDDGTGAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707532_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707536_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707537_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707549_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707550_HBSP_P-A          MPLSYQHFRKLLLLDDGIEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707575_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707577_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707581_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707582_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707589_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707599_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707635_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRHADADLNRRVAEDLNLGNLND
JQ707674_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX096952_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KC875259_HBSP_P-A          MPLSYQHFRKLVLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875260_HBSP_P-A          MPLSYQHFRRLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF214659_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214660_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214662_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214666_HBSP_P-A          MPLSYQHFRKLLLLDD--EVGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF779210_HBSP_P-A          MPLSYQHFRSLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779213_HBSP_P-A          MPLSYQHFRKLLLIDDGTEAGPLEEELPRLADADLNRRVAEDLHLRNLND
KF779221_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADSDRRVAEDLNLGNLND
KF779232_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779239_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAYADLNRRVAEDLNLGNLND
KF779261_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779264_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779265_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAYLNRRVAEDLNLGNLND
KF779268_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADASLNRRVAEDLNLGNLND
KF779270_HBSP_P-A          MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779272_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779276_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779280_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779284_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAVSHINRRVAEDLNLGNLND
KF779293_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779295_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779297_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLYRRVAEDLNLGNLND
KF779308_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADPNRRVAEDLNLGNLND
KF779329_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVPEDLNLGNLND
KF779332_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF779334_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAAPYRRVAEDLNLGNLND
KF779360_HBSP_P-A          MLLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779384_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF922406_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922407_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF922414_HBSP_P-A          MPLSYHHFRKLLLLDDEAETGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922415_HBSP_P-A          MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922429_HBSP_P-A          MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922431_HBSP_P-A          MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922433_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922434_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922435_HBSP_P-A          MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ843172_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843183_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ843216_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843217_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADGDLNRRVAEDLNLGNLND
KJ854685_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854689_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854699_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854701_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
KJ854703_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854704_HBSP_P-A          MPLSYQHFRKLLLLDEETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854706_HBSP_P-A          MPLSYQRFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854709_HBSP_P-A          MPLSYQHFRKLLLLDDXTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KM606737_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168422_HBSP_P-A          MPLSYQHFRKLLLLDXETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168424_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168426_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168427_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168428_HBSP_P-A          MPLSYQHFRKLLLLDVATEXGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168429_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168431_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168433_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP168434_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168435_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEELNLGNLND
KP718095_HBSP_P-A          MPLSYQHFRKLLLLDDEAEAGPLEEEPPRLADEDLNRRVAEDLNLGNLND
KR905425_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KR905426_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KR905427_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPND
KR905429_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KR905430_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151611_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151612_HBSP_P-A          MPLSYQHFRKLLLLEEEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151613_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366467_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT749822_HBSP_P-A          MPLSYQHFRNVLLLDTGTEAGLLEEELPRLADEDLNRRVAEDLNLGNLND
KT749833_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749834_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAYADLNRRVAEDLNLGNLND
KT749839_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEQELPRLADADLNRRVAEDLNLGNLND
KU605536_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX276769_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEELNLGNLND
KX357643_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357646_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX648547_HBSP_P-A          MPLSYQHFRKLLLLDDEAAAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX648548_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX648549_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX827297_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLSRRVAEDLNLGNLND
LC051141_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
LC462120_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLND
LT992440_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNPND
LT992441_HBSP_P-A          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
LT992448_HBSP_P-A          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
M57663_HBSP_P-A            MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772344_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772345_HBSP_P-A          MPLSYQHFRKLVLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772346_HBSP_P-A          MPLSYQHFRKLVLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772347_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772353_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925362_HBSP_P-A          MPLSYQHFRKLLLLDDEAKAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925373_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464808_HBSP_P-A          MPLSYQHFXKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464809_HBSP_P-A          MPLSYQHFRKLLLLDAELEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464810_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464811_HBSP_P-A          MPLSYQHFRKLLLLDAELEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464816_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464820_HBSP_P-A          MPLSYQHFRKLLLLDDEIEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464825_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464829_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH580627_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512460_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLANKNLNRRVAKDLNLGNLND
MK512462_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512463_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADKDLNRRVAENLNLGNLND
MK512464_HBSP_P-A          MPLSYQHFRKLLFLDDETEAGPLEEELPRLADEDFNRRVAEDLNLGNLND
MK512466_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512469_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512474_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRPADEDLNRRVAEDLNLGNLND
MK512475_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512477_HBSP_P-A          MPLSYQHFRKLLLLDVESEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN053840_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN476102_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN507849_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MN544634_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN585096_HBSP_P-A          MPLSYQHFRKLLLLDDGDMAGPLEEELPRLADEDLNRRVAEDLNLGNPNE
MN585097_HBSP_P-A          MPLSYQHFRKLLLLDDGDMAGPLEEELPRLADEDLHRRVAEDLNLGNPND
MT114170_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT210032_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT210034_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT426090_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT426091_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT426092_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT426096_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLAGADLNRRVAEDLNLGNLND
MT622525_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567968_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567969_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567972_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567973_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567975_HBSP_P-A          MPLSYQHFRKILLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW567976_HBSP_P-A          MPLSYQHFRKLLLLEVGAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW847938_HBSP_P-A          MPLSYQHFRKLLLLDDETGAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999475_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPPLADADLNRRVAEDLNLGNLND
MW999482_HBSP_P-A          MPLSYQHFRKLLLLDNETEAGSLEEELPRLADEDLNRRVAEDLNLGNLND
MW999487_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999503_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLANEDLNRRVAEDLNLGNLND
MW999506_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAKDLNLGNLND
MW999510_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLANEDLNRRVAKDLNLGNLND
MW999511_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAELNRRVAEDLNLGNLND
MW999517_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999519_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAKDLNLGNLND
MW999546_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999598_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLNX
MW999601_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEELNLGNPND
MZ043027_HBSP_P-A          MPLSYQHFLKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043031_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043032_HBSP_P-A          MPLSYQHFRKLLLLDEGTESGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043033_HBSP_P-A          MPLSYQHFRKLLLLEVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043034_HBSP_P-A          MPLSYQHFMKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043035_HBSP_P-A          MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADPDLNRRVAEDLDLGNLDD
MZ043037_HBSP_P-A          MPLSYQHFRKLLLLDXGTEAGPLEEELPRLADEDLNHRVAEDLNLGNLND
MZ043038_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MZ043039_HBSP_P-A          MPLSYQHFRRLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043041_HBSP_P-A          MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043043_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043044_HBSP_P-A          MPLSYQHFRKLLLLDDG-DAGPLEEXLPRLADADLNRRVAEDLNLGNLND
MZ043045_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
MZ043048_HBSP_P-A          MPLSYQHFRKLLLLDVGPEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043049_HBSP_P-A          MPLSYQHFRKLLLLETGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043051_HBSP_P-A          MPLSYQCFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043052_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043053_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043056_HBSP_P-A          MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043058_HBSP_P-A          MPLSYQHFRNVLLLDNGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043059_HBSP_P-A          MPLSYQHFRKLLLLEVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043060_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043063_HBSP_P-A          MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVXEDLNLGNLND
MZ043064_HBSP_P-A          MPLSYQHFRKLLLLEAGDEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043065_HBSP_P-A          MPLSYQSFRKLLLLDHGADAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043067_HBSP_P-A          MPLSYQHFRKLLLLDDGAETGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043068_HBSP_P-A          MPLSYQHFRKLLLLDHDTEAGPLEEELPRLADADLNRRVAEDLNLGTLND
MZ043070_HBSP_P-A          MPLSYQHFRKLLLLDDGTTAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043071_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043073_HBSP_P-A          MPLSYQHFRKLLLLDNDPEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043074_HBSP_P-A          MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043076_HBSP_P-A          MPLSYQHFLKLLLLDD--EAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043080_HBSP_P-A          MPLSYQHFRKLLLLDLETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043081_HBSP_P-A          MPLSYQHFRKLLLLDHGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043082_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLTD
MZ043085_HBSP_P-A          MPLSYQHFRKLLLLDHGTDAGPLEEELPRLADADLNRRVADDLNLGTLND
MZ043086_HBSP_P-A          MPLSYQHFRKLLLLDNEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043087_HBSP_P-A          MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043089_HBSP_P-A          MPLSYQHFRKLLLLDVETEVGSLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043090_HBSP_P-A          MPLSYQHFRKLLLLDNGAEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043092_HBSP_P-A          MPLSYQHFRXLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043093_HBSP_P-A          MPLSYQHFRKLLLLDDG--AGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043094_HBSP_P-A          MPLSYPRFLKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043095_HBSP_P-A          MPLSYQHFRKLLLLDNGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043096_HBSP_P-A          MPLSYQHFLKLLLLDHESEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ093431_HBSP_P-A          MPLSYQHFRRLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OK143477_HBSP_P-A          MPLSYQHFRKLLLLED--EAGPLEEELPRLADADLNRRVAEDLNLGDLND
OK143478_HBSP_P-A          MPLSYQHFRKLLLLDD--ELGPLEEELPRLADADLNRRVAEDLNLGNLND
OK143482_HBSP_P-A          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADADLNRRVAEDLNLGNLND
OK143483_HBSP_P-A          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADADLNRRVAEDLNLGNLND
OK143492_HBSP_P-A          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADADLNRRVAEDLNLGNLND
OK143495_HBSP_P-A          MPLSYQHFRKLLLLDD--EAGPLEEELPRLANADLNRRVAEDLNLGNLND
OK143498_HBSP_P-A          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADADLNRRVAEDLNLGNLND
OK998526_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLSRRVAEDLNLGNLND
OM304326_HBSP_P-A          MPLSYQHFRKLLLLDVGTEEGPLEEELPRLADADLNRRVAEDLHLGDLND
ON585698_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON585700_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNPND
ON854558_HBSP_P-A          MPLSYQHFRKLLWLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854559_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854560_HBSP_P-A          MSLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854562_HBSP_P-A          MPLSYQHFRKLLLLDVEAEAGPLEEELPRLADQDLNRRVAEDLNLGNLND
ON854563_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854564_HBSP_P-A          MPLSYQHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854565_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
ON854567_HBSP_P-A          MPLSYQHFRKLLLLDDGAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854568_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854569_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854570_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854571_HBSP_P-A          MPLSYQHFRKLLLLDDEAEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854579_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854581_HBSP_P-A          MPLSYQHFRKLLLLDNEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854584_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854590_HBSP_P-A          MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
ON854594_HBSP_P-A          MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
V00866_HBSP_P-A            MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
X02763_HBSP_C-A            MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLHRRVAEDLNLGNLND
Z72478_HBSP_P-A            MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB010289_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
AB010290_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB010292_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB014366_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB031266_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
AB031267_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB033555_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRPVAEDLNLGNLND
AB048705_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB073821_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073822_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073823_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073824_HBSP_P-B          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB073825_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073826_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073830_HBSP_P-B          MPLSYQXFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073832_HBSP_P-B          MPLSYQHFRKLLLLEE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB073835_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073836_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073837_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073838_HBSP_P-B          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB073839_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073841_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073842_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
AB073843_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB073844_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB073846_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHHVAEDLNLGNPND
AB073847_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB073848_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB073849_HBSP_P-B          MPLSYQHFRKLXLLDD--EAGPLEEELPRLADEGLNXRVAEDLNLGNPND
AB073850_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB073851_HBSP_P-B          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB073852_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB073853_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB073855_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB073857_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPTD
AB073858_HBSP_P-B          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
AB100695_HBSP_P-B          MPLSYPPFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB117759_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
AB195933_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB195934_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB205120_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB205122_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB212625_HBSP_P-B          MPLSYQHFRKLLLLDE--QAGPLEEELPHLADEGLNRRVAEDLNLGNLND
AB219427_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB219428_HBSP_C-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB219430_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB231909_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGFNHRVAEDLNLGNLND
AB241116_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB246339_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
AB246343_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB287314_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
AB287316_HBSP_P-B          MPLSYQHFRKLLLLDD--ESGPLEEELPRLADEDLNHRVAEDLNLGNPND
AB287317_HBSP_P-B          MPLSYQYFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
AB287320_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDPND
AB287321_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGALEEELPRLADPDLNHRVAEDLNLGDPND
AB287322_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
AB287323_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADQDLNRRVAEDLNLGNPND
AB287325_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
AB287326_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB287327_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADAGLNHRVAEDLNLGNPND
AB287329_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB300370_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB300371_HBSP_P-B          MPLSYQLFRKLLLLDN--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB302095_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB302942_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB302945_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB362933_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB365445_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB493833_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB555499_HBSP_P-B          MPLSYQHFRKLLLLEE--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB642093_HBSP_P-B          MPLSYQHFRKLLLLDD--ESGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB642094_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB713527_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB713528_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB713529_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
AB713530_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
AB713531_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB900095_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB900096_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB900097_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADAGLNRRVAEDLNLGNPND
AB900098_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
AB900104_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
AB900105_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB900106_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB900107_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB900108_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPDD
AB900110_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB900112_HBSP_P-B          MPLSYQHFRKLLLLDDG--AGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB931168_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
AB931169_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
AF121243_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
AF121247_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF121248_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF121251_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF282917_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF461360_HBSP_P-B          MPLSYQRFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF461362_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF479684_HBSP_P-B          MPLSYQHFRKLLLLDG--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AJ627225_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011086_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011087_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011092_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011093_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011094_HBSP_P-B          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY033072_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
AY033073_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
AY163869_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNVND
AY167089_HBSP_P-B          MPLSCQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY167093_HBSP_P-B          MPLSYQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY167094_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY167098_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY167100_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY167101_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
AY167102_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY206383_HBSP_P-B          MPLSYQRFRRLLLLEQ--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY206387_HBSP_P-B          MPLSYQRFRKLLLLDG--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AY206390_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY206391_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY217357_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY217359_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
AY217360_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRIAEDLNLGNLND
AY217362_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY217364_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY217368_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY220698_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY518556_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY596103_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
AY596104_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY596105_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY596111_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AY800389_HBSP_P-B          MPLSYQPFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY800391_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
D00329_HBSP_P-B            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
D00331_HBSP_C-B            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
D23679_HBSP_P-B            MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNHRVAEDLNLGNPND
D50521_HBSP_P-B            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLGLGNLND
D50522_HBSP_P-B            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLGLGNLND
DQ361535_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ377158_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
DQ448622_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNLND
DQ448624_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ448627_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ448628_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGKLND
DQ463788_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
DQ463789_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDDLNRRVAEDLNLGNPND
DQ463791_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
DQ463792_HBSP_P-B          MPLSYQHFRKLLLLD--TDAGPLEEELPRLADEDLNHRVAEDLNLGNPND
DQ463793_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
DQ463794_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGDPND
DQ463795_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
DQ463799_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
DQ463800_HBSP_P-B          MPLSYQHFRKLLLLD--SDAGPLEEELPRLADEDLNHRVAEDLNLGNPND
DQ463801_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNLRVAEDLNLGNPND
DQ904357_HBSP_P-B          MPLSYQHFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993680_HBSP_P-B          MPLSYEDFRRLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
DQ993685_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
DQ993687_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNHRVAEDLNLGNLND
DQ993696_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993698_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993700_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
DQ993704_HBSP_P-B          MPLYYQHFRKLLLLDE--QAGPLEKELPRLADEGLNRRVAEDLNLGNLND
DQ993706_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993707_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
DQ993711_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGTLND
DQ995801_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ995802_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
DQ995803_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
DQ995804_HBSP_P-B          MPLSYQHFRKLLLLDQ--ESGPLEEELPRLADEGLNRRVADDLNLGNLND
EF473971_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
EF473972_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
EF473973_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRPVADDLNLGNLND
EF473975_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVADDLNLGNLND
EF473976_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF473977_HBSP_P-B          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF494382_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNHRVAKDLNLGTLND
EU139543_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU158262_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU158263_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
EU305547_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU305548_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306677_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306681_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306696_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
EU306699_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306704_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306707_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRAAEDLNLGNLND
EU306711_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU330989_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU522072_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU547563_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU564822_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
EU564823_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
EU564826_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
EU570069_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU570075_HBSP_P-B          MPLSYQHFRNILLLDK--DAGPLEEELPRLADQGLNRRVAEDLGLGNLND
EU579441_HBSP_P-B          MPLSYQHFRKILLLDQ--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU595031_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU660231_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU796066_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
EU796067_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU881997_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU881998_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU882002_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU882004_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU919171_HBSP_P-B          MPLSYQRFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLDD
EU919172_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU919175_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU919176_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939559_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939636_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
EU939637_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939638_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939639_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939660_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939661_HBSP_P-B          MPLSYQHFRKLLLLD--VEAGPLEEELPRLADEDLNRRVADELNLGNLND
EU939665_HBSP_P-B          MPLSYQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939667_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
EU939669_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939670_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGDLNE
EU939673_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939674_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
EU939675_HBSP_P-B          MPLSYQHFRSVLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939676_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939677_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
EU939678_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ023631_HBSP_P-B          MPLSYQHFRKLLLLDQ--ESGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ023632_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ023633_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
FJ023634_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ023635_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
FJ023636_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ023637_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEGLPRLADEGLNRRVAEDLNLGNLND
FJ032342_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ032344_HBSP_P-B          MPLSYQHFRNILLLDK--DAGPLEEELPRLADQGLNRRVAEDLGLGNLND
FJ032352_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ032353_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ032358_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386600_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386608_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ386610_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386648_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGILNE
FJ386654_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386655_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386660_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ386666_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386669_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386676_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNHRVAEDLNLGNLND
FJ386681_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
FJ386682_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386683_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
FJ386688_HBSP_P-B          MPLSYQRFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ518811_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ518812_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562219_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562222_HBSP_P-B          MPLSYQHFRKLLLLDE--KAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562224_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562234_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562240_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562246_HBSP_P-B          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562254_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
FJ562257_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562260_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562262_HBSP_P-B          MPLSYQHFRRLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562296_HBSP_P-B          MPLSYQHFRKLLLLEE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562303_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562311_HBSP_P-B          MPLSYQHFRKLLLLEG--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ562312_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562316_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
FJ562322_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ787475_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ787476_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ787477_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ899779_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ899787_HBSP_P-B          MPLSYQHFRKLLSLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358136_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358137_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLAEEGINRRVAEDLNLGNLND
GQ358138_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358139_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDFNLGNLND
GQ358141_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358142_HBSP_P-B          MPLSYRHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358143_HBSP_P-B          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358145_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLAEEGLNRRVAEDLNLGNLND
GQ358147_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRLVAEDLNLGNLND
GQ358148_HBSP_P-B          MPLFYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377525_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377542_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377558_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377566_HBSP_P-B          MPLSYQHFRKLQLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377567_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377587_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377606_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377622_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADDGLNRRVAEDLNLGNLND
GQ377625_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAKDLNLGNLND
GQ377629_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377641_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ377644_HBSP_P-B          MPLSYQHFRKLLLLEE--DAGPLEEELHHLADEGLNRRVAEDLNLGNLND
GQ924605_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPXLAXEGLNRRVAEDLNLGNLND
GQ924607_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNGRVAEDLNLGNLND
GQ924608_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924617_HBSP_P-B          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLHD
GQ924624_HBSP_P-B          MPLSYPLFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924626_HBSP_P-B          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNHRVAEDLNLGNLND
GQ924628_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
GQ924630_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ924632_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924635_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDFNVGNVND
GQ924637_HBSP_P-B          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924638_HBSP_P-B          MPLSYQRFRKLLLLED--EAGPLEEELPRVADEGLNRRVAEDLNLGNLND
GQ924639_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRVADEGLNRRVAEDLNLGNLND
GQ924640_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924645_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
GQ924646_HBSP_P-B          MPLSYQHFRKLLLLEE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924647_HBSP_P-B          MPLSYQRFRKLLLLEE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924648_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924651_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815548_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815550_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNPGNLND
GU815554_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815571_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815573_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNY
GU815574_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815578_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815616_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815641_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815662_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLDRRVAEDLNLGNLND
GU815673_HBSP_P-B          MPLSYQHFRKLLLL--GEEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815709_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815712_HBSP_P-B          IPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815720_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815723_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNN
GU815727_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815741_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815760_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815765_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEEPPRLADEGLNRRVAEDLNLGNLND
GU815772_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815774_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011466_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011467_HBSP_P-B          MPLSYQHFRKLLLLED---AGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011469_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGBLND
HM011470_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011471_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
HM011473_HBSP_P-B          MPLSYQHFRKLLLLD--XEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011474_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAXDLXLGNXND
HM011475_HBSP_P-B          MPLSYQHFRKXLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011476_HBSP_P-B          MPLSYQHFRKLLLLEE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011478_HBSP_P-B          MPLSCQHFRKLLLLEE--DAGPLEEELPRLADEGLNRRVADDLNLGNLND
HM011482_HBSP_P-B          MPLSYQHFRKLLLLEE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011483_HBSP_P-B          MPLSYQHFRKLLLLDE--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011487_HBSP_P-B          MPLSYQRFRKLLLLDDA--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011490_HBSP_P-B          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011492_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011494_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011496_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
HM011499_HBSP_P-B          MPLSYQHFRKLLLLD--BEAGPLEEELPRLADEGLNRRVAEDLNLGBPXD
HM011503_HBSP_P-B          MPLSYQHFRKLLXLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGXLND
HM011504_HBSP_P-B          MPLSYQRFRKLVLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ700546_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNIND
HQ700548_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN792894_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
JN792900_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
JN792901_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDDLNLRVAEDLTLGNPND
JN792902_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDDLNLRVAEDLTLGNPND
JN827419_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ027311_HBSP_P-B          MPLSYQHFRKLLLLDD--EXGPLEEELPRLADEGLNRRVAEDLNLGNXND
JQ027312_HBSP_P-B          MPLSYQHFRKLLLLDX--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ027313_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADDDLNRRVAEDLNLGNLND
JQ027315_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JQ027325_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
JQ027329_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLDD
JQ027330_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JQ027334_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ040125_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRIAEDLNLGNLND
JQ040128_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGBLND
JQ040147_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ040157_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNX
JQ040170_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ040171_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLXDEGLNRRVAEDLNLGNLND
JQ341549_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341551_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341552_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341553_HBSP_P-B          MPLSYQHFRKLLLLDE--XAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ341554_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLXLGNLND
JQ341556_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGTLND
JQ341557_HBSP_P-B          MPLSYQHFRKLLLLDE--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341559_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341560_HBSP_P-B          MPLSYQHFRRLLLLEE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341561_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGTLND
JQ341562_HBSP_P-B          MPLSYQYFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341564_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341565_HBSP_P-B          MPLSYQHFRKLLLLDX--XAGPLEEELPRLADEGLNRRVAEDLNLGBLND
JQ341567_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
JQ341569_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341571_HBSP_P-B          MPLSYXHFRKLLLLEDG--AGPLEEELPRLADEGLNHRVAEDLNLGNPND
JQ341572_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLSLGNLND
JQ341576_HBSP_P-B          MPLSYPHFRRILLLDQ--DAGPLEEELPRLADEGLNRRVAEDLNLGNVND
JQ341577_HBSP_P-B          MPLSYQHFRKLLLLD--XEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341578_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341580_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPHLADEGLNRRVAEDLNLGNLND
JQ341581_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ341582_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
JQ341585_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
JQ341586_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341587_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNIND
JQ341588_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEELNLGNLND
JQ341589_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNHRVAEDLNLGDLND
JQ341590_HBSP_P-B          MPLSYQHFRKLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341592_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLHLGNIND
JQ341594_HBSP_P-B          MPLSYQHFRKLLLLX--XEAGPLEEELPRLADEGLNRRVAEDLXLGNLND
JQ341595_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341596_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
JQ341597_HBSP_P-B          MPLSYQHFRKLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341600_HBSP_P-B          MPLSYQCFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341601_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ341603_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
JQ341605_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341606_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGXLND
JQ341607_HBSP_P-B          MPLSYQRFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
JQ341608_HBSP_P-B          MPLSYQHFRKLLLLDE--KAGPLEEELPRLADEGLNRRVAEDLSLGNLND
JQ341609_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
JQ429079_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ429080_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNXND
JQ707740_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNN
JQ707745_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707747_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707750_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ801474_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ801494_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ801506_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
JQ801516_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
JX026879_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX026881_HBSP_P-B          MPLSYQHFRRLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX026883_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
JX026886_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX429901_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
JX429908_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNFND
JX429910_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGILND
JX429911_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNCRVAEDLNLGNLND
JX504543_HBSP_P-B          MPLSYRHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
JX507213_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661473_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661484_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX869998_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JX869999_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEEPPRLADEGLNRRVAEDLNLGNLND
KC492739_HBSP_P-B          MPLSYQHFRRLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLTD
KC510643_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510646_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510654_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774369_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774370_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLILGNLND
KC774372_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774379_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774380_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774382_HBSP_P-B          MHLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774390_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774394_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774397_HBSP_P-B          MPLSYQHFRKILLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774401_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774407_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGLLEEELPRLADDGLNRRVAEDLNLGNLND
KC774409_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774410_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774412_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774415_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLSLGNLND
KC774417_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774419_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792652_HBSP_P-B          MPLSYQHFRKLLLLDQ--DARPLEEELPRLADEGLNRRVADDLNLGNLND
KC792674_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792701_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792712_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
KC792717_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KC792719_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792742_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792745_HBSP_P-B          MPLSYQHFRKLLLLDH--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KC792748_HBSP_P-B          MPLSYQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLTD
KC792765_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792767_HBSP_P-B          --LSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KC792777_HBSP_P-B          MPLSCQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLGLGTLND
KC792779_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792780_HBSP_P-B          MPLSYQHFRKLLLLEE--EAGPLEEELPRLADEGLNRRVAEDLGLGNLND
KC792786_HBSP_P-B          MPLSYQHFRKLLLLDE--ESGPLEEELPRLADEGLNRRVAEDLNLGXLND
KC792800_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792801_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792811_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVADDLNLGNLND
KC792843_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KC792859_HBSP_P-B          --LSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KC792860_HBSP_P-B          MPLSYQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLNLGTLND
KC792889_HBSP_P-B          --LSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792896_HBSP_P-B          --LSYQHFRKLLLLDE--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792897_HBSP_P-B          MPLSYQRFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792901_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KC792904_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNXND
KC792920_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNXND
KC792935_HBSP_P-B          --LSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC792936_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLXLGBLND
KC792938_HBSP_P-B          MPLSYQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792939_HBSP_P-B          --LSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KC792947_HBSP_P-B          MPLSYQHFRKLLLLEE--DAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC792949_HBSP_P-B          --LSYQHFRKLLLLDE--EAGPLEEELPRLADEXLNRRVAXELNLGNXNX
KC792955_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLHLGNLND
KC792970_HBSP_P-B          --LSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792973_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
KC792974_HBSP_P-B          --LSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792976_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLSLGXLND
KC792985_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
KC793004_HBSP_P-B          --LSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KC793006_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC793030_HBSP_P-B          MPLSYQQFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC793042_HBSP_P-B          --LSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC793061_HBSP_P-B          --LSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KC793064_HBSP_P-B          --LSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC793069_HBSP_P-B          --LSYQHFRKLLLLEE--DAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KC793076_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEXLNXRVABDLXLGNLND
KC793125_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KC793139_HBSP_P-B          --LSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC793141_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
KC793168_HBSP_P-B          --LSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC793180_HBSP_P-B          MPLSYQRFRKLLLLD--ZEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC793189_HBSP_P-B          -PLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNHRVAEDLHLGNLND
KC793199_HBSP_P-B          --LSYQRFRXLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF053159_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADKGLNRRVAEDLNLGNLND
KF053162_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF053163_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF053171_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADKGLNRRVAEDLNLGNLND
KF053174_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
KF053180_HBSP_P-B          MPLSYPHFRRLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLGLGNLND
KF053182_HBSP_P-B          MPLSYPHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLGLGNLND
KF053189_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVADDLNLGNLND
KF053190_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173298_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173341_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173360_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173375_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ173378_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLRNLND
KJ173385_HBSP_P-B          MRLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173397_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
KJ173399_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADDGLNRRVAEDLNLGNLND
KJ173401_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173403_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173420_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ410500_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KJ717792_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRFAEDLNLGNLND
KJ717795_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ717798_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
KJ717801_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
KJ717808_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRFADDLNLGNLND
KJ717813_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ717817_HBSP_P-B          MPLSYQHFRKLVLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
KJ717818_HBSP_P-B          MPLSYQRFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAENLHLGDLND
KJ717820_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEDELPRLADEGLNRRVAEDLTLGNLNE
KJ717829_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRFAEDLNLGTLND
KJ717835_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ717836_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717837_HBSP_P-B          MPLSYQRFRKLLLLD--TDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ717840_HBSP_P-B          MPLSYQHFRKLLLFDN--AAGPLEEELPRLADEGLNRRVAEDLNLGNLDD
KJ717842_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRFAEDLNLGNLND
KJ717843_HBSP_P-B          MPLSYQRFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ790200_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KJ803752_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADKGLNRRVAEDLNLGNLND
KJ843165_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM213032_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KM213034_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KM213035_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM213036_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM392084_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAXDLNLGNLND
KM875420_HBSP_P-B          MPLSYQHFRRLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148328_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148335_HBSP_P-B          MPLSYQHFWKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148341_HBSP_P-B          MPLSYQHFRKLPLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148373_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148374_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148377_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148387_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148399_HBSP_P-B          MPLSYQHFRKLLLLDDG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148401_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148405_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148406_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148407_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148420_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148426_HBSP_P-B          MPLSNQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148429_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148437_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148438_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDHNLGNLDD
KP148452_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148453_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGFNRRVAEDLNLGNLND
KP148459_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAENLNLGNLND
KP148581_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406164_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406167_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406168_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KP406172_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KP406174_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KP406175_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KP406255_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406256_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KP406257_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNIND
KP406258_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNVND
KP406265_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406267_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KP406268_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406269_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406274_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406280_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNIND
KP406284_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406290_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406291_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406297_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406298_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406302_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406304_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406331_HBSP_P-B          MPLSYQHFRKLLLLDE--DAAPLEEELPRLADEGLNRRVAEDLNLGNLND
KP659220_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659223_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659234_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLKEELPRLANENLNHRVAKNLNLGNPND
KP659235_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLXEELPRLADEDLNHRVAXBLNLGNPND
KP659239_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADQDLNHRVAEDLNLGNPND
KP659240_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADXXLNHRVAEDLNLGNPND
KP659244_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLXDEDLNHRVAEDLNLGNPND
KP659245_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADQDLNHRVAEELDLGIPND
KP659250_HBSP_P-B          MPLSYQCFRKLLLLDDVT--GPLEEELPRLADEDLNRRVAEDLNLGNPND
KP659251_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659253_HBSP_P-B          MPLSYQCFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659255_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNLRVAEDLNLGNPND
KR152339_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KT749820_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU963799_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963814_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963815_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNX
KU963854_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963946_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964079_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964109_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964120_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964141_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964155_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964156_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964165_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLKLGNLND
KU964245_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964257_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964258_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964259_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964265_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964267_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964287_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964293_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964302_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964381_HBSP_P-B          MPLSYQHFRNVLLL--GEDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276771_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KX276772_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276775_HBSP_P-B          MPLSYQRFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KX276777_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276778_HBSP_P-B          MPLSYQHFRKLLLLD--XEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276779_HBSP_P-B          MPLSYQHFRKLLLLDZ--XAGPLEEELPHLADEGLNRRVAEDLNLGNLND
KX276782_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNIND
KX276783_HBSP_P-B          MPLSYQHFRKLLLLEAG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276785_HBSP_P-B          MPLSXQHFRKLLLLDE--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276786_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNXND
KX276787_HBSP_P-B          MPLSYQRFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276789_HBSP_P-B          MPLSYQRFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGDPND
KX276790_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
KX276792_HBSP_P-B          MPLSYQHFRXLLLLEZ--DAGPLEEELPRLADEGLNRRVAEDLGLGNLND
KX276793_HBSP_P-B          MPLSYQHFRKLLLLXQG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276794_HBSP_P-B          MPLSYQHFRKLLLLDE--EXGPLEEELPRLADDDLNRRVAEDLNLGNLND
KX276795_HBSP_P-B          MPLSYXXFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLDD
KX276796_HBSP_P-B          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276797_HBSP_P-B          MPLSYQHFRXLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLXLGXLND
KX276798_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGXLND
KX276799_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276800_HBSP_P-B          MPLSYQHFRKLLLLEE--DAGPLEEELPRLADEGLNRRVAEDLNLGTLND
KX276801_HBSP_P-B          MPLSYQHFRKLLLLEE--DAGPLEEELPRLADEGLNRRVAEDLNLGNXND
KX276802_HBSP_P-B          MPLSYQRFLKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276803_HBSP_P-B          MPLSYQRFRKLLLLDK--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
KX276804_HBSP_P-B          MPLSYQRFRKLLLLXX--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276805_HBSP_P-B          MPLSYQRFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276806_HBSP_P-B          MPLSYQLFRKLLLLD--XEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276807_HBSP_P-B          MPLSYXXFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276809_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNXND
KX276810_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276811_HBSP_P-B          MPLSYQLFRKLLLLDN--EAGPLEEELPRLADEXLNRRVAEDLNLGDLND
KX276812_HBSP_P-B          MPLSYQHFRKLLLLDN--ESGPLEEELPRLADEGLNRRVAEDLHLGNLND
KX276813_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276814_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276815_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276817_HBSP_P-B          MPLSYQHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLDLGXPND
KX276818_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
KX276819_HBSP_P-B          MPLSYXHFRRLVLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KX276820_HBSP_P-B          MPLSYQHFRKLLLLDH--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276822_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGBLND
KX276823_HBSP_P-B          MPLSXQHFRKLLLLDB--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276824_HBSP_P-B          MPLSYQHFRKLXLLD--BEAGXLEEELPRLADEGLNRRVAEDLNLGXLND
KX276825_HBSP_P-B          MPLSYQCFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
KX276827_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276828_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276829_HBSP_P-B          MXLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276858_HBSP_P-B          MPLSYQHFRKLLLLDB--XAGPLEEELPRLADEGLNRRVAEDLNLGBXXD
KX765841_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470962_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLENLND
KY629636_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881721_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881782_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881787_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881790_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881792_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLRNLND
KY881794_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881795_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881808_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881822_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881837_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEKLPRLADEGLNRRVAEDLNLENLND
KY881841_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881845_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881846_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881849_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881851_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881853_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881861_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVSEDLNLGNLND
KY881862_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLSRRVAEDLNLGNLND
KY881864_HBSP_P-B          MPLSYQHFRKLLLLD--AEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881865_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881869_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881899_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLHD
KY881913_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881945_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881952_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KY881956_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KY881957_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRIAEDLNLGNLND
LC349868_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC349872_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC349873_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC349874_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC349877_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC461174_HBSP_P-B          MPLSYQHFRKLLLLDD--EXGPLEEELPRLADEGLNRRVAEDLNLGNPND
LC461175_HBSP_P-B          MPLSYQHFRKLLLLDD--EXGPLEEELPRLADEXLNRRVAEDLNLGNPND
LT992442_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
M54923_HBSP_P-B            MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRPVAEDLNLGNLND
MF674382_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674385_HBSP_P-B          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674389_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674396_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674397_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNHRVAEDLNLGNLND
MF674401_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674404_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674406_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674407_HBSP_P-B          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEDLNHRVAEDLNLGNLND
MF674415_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674419_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674420_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGDLND
MF674437_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEELNLGNLND
MF674439_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLSLGTPND
MF674440_HBSP_P-B          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MF674441_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674446_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674455_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADESLNRRVAEDLNLGNLND
MF674456_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674459_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674460_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674462_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674465_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MF674473_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674478_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MF674488_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674492_HBSP_P-B          MPLSYQRFRKLLLLDH--EAGPLEEELPRLADEGLNHRVAEELNLGNLND
MF674496_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNHRVAEDLNLGNLND
MF674503_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRHVAEDLNLGNLND
MF674505_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674507_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674508_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674513_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MG372436_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNVND
MG571323_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571325_HBSP_P-B          MPLSYQRFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MG571326_HBSP_P-B          MPLSYQRFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571329_HBSP_P-B          MPLSYQRFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571331_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571333_HBSP_P-B          MPLSYQRFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571334_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MG571336_HBSP_P-B          MPLSYQHFRKLLLLDN--DAGPLEKELPRLANEGLNRRVAQHLNLGNLND
MG571337_HBSP_P-B          VPLWYKHFRKLPLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571338_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571339_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571340_HBSP_P-B          MPLSYQLFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571341_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571347_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571349_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLQEELPRLADEGLNRRVAKDLNLGNLND
MG571351_HBSP_P-B          MPLSYQHFRKLVLLDK--EAGPLKEELPRLADEGLNRRVAEDLNLGNLND
MG571352_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLHD
MG571353_HBSP_P-B          MPLSYQHFRKLLLLEE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
MG571354_HBSP_P-B          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571357_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571358_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
MG571360_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571361_HBSP_P-B          MPLSYQRFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571364_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571367_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571368_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLPDEGLNRRVAKDLNLGNLND
MG571369_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571370_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEKELPRLADEGLNHRVAEDLNLGNLND
MG571374_HBSP_P-B          MPLSYRHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571375_HBSP_P-B          MPLSYQHFRKLLLLND--DARPLKQELPRLADEGLNRRVAEDLNLGNLNE
MG571376_HBSP_P-B          MPLSYQHFRKLLLLEE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
MG826152_HBSP_P-B          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG826153_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MH061283_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534571_HBSP_P-B          MPLSYQHFRKLPLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534608_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534612_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534614_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534661_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGSLND
MK534673_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534676_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534683_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
MK534691_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534692_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534698_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
MK534699_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534703_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534708_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534710_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534727_HBSP_P-B          MPLSYQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLNLGNPND
MK818223_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNVND
MN689117_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
MN689118_HBSP_P-B          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
MN689119_HBSP_P-B          MPLSYQCFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLHLGTLND
MN689122_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGFHRRVAEEFHLGNLND
MN689123_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNLRVAEDLNLGNLND
MT426102_HBSP_P-B          MPLSYQHFRRLVLLD--PEAGPLEEELPRLADEGLNRRVAEDLNLGNIND
MT426103_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426859_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426863_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426890_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVTEDLNLGNLND
MT426906_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426909_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426940_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426942_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426951_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRIADEGLNRRVAEDLNLGNLND
MT426956_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426965_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426974_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426976_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427009_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLKLGNLND
MT427064_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT427067_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427070_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427071_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427073_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427081_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427090_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427097_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645001_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MT645005_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MT645016_HBSP_P-B          MPLSYQHFRKLLLLDEG--VGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645018_HBSP_P-B          MPLSYQLFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645057_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757438_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757439_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757442_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757443_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757445_HBSP_P-B          MPLSYPHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757447_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757448_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757455_HBSP_P-B          MPLSYPHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW310261_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW310263_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845288_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845289_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVADDLTLGNLND
MW845290_HBSP_P-B          MPLSYQHFRKLLLLED--DAGPLEEELPRLADEGLNRRVAEDLLLGDLND
MW845291_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845292_HBSP_P-B          MPLSYQHFRKLLLLEG--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845294_HBSP_P-B          MPLSYQHFRRLLLLEE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845295_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845296_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845297_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
MW845298_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845299_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGDLND
MW845301_HBSP_P-B          MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MW845302_HBSP_P-B          MPLSYPHFRKLLLLED--VAGPLEEELPRLADEGLNRRVAEDLGLGNLND
MW845303_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845304_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MW845305_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEELNLGNLNE
MW845306_HBSP_P-B          MPLSYQHFRKLLLLD--TEAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MW845310_HBSP_P-B          MPLSYQRFRKLLLLEE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845311_HBSP_P-B          MPLSYQRFRKLLLLEDG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845312_HBSP_P-B          MPLSYQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW847941_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MW999602_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MW999603_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999604_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999608_HBSP_P-B          MPLSYQHFRKLLLLED--EAGPLEEELPRLADEGLNHRVAEDLNLGTLND
MW999610_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999612_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLAEEGLNRRVAEDLGLGTLND
MW999613_HBSP_P-B          MPLSYQHFRKLLLLED--XAGPLEEELPRLADEGLNRRVAEDLNLGTLND
MW999615_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999616_HBSP_P-B          MPLSYQHFRKLLLLD--VEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ439517_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439520_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439525_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
MZ439531_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
MZ439532_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGILND
MZ439533_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439535_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439538_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGTLND
MZ439541_HBSP_P-B          MPLSYQHFRKILLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGTLND
MZ675794_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNIND
MZ675798_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGFNHRVAEDLNLGNLND
MZ675799_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNIND
MZ675800_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGFNHRVAEDLNLGNLND
MZ934423_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MZ934428_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MZ934429_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MZ934430_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
OM688316_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADDGLNRRVAEDLNLGNLND
ON402775_HBSP_P-B          MALSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
ON402778_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
ON402781_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADQGLNHRVAEDLNLGNIND
X97850_HBSP_P-B            MPLSYQHFRKMLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
X98077_HBSP_P-B            MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB014360_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014361_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014363_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB014364_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014365_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB014367_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGBLNE
AB014368_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014369_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014371_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB014372_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014373_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014374_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014377_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014378_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014379_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014380_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014381_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014382_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB014383_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB014384_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB014385_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014386_HBSP_P-C          MPLSYHHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB014387_HBSP_P-C          MPLSYQHFRKLLLLD--AEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014388_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB014389_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014390_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014391_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014392_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014393_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014395_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014396_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014398_HBSP_P-C          MPLSYQHFRKLVLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB014399_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB033550_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB033551_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB033552_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB033553_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB042282_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB042284_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB049610_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB050018_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB074047_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB074755_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB074756_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB105173_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
AB105174_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB111114_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB111115_HBSP_P-C          RPLSYQHLRKLLMLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB111116_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB111117_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB111118_HBSP_P-C          MPLSYQHFRKLLLLDD--KAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB111119_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB111120_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB111121_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB111123_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB111946_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB112063_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGDLNE
AB112065_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
AB112066_HBSP_P-C          MPPSYQHSRKLLLLDD--EAGPLERELPRLADEGLNRRVAEDLNLGNLNE
AB112471_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB112472_HBSP_P-C          MLLSYQHFRKLLLLDD--EAGPLEEEFPRLADEGLNRRVAEDLNLGNLNE
AB113877_HBSP_P-C          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB113878_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB113879_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB115417_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB115418_HBSP_P-C          MPLSYQHFRKLLLLD--PEAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB117758_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB176642_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGTLNE
AB182589_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB195932_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB195936_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB195937_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB195943_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB195945_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB195946_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB195949_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB195952_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB198077_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB198080_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB198083_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB202071_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB205123_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB205124_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEGLPRLADEGLNRRVAEDLNLGNLNE
AB205125_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB222714_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB241110_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB241111_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB241112_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB241113_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB246346_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB247916_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB250109_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB298720_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADAGLNRRVAEDLNLGNLNE
AB299858_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB300360_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLNE
AB300361_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAKELNLGNLNE
AB300372_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB300373_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPNE
AB365451_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLAEEGLNRRVAEDLNLGNLNE
AB367392_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367394_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367395_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367396_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367397_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367398_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367401_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB367402_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367403_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367404_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367405_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
AB367406_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367408_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367411_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367413_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367417_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367418_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB367421_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGTLNE
AB367422_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB367423_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367426_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367427_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB367429_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB367430_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB367431_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB367433_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPREEELPRLADEGLNRRVAEDLGLGNLNE
AB367434_HBSP_P-C          MPLSYQHFRKLLLLDD--EACLLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367802_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367803_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADECLNRRVAEDLNLGNLNE
AB367804_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB368297_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB471851_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
AB485810_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB493839_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNPNE
AB493844_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDDLNRRVAEDLNLGNLNE
AB642097_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGXLNE
AB670237_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670238_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB670239_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670241_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB670242_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRHVAEELNLGNLNE
AB670243_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB670246_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670248_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLBE
AB670249_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670251_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDLNE
AB670252_HBSP_P-C          MPLSYQHFRKLLLLDD--EGGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670253_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670259_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670260_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670262_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTPNE
AB670263_HBSP_P-C          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB670264_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB670265_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPTE
AB670267_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670268_HBSP_P-C          MPLSYXHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLNE
AB670272_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPTE
AB670273_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTE
AB670274_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGXLNE
AB670277_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670279_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670298_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB670300_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB670302_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670304_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670306_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLNE
AB670310_HBSP_P-C          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB675674_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB697490_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB697502_HBSP_P-C          MPLSYQHFRKLLLLDN--EVGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB697510_HBSP_P-C          MPLSYQHFRKLLFLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB900109_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AB900113_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB900115_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGDLNE
AB931170_HBSP_P-C          MPLSYQHFLKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB971714_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB971715_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF182802_HBSP_P-C          MPLSYQHFRKLLLLDD--KAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF182803_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF182804_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF182805_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF223955_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF223960_HBSP_P-C          MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF223961_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF241410_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF286594_HBSP_P-C          MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
AF363961_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF384371_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF411408_HBSP_P-C          MPLSYQHFRKLLLLDD--EADPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF411412_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF458664_HBSP_P-C          MPLSYQHFRELLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF461357_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLNE
AF461358_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF473543_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF533983_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AJ748098_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AP011099_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AP011100_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AP011106_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLNE
AP011107_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY057947_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY167091_HBSP_P-C          MPLSYQHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
AY167092_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY167096_HBSP_P-C          MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY167099_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY206376_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AY206378_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
AY206381_HBSP_P-C          MPLSYQHFRRLVLLDD--EAGPLEEELPRLTDEGLNRRVAEDLNLGNLNE
AY206382_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY206384_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY206385_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY206386_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGSLNE
AY206389_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY206392_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
AY220699_HBSP_P-C          MPLSYQHFRRLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY220701_HBSP_P-C          MPLSYQLFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AY641559_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AY641560_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY641562_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY641563_HBSP_P-C          MPLSYQHFRKLLLLDDA--AGPLEEELPRLADEDLNRRVAEDLNLGNLNE
D12980_HBSP_P-C            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
D23682_HBSP_P-C            MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
D28880_HBSP_P-C            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
D50517_HBSP_P-C            MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
D50520_HBSP_P-C            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089756_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
DQ089757_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
DQ089758_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089759_HBSP_P-C          MPLSYQHFRKLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089760_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089761_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
DQ089764_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089766_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089769_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089770_HBSP_P-C          MPLSYQHFRKLLLLDD--EPGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089772_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
DQ089773_HBSP_P-C          MPLSYQHFRKLLFLDD--EAAPLEEELPRLADEVLNRRVAEDLNLGNLNE
DQ089775_HBSP_P-C          MPLSYQHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089776_HBSP_P-C          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
DQ089777_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
DQ089778_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVADDLNLGNLNE
DQ089780_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
DQ089781_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLNE
DQ089783_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLSLGNLNE
DQ089784_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089785_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLAEEGLNRRVAEELNLGNPNE
DQ089786_HBSP_P-C          MPLSYPHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
DQ089788_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
DQ089790_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089791_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089792_HBSP_P-C          MPLSYQHFRKLLLLDD--XAGPLEXELPRLADEGLNRRVAEDLNLGNLNE
DQ089794_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNINE
DQ089796_HBSP_P-C          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089797_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089799_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ089800_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089801_HBSP_P-C          MPLSYQHFRKLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089802_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
DQ089803_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089804_HBSP_P-C          MPLSYQHFRKLLLLED--DAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
DQ246215_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ315781_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ361526_HBSP_P-C          MPLSYQRFRRLVLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ361534_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLNE
DQ377160_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ377164_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ478885_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ478899_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ478901_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ922650_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ922651_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLSE
DQ975272_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
DQ975274_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDPNLGNLNE
DQ980551_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ986375_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ986376_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ993181_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
DQ993691_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ993692_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EF137802_HBSP_P-C          MPLSYQHFRKLLLLDDA--AGPLEEELPRLADEDLNRRVADDLNLGNLNE
EF137803_HBSP_P-C          MPLSYQHFRKLLLLDD--AAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
EF197911_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EF494377_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPNE
EF536066_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EF688062_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU305541_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306672_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEKLPHLADEGLNRRVAEDLNLGNLNE
EU306688_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306722_HBSP_P-C          MPLFYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306724_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGTLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306725_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGGLNE
EU306726_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306727_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306729_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU410079_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU410080_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU439008_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU439010_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLKLGNLNE
EU439016_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU439025_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLKLGNLNE
EU498227_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU522068_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU522069_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU522071_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU547559_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU547562_HBSP_P-C          MPLSYQHFRKLLLLEQ--DAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
EU554540_HBSP_P-C          MPLSYQHFRRLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU554541_HBSP_P-C          MPLSYQYFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU560438_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGDLNE
EU560439_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNHRVAEDLNLGNLNE
EU560440_HBSP_P-C          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU562215_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU562216_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU570072_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDDLNRRVAEDLNLGNLNE
EU579443_HBSP_P-C          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU589340_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU589341_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU589344_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU589345_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU670263_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNLND
EU717212_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU717214_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU717215_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU717217_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU717218_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLDEELPRLADEGLNRRVAEELNLGNLNE
EU796069_HBSP_P-C          MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU796070_HBSP_P-C          MPLSYQHFRKLLLLDG--EADPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871974_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLSE
EU871975_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871976_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871978_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLAAEGLNRRVAEDLNLGNLNE
EU871980_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU872000_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
EU872005_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU872008_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU881996_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
EU881999_HBSP_P-C          -PLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU882000_HBSP_P-C          -PLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU882005_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916204_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916210_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916211_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916214_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLDE
EU916215_HBSP_P-C          MPLSYQHFRELLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916219_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916222_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916223_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916225_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916226_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
EU916227_HBSP_P-C          MPLSYQHFRKLLLLDG--EAGPLEEELPRLADDGLNRRVAEDLNLGNLNE
EU916237_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDPNLGNLNE
EU916238_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
EU919164_HBSP_P-C          MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
EU919165_HBSP_P-C          MPLSYQHFRKLLLLDA--GAGPLEEELPRLADEGLNRRVAEDLNLGDPNE
EU919168_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU919169_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939536_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939539_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLHLGDLNE
EU939540_HBSP_P-C          MPLSCQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939541_HBSP_P-C          MPLSYQHFRKLLLLDD--KAGPLKKKLPRLANKGLNRRVAKNLNLGNLNE
EU939542_HBSP_P-C          MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939543_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939549_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939552_HBSP_P-C          MPLSYQHFRKLLLLNN--QAGPLEKELPRLANEGLNRRVAKDLNLGNLNE
EU939553_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939555_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939556_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
EU939558_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTE
EU939562_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTE
EU939564_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939569_HBSP_P-C          MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
EU939571_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939572_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939573_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939578_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939579_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939582_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939583_HBSP_P-C          MPLSYQHFRKLLLLD--VEAGPLEEELPRLADEDLNRRVAEDLNLGNLSE
EU939584_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939586_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLTDEGLNRRVAEDLNLGNLNE
EU939588_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939592_HBSP_P-C          MPLSYQHFRKLLLLDD--GAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939593_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939596_HBSP_P-C          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939599_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLAYEGLNRRVAQDLNLGNPNE
EU939600_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939601_HBSP_P-C          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939603_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939605_HBSP_P-C          MPLSYQYFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTE
EU939611_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939614_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939615_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939616_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939617_HBSP_P-C          MPLSYQHFRNVLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939619_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939625_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNINE
EU939626_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
EU939641_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939645_HBSP_P-C          MPLSYQHFRKLLLLDD--NAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
EU939648_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
EU939651_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939653_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939654_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDDLNRRVAEDLNLGNLNE
EU939655_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939657_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939658_HBSP_P-C          MPLSYQHFRKLLLLDD--QAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939659_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
FJ023639_HBSP_P-C          MPLSYQHFRKLLLLDDG--AGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023640_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023646_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLSLGNLNE
FJ023648_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023652_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023654_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023655_HBSP_P-C          MPLSYQHFLKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032333_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ032334_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
FJ032336_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032340_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032347_HBSP_P-C          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032350_HBSP_P-C          TPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032351_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032355_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLANEGLNRRVAEDLNLGNLNE
FJ032356_HBSP_P-C          MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032359_HBSP_P-C          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032360_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032361_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386579_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386589_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386595_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386601_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386602_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386604_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386607_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386609_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386611_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ386612_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386613_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386614_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386617_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386620_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386621_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386623_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ386624_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386626_HBSP_P-C          MPLSYQHFRKLLLLDD--NAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386630_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTE
FJ386638_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ386640_HBSP_P-C          MPLSYQHFRRLLLLD--AEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386645_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386647_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386650_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386652_HBSP_P-C          MPLSYQHFRKLLLLD--AEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386653_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLGNLNE
FJ386657_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386659_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386661_HBSP_P-C          MPLSYQHFRRLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGTLNE
FJ386664_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386667_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGSLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386670_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
FJ386671_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386673_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386677_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386689_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562221_HBSP_P-C          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ562228_HBSP_P-C          MPLSYQHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562230_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562233_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562238_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562241_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
FJ562242_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
FJ562245_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562250_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ562251_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ562256_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ562261_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGHLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562265_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562266_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
FJ562270_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
FJ562272_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562279_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562280_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562281_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562286_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562291_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562292_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562295_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ562298_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562300_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
FJ562304_HBSP_P-C          MPLSYQRFRKLLLLDG--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562306_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562310_HBSP_P-C          MPLSYQHFRKLLLLDA--QAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ562319_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562320_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562323_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEDLNRRVAEDLNLGNLNE
FJ562326_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPHLADEGLNRRVAEDLNLGNPNE
FJ562327_HBSP_P-C          MPLSYHHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562334_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562337_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562339_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562340_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715342_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADECLNRRVAEDLNLGNLNE
FJ715343_HBSP_P-C          MPFSYQHSRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715344_HBSP_P-C          MPLSYQHFRKLLLLDD--EACPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715351_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRAAEDLNLGNLNE
FJ715359_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715360_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715364_HBSP_P-C          MPLSYQHFPKLLLLDD--EAVPLEEELPRLADEGLNHRVAEDLNLGNLNE
FJ715365_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715366_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715368_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRAAEDLNLGNLNE
FJ715371_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715374_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715379_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715382_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
FJ715391_HBSP_P-C          MPLSYQHFGKLLLLDD--EAGPLEEELPRLADEGPNRRAAEDLNLGNLNE
FJ715395_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ715404_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRCVAEDLNLGNLNE
FJ715405_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGSLNE
FJ715418_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRAAEDLNLGNLNE
FJ715422_HBSP_P-C          MPLSYQHFRKLLLLYD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787437_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLSRRVAEDLNLGNLNE
FJ787439_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787441_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787442_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787447_HBSP_P-C          MPLSYQHFRKLLLLDD--AAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787448_HBSP_P-C          MPLSYQHFRKLLLLDDA--AGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787449_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLNE
FJ787450_HBSP_P-C          --LSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ787451_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ787452_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLDE
FJ787453_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787455_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787457_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNFNE
FJ787458_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787459_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787461_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787462_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787463_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787467_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787469_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPCLADEGLNRRVAEDLNLGNLNE
FJ787470_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNINE
FJ787471_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNINE
FJ787474_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787481_HBSP_P-C          MPLSYQHFRKLPLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787484_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRDAEDLNLGNLNE
FJ787487_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
FJ787488_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
FJ787490_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGFNRRVAEDLNLGNLNE
FJ899768_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ899772_HBSP_P-C          MPLSYQDLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ899773_HBSP_P-C          -PLSYQHFRKLLLLDD--EAGPLEEELPRLANEGLNRRVAEDLNLGNLNE
FJ899778_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNLNE
FJ899789_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEEPPRLADEGLNRRVAEDLNLGNLNE
FJ899793_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
FJ899795_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ904423_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ184326_HBSP_P-C          MPLSYQHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ227692_HBSP_P-C          MPLSYQHFRKLLSLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ358153_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
GQ358157_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
GQ358158_HBSP_C-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVADDLNLGNLNE
GQ377524_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
GQ377526_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377536_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377538_HBSP_P-C          MPLSYQHFLKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377545_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377555_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377557_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
GQ377570_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377571_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377575_HBSP_P-C          MPLSYQHFRKLQLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377576_HBSP_P-C          MPLSYQHFRKLQLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377583_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377586_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDPNE
GQ377591_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
GQ377593_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377597_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377600_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377608_HBSP_P-C          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377609_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
GQ377620_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
GQ377623_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLDE
GQ377624_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377636_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377642_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475312_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
GQ475316_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
GQ475323_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475328_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475336_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
GQ475341_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475342_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475343_HBSP_P-C          MPLSYQHFRKLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475344_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475350_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475351_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475353_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
GQ475354_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475355_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475356_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924609_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGLLEEELPRLAXEGLNRRVAEDLNLGNXNE
GQ924612_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTE
GQ924616_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924619_HBSP_P-C          MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924620_HBSP_C-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924629_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPXEEELPLLADEGLNRQVAEDLNVGNVXE
GQ924636_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPIEEELPRLADEGLNRRVAEDLNVGNVNE
GQ924642_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924643_HBSP_P-C          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
GQ924655_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GU721029_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011465_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM011468_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM011472_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM011479_HBSP_P-C          MPLSYQHFRKLLLLDX--XAGPLEEELPRLADEGLNRRVAEDLXLGXLNE
HM011481_HBSP_P-C          MPLSYQHFXKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM011486_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGXLBE
HM011488_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM011491_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM011495_HBSP_P-C          MPLSYQHFRKLLLLDX--EAGPLEEELPRLADEGLNRRVAEDLNLGNXNE
HM011500_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
HM750135_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLGNLNE
HM750136_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
HM750139_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM750140_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM750141_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HQ638218_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HQ700517_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HQ700522_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
HQ700529_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
HQ700543_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
JF828905_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF828906_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF828910_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF828913_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF828916_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF828918_HBSP_P-C          MPLSYQHFRKLLSLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF828921_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF828922_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF828923_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF828924_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF828937_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF899336_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN400087_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNPGNLNE
JN827414_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN827417_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN827418_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN827420_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN827422_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN827423_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN827424_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ027317_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ027318_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPNE
JQ027320_HBSP_P-C          MPLSYQLFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ027322_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
JQ027323_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
JQ027324_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040131_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDLNE
JQ040135_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040139_HBSP_P-C          MPLSYPHFRKLLLLDN--EAXPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040141_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040143_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040145_HBSP_P-C          MPLSXQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040152_HBSP_P-C          MPLSYQHFRKLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040154_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040156_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040161_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADVGLNRRVAEDLNLGNLNE
JQ040164_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
JQ341611_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341612_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLSE
JQ341614_HBSP_P-C          MPLSYQHFRKLLLLEG--DAGPLEEELPRLADEGLNRRVAEDLHLGDLNE
JQ341615_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341617_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341618_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341619_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNINE
JQ341620_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEXLNLGNLNE
JQ341624_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341628_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341630_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341631_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341633_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341634_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341635_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTE
JQ341639_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLGLGNLNE
JQ341643_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341647_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341650_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341651_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341653_HBSP_P-C          MPLSYQHFRKLLLLDP--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
JQ341656_HBSP_P-C          MPLSYQHFRKLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341657_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341659_HBSP_P-C          MPLSYQHFRKLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341661_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341663_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341665_HBSP_P-C          MPLSYQHFRKLLLLDX--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341666_HBSP_P-C          MPLSYQHFRKLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341670_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ429078_HBSP_P-C          MPLSYQHFRKLLLLDA--GAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ707707_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707708_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLANEGLNRRVAEDLNLGNLND
JQ707710_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707716_HBSP_P-C          MPLSYQLFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707719_HBSP_P-C          MPLSYRHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707723_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707725_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707768_HBSP_P-C          MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801475_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801478_HBSP_P-C          MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801482_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801487_HBSP_P-C          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801489_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801490_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
JQ801491_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801493_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADKGLNRRVAEDLNLGNLNE
JQ801499_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801500_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801501_HBSP_P-C          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801503_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRPADEGLNRRVAEELNLGNLNE
JQ801508_HBSP_P-C          MPLSYQSFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLHLGDPNE
JQ801510_HBSP_P-C          MPLSYQHFRKLLLLDD--KAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801515_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
JQ801518_HBSP_P-C          MPLSCQHVRKLMLLYD--EAGRIEEELPRIANEGLNRRVAEDVNLGNLNE
JQ801520_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEKLPRLPHEGLNPLLAEDLNLGNLNE
JQ801521_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801522_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPVEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801523_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEEHPRLADEGLNRRVAEDLNLGNLNE
JX026877_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX026878_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX026888_HBSP_P-C          MPLSYQLFRKLLLLDD--EAGPLEEELLRLADEDLNRRVAEDLNLGNLNE
JX429905_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX429913_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX429917_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX504534_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX504535_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX504537_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
JX504539_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLSE
JX504545_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX507211_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVADDLNLGNLNE
JX507212_HBSP_P-C          MPLSYQHFRKLLLLDN--EXGPLEEEPPRLADEGLNRRVAEDLNLGNLNE
JX560520_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX661489_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLNE
JX661490_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
JX661496_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX661497_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
JX870000_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEXLPXLADEGLNRRVAEDLNLGNLNE
KC315399_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774179_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774180_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774187_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KC774191_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774195_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774196_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774197_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774202_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774206_HBSP_P-C          MPLSYRHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774208_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774211_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDVLNRRVAEDLNLGNLNE
KC774213_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774215_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774217_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774219_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774223_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774226_HBSP_P-C          MPLSYQPFRKLLLLNN--KAGPLKKKLPPLPNKGLNRRVAEDLNLGGFNE
KC774229_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774231_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774232_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774235_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KC774237_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KC774238_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774240_HBSP_P-C          MPLFYQHFRKLLLLND--KAGPLKKKLPRLKNKGLNRRVAEDLNLGNLNE
KC774242_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774245_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774252_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNINE
KC774253_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774254_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774260_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774265_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774272_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774279_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774281_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774284_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
KC774286_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774287_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774288_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEDLNRRVAQDLNLGNLNE
KC774289_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774290_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774300_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLKLGNLNE
KC774306_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774311_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774313_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRAAEDLNLGNLNE
KC774316_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLNE
KC774320_HBSP_P-C          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774321_HBSP_P-C          MPLSYQHFRKLLLLD--AEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774330_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPNE
KC774334_HBSP_P-C          MHLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLGNLNE
KC774335_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC774337_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774340_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774346_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774348_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774352_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLKYRVAEDLNLGNLNE
KC774353_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAKDLNLGNLNE
KC774354_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
KC774355_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
KC774361_HBSP_P-C          MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KC792753_HBSP_P-C          MPLSYQHFRKLLLLDN--XAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC792759_HBSP_P-C          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC792799_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC792831_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC792834_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC792880_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC792902_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEDELPRLADEGLNRRVAEDLNLGDLNE
KC792911_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGBLNE
KC792921_HBSP_P-C          --LSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC792995_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC793024_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC793046_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KC793097_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC793107_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC875268_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEALNLGNLNE
KC875269_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC875273_HBSP_P-C          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF053161_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTE
KF053164_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KF053168_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF053170_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
KF053172_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF053175_HBSP_P-C          MPLSCQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF053177_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF053181_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF053184_HBSP_P-C          MPLSYPHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
KF053185_HBSP_P-C          MPLSYQHFRKLLLLDV--AAGPLEEELPHLADEGLNRRVAEDLNLGDLNE
KF053193_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF214652_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF214655_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF214667_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF214668_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF214670_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF214672_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF214677_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
KF485390_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNXRVAEDLNLGNLNE
KF495606_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KF779327_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF873536_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
KF873539_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KF873544_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173285_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173287_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADESLNRRVAEDLNLGNLNE
KJ173290_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173291_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173292_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173296_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173304_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173305_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173333_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KJ173334_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KJ173335_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173443_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ410491_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTE
KJ410493_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KJ410511_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLDE
KJ410514_HBSP_P-C          MPLSYQHFRKLLFLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KJ410519_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ410521_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KJ598635_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598637_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598648_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLVDEGLNRRVAEDLNLGNLNE
KJ598662_HBSP_P-C          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598663_HBSP_P-C          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598689_HBSP_P-C          MHLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598703_HBSP_P-C          MHLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598714_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598715_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598716_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598740_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598741_HBSP_P-C          MHLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598743_HBSP_P-C          MHLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598753_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598756_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598760_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGKINE
KJ598762_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNINE
KJ598767_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598768_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598772_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598773_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598774_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717791_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRFAEDLNLGNLNE
KJ717802_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLNE
KJ717803_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KJ717809_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717821_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGTLDE
KJ717822_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717823_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRGAEDLNLGNLNE
KJ717825_HBSP_P-C          MPLSYQRFLRLLLLDH--EAGPLEEELPRLADEGLNRRFAEDLNLGNLNE
KJ717826_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717827_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRCAEHLNLGNLKE
KJ717828_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRCAEHLNLGNLKE
KJ803814_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRCAEHLNLGNLNE
KJ803815_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRCAEHLNLGNLNE
KM875406_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KM875412_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KM875423_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KM875424_HBSP_P-C          MPLSYQHFRKLLLLED--GAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KM875428_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KP148315_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KP148462_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRPADEGLNRRVAEDLNLGDLNE
KP148476_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KP148488_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVTEDLNLGNLNE
KP148493_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KP148534_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGLLEEELPRLADEGLNRRVAEDLNLGNLNE
KP148535_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KP148540_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KP148559_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADKGLNRRVAEDLNLGNLNE
KP148564_HBSP_P-C          MPLSHQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KP148568_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KP148570_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013762_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNCRVAEDLNLGNLNE
KR013764_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013766_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013768_HBSP_P-C          MSLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013771_HBSP_P-C          MPLSYRHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLDLGNLNE
KR013772_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNFNE
KR013778_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLDRRVAEDLNLGNLNE
KR013780_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGSLNE
KR013783_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRAAEDLNLGNLNE
KR013786_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013787_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013788_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KR013789_HBSP_P-C          MPLSYQHFRKLLLLD--VEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KR013796_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
KR013797_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013802_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013803_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013804_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013805_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNCRVAEDLNLGNLNE
KR013807_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013809_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLKEELPRLADEGLNRRVAEDLNLGNLNE
KR013811_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013812_HBSP_P-C          MPQSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013813_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013814_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013820_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013822_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGDLNE
KR013823_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
KR013824_HBSP_P-C          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013825_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
KR013827_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013831_HBSP_P-C          MPLSYQHFRKLLLLDD--ETGPLEEELPRLADEDLNRRVAEDLNLGDLNE
KR013833_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEGLNLGNLNE
KR013837_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KR013838_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KR013839_HBSP_P-C          MPLSYQHFRKLLLLDD--VAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KR013840_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KR013841_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KR013842_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEEPPRLADEGLNRRVAEDLNLGNLNE
KR013844_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013847_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013852_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEGELPRLADEGLNRRVAEDLNLGNLNE
KR013853_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013863_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013865_HBSP_P-C          MPLSYQHSRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013866_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013868_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KR013869_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013870_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLKRRVAEDLNLGNLNE
KR013875_HBSP_P-C          TPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGSLNE
KR013878_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGTLNE
KR013883_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADGDLNRRVAEDLNLGTLNE
KR013885_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGTLNE
KR013890_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGTLNE
KR013899_HBSP_P-C          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
KR013903_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013904_HBSP_P-C          MPLSYQHFRKPLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013905_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KR013915_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013923_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013942_HBSP_P-C          MPLSYQHFRKLLLLD--VEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KR013943_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013961_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRHVAEDLNLGNLNE
KR013993_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KR014002_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014005_HBSP_P-C          IPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014006_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014007_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014010_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014012_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLKLGNLNE
KR014013_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNLNE
KR014014_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014015_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014017_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014021_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KR014043_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014048_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRFADEGLNRRVAEDLNLGNLNE
KR014077_HBSP_P-C          MPLSYQHFRELLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014078_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRPADEGLNRRVAEDLNLGNLNE
KR819180_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT284757_HBSP_P-C          MPLSYQHFRKVLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT307718_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT366463_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT366464_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT987423_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU051424_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU679937_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGBPND
KU679951_HBSP_P-C          MPLSYQRFRXLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU679960_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGBPND
KU963882_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGINRRVAEDLNLGNLNE
KU963900_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963904_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963920_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963937_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
KU964014_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964034_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KU964042_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KU964046_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEELNLGNLNE
KU964049_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KU964064_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964198_HBSP_P-C          MPLSYQHFRKILLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964214_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964215_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964219_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964318_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964341_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964343_HBSP_P-C          MPLSYQHFRKLLLLED--ESGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964349_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964353_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX276831_HBSP_P-C          MPLSYQHFRKLLLLDX--EAGPLEEELPRLADEGLNRRVAEDLNLGNLDE
KX276833_HBSP_P-C          MPLSYQHFRKLLLLDB--EVGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX276836_HBSP_P-C          MPLSYQHFRKLLLLDN--XAGPLEEELPRLADEGLNRRVAEDLNLGNLBE
KX276837_HBSP_P-C          MPLSYQHFRKLLLLDH--XAGPLEEELPRLADEGLNRRVAEXLXLGXLNE
KX276838_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNINE
KX276839_HBSP_P-C          MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX276840_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNXNE
KX276841_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLNE
KX276847_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KX276849_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KX276850_HBSP_P-C          MPLSYQHFRKLXLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KX276852_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX276853_HBSP_P-C          MPLSYQHFRKLLLLED--XAGPLEEELPRLADEXLNRRVAEDLXLGXXNE
KX276855_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLXLGDLNE
KX765819_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765821_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765828_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765836_HBSP_P-C          TPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KX765839_HBSP_P-C          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVTEDLNLGNLNE
KX765840_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLNE
KX765843_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX765852_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765855_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363253_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363254_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KY363256_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KY363257_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KY363260_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KY363264_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363266_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363267_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363274_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLAGEGLNRRVAEDLNVGNLNE
KY363284_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363285_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363286_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363287_HBSP_P-C          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470873_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470874_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470875_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470878_HBSP_P-C          MPLSYLHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470882_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470886_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLDLGNLNE
KY470911_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470920_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470925_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KY470927_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KY470930_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KY470936_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLSLGNLNE
KY470937_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLGLGNLNE
KY470965_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
KY470966_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
KY470967_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
KY470975_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLDRRVAEDLNLGDLNE
KY470980_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEGLPRLADEGLNHRVAEDLNLGNLNE
KY470983_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KY629637_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNLRVAEDLNLGNLNE
KY881737_HBSP_P-C          MPLSYQHFRKLLLLDD--EVGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881802_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLGNLNE
KY881803_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881804_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881805_HBSP_P-C          MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881806_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881807_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881809_HBSP_P-C          MPLSYQHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881810_HBSP_P-C          MPLSYQHLRKLLLLND--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881814_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881815_HBSP_P-C          MPLSYQHLRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881817_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881819_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLNE
KY881872_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881873_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881880_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLVDEGLNRRVAEDLNLGNLNE
KY881888_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLDLGNLNE
KY881889_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRAAEDLNLGNLNE
KY881890_HBSP_P-C          MPLSYQHFQKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881891_HBSP_P-C          MPISYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881915_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881916_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881964_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881965_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881966_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLDE
KY881973_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881976_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881979_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881983_HBSP_P-C          MPLPYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881991_HBSP_P-C          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881994_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881998_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY882003_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279254_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279276_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
MF674399_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674417_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674425_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674428_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEELNLGNLNE
MF674430_HBSP_P-C          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNHLVAEDLNLGTLNE
MF674471_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925375_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925376_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925403_HBSP_P-C          MHLSYQRFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925405_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925409_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG571359_HBSP_P-C          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
MG826123_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG826124_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
MG826125_HBSP_P-C          -PLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG826126_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MG826128_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG826129_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
MG826132_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG826134_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MG826136_HBSP_P-C          MPLSYQHFRKLLLLND--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG826138_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
MG826140_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG826143_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG893553_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG893557_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG893560_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGHLEEELPRLADEGLNRRVAEDLNLGNLNE
MH220971_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
MH818373_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
MK286461_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVXEDLNLGNLNE
MK321266_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNLRVAEELNLXNLNE
MK534557_HBSP_P-C          MPLSYQHFRKLLLLDD--ESGPLEEELPRLADEGLNRRVAEDLNLGNPNE
MK534588_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
MK534596_HBSP_P-C          MPLSYPHFRKLLLLDN--DTGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534624_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534631_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534636_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534640_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534644_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534647_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534677_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534678_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPNE
MK534720_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK720629_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNLRVAEELNLGNLNE
MK818227_HBSP_P-C          MPLSYQHFRXLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MN683728_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426250_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426254_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426264_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426265_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGRLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426266_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426267_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426277_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426280_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426282_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNSRVAEDLNLGNLNE
MT426283_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGALEEELPRLADEGLNRRVAEDLNLGNLNE
MT426287_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426292_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426297_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426298_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRIAEDLNLGNLNE
MT426308_HBSP_P-C          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426312_HBSP_P-C          MPLSYQHFRKLLLLDG--EAGPLEEELTRLADEGLNRRVAEDLNLGNLNE
MT426314_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426319_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNK
MT426328_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426352_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADESLNRRVAEDLNLGNLNE
MT426355_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNLNE
MT426363_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426409_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426445_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426451_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426458_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426577_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426578_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADESLNRRVAEDLNLGNLNE
MT426579_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426584_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426588_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426599_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426603_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPCLADEGLNRRVAEDLNLGNLNE
MT426615_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426624_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426630_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426637_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
MT426650_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426659_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426663_HBSP_P-C          MPISYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426666_HBSP_P-C          MPLSYQHVRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426679_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426683_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426731_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426743_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426754_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426756_HBSP_P-C          MPLSYQLFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426781_HBSP_P-C          MPLSYLHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426793_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLDEELPRLADEGLNRRVAEDLNLGNLNE
MT426797_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MT426804_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426811_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426818_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLSE
MT426829_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLDLGNLNE
MT426837_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGINRRVAEDLNLGNLNE
MT426838_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGALEEELPRLADEGLNRRVAEDLNLGNLNE
MT426839_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVEEDLNLGNLNE
MT426841_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426843_HBSP_P-C          MPLSYQHFRKLLLLDD--ESGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426847_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426850_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426853_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNK
MT426854_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT644996_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT644997_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT644998_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT644999_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645003_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645007_HBSP_P-C          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MT645008_HBSP_P-C          MPLSYQHFRKLLLLDN--DAGHLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645010_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
MT645011_HBSP_P-C          MPLSCQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNINE
MT645013_HBSP_P-C          MPLSYQHFRKLLLLED--EAGHLEEELPRLADEGLNRRVAEDLNLGNPNE
MT645014_HBSP_P-C          MPLSYLHFRKLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645019_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
MT645020_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645021_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
MT645024_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645027_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPTE
MT645030_HBSP_P-C          MPLSYQHFRKLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645032_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645036_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
MT645038_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645046_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645050_HBSP_P-C          MPLSYQQFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645051_HBSP_P-C          MPLSYQHFRKLLLLED--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
MT645054_HBSP_P-C          MPLSYQCFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
MW310259_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MW310260_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MW675888_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MW675889_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEDLNRRVAEDLNLGNLNE
MW675890_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MW675896_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
MW755445_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MW887641_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
MW887642_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADQDLNRRVAEDLNLGDPNE
MW887643_HBSP_P-C          MPLSYQHFRKLLLLDD--DSGPLEEELPRLADEGLNRRVAEDLNLGNPNE
MW887646_HBSP_P-C          MPLSCQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MW887647_HBSP_P-C          MPLSYQCFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNVNE
MW887651_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEELNLGNLNE
MW887652_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
MW999620_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLNE
MW999626_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MW999629_HBSP_P-C          MPLSYQHFLKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439270_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439283_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439320_HBSP_P-C          MPLSYQRFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439330_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439334_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439374_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439408_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439420_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439557_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439560_HBSP_P-C          MPLSYQHFRKLLLLDD--DSGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439565_HBSP_P-C          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439598_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439624_HBSP_P-C          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLGLGTLND
MZ439625_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ439626_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439628_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439630_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ439672_HBSP_P-C          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ439724_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ671235_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
MZ671240_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ671244_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ671247_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
MZ671248_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MZ934422_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MZ934433_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLAEEGLNHRVAEDLNLGNLNE
OK106255_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLXEELPRLADEGLNRRVAEDLNLGNLNE
ON402774_HBSP_P-C          MPLSYQLFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
ON402776_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNLNE
ON402777_HBSP_P-C          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEDLNRGVAEDLNLGNLNE
ON402779_HBSP_P-C          MPLSYQDFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNQ
ON402780_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
ON402782_HBSP_P-C          MPLCYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
X04615_HBSP_P-C            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
X52939_HBSP_P-C            MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB048701_HBSP_P-D          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB078031_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB078032_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB090268_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB104709_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB104710_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB104711_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB104712_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB109479_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
AB119252_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
AB119254_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB119255_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB119256_HBSP_P-D          MPLSYHHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB120308_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
AB126581_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB188241_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB188242_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB188244_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB205127_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB205128_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB210820_HBSP_P-D          MPLSYQHFRRLLLLED--ESGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB210821_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLGNLND
AB222709_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB222710_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB222711_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNLND
AB222713_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB246347_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB246348_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB267090_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB270537_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
AB270539_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB270540_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB270541_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
AB270547_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB270548_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB270549_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB270550_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPTD
AB330367_HBSP_P-D          MPLSYQCFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB330369_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB493846_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
AB555496_HBSP_P-D          MPLSYQHFWRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLYD
AB555497_HBSP_P-D          MPLSYQHFWRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB555500_HBSP_P-D          MPLSYQHFRRLLLLDX--EAGPLEEELPRLADEDLNRRVAEDLNLGTPND
AB555501_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
AB674403_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB674404_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB674405_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
AB674406_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB674407_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB674408_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB674411_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
AB674413_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB674415_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
AB674416_HBSP_P-D          MPLSYQHFRRVLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB674417_HBSP_P-D          MPLSYQHFRRLLLLDQ--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
AB674418_HBSP_P-D          MPLSYQHFRRLLLLDQ--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
AB674419_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
AB674420_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB674422_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGXNRRVAEDLNLGNLND
AB674423_HBSP_P-D          MPLSYQHFRSVLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGTLND
AB674424_HBSP_P-D          MPLSYQLFRRLLLLDP--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB674425_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEDELPRLADEGXNRRVAEDLNLGNLND
AB674427_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
AB674428_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPDD
AB674431_HBSP_P-D          MPLSYHHFRRLVLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB674435_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF043593_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF043594_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF121239_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
AF121240_HBSP_C-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
AF151735_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AJ344116_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AJ627215_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
AJ627219_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AJ627220_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AJ627222_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADXDLNHRVAEDLNLGNLND
AJ627224_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY090452_HBSP_P-D          MPLSYQHFRSVLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGKLND
AY090453_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY161150_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY161157_HBSP_P-D          MPLSYQHFRRPLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY161158_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
AY161159_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY233291_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY233294_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY233296_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY236160_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
AY236164_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELSHLADEGLNRRVAEDLNLGNLND
AY721605_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY721606_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY721607_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY721608_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY721611_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY741794_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAQDLNLGDLND
AY741795_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAQNLNLGDLND
AY741797_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAENLNLGNLND
AY741798_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAENLNLGNLND
AY796031_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY945307_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLANEGLNRRVAEDLNLGNLND
DQ111986_HBSP_P-D          MPLSYQHFRRLVLLDX--DAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ336674_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
DQ336676_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
DQ336680_HBSP_P-D          MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGKLND
DQ336681_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGKLND
DQ336682_HBSP_P-D          MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGKLND
DQ336683_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ336685_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLLD
DQ336686_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
DQ336689_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELSHLADEGLNRRVAEDLNLGNLND
DQ464172_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLQEELPHLADEGLNRRVAEDLNLRNLTD
DQ464173_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ464174_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
DQ464181_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ486023_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLEDEGLNRRVAEDLNLGNLND
DQ486025_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
EF103275_HBSP_P-D          MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF103276_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF103277_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF103279_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLANEGLNRRVAEDLNLGNLND
EU414136_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU414138_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU414139_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEEXPRLADEDLNRRVAEDLNLGNLND
EU414141_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLXDEGLNRRVAEDLNLGNLND
EU414143_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRXAEDLNLGNLND
EU594396_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU594398_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNLND
EU594400_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU594401_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU594404_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU594407_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU594416_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU594418_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU594419_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU594426_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU594433_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU594434_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU787437_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU787438_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU787439_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEDLPRLADEGLNRRVAEDLNLGNLND
EU787441_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU787443_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
EU787445_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU787447_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU919197_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU921418_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
EU921419_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNPND
EU939680_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGTLEEELPRLADEGLNRRVAEDLNLGNLND
EU939681_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ349206_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLHLGNLND
FJ349208_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
FJ349218_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ349219_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ349220_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
FJ349233_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ349234_HBSP_P-D          MPLSYQHFRRLLLLD--AEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ349235_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
FJ386590_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562309_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ692532_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPXLADEDLNRRVAEDLNLGNLND
FJ692533_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ904395_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904399_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLAXEGXNRRVAEDLNLGNLND
FJ904402_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGVNRRVAEDLNLGNXND
FJ904410_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904415_HBSP_P-D          MPLSYQHFRSILLLDD--EAGPLEEELPRVAVEGVNRRVAEDLNLGNLND
FJ904419_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904420_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904422_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904424_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
FJ904426_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904427_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904429_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904432_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
FJ904433_HBSP_C-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNXND
FJ904435_HBSP_P-D          MPLSYQHFRRLLLLEE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904438_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
FJ904439_HBSP_P-D          MPLSYQHFRRLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904445_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGSLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904446_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ167301_HBSP_P-D          MPLSYQHFLRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
GQ183448_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGILND
GQ183449_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ183470_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
GQ183472_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ183473_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ183475_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEKLPRLADEGLNRRVAEDLNLGNLND
GQ183478_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ183480_HBSP_P-D          MPLSYRHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ183481_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ183482_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ184322_HBSP_P-D          MPLSYQHFLRLLLLDE--EAGPLEEELPRLADEGLDRRVAEDLNLGTLND
GQ205380_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
GQ477453_HBSP_P-D          MPLSYQHFRRLLLLDA--EAGPLEEELPRLADEDLNRRVAEDLNLGTPND
GQ477455_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ477456_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADQDLNRRVAEDLNLGNLND
GQ477457_HBSP_P-D          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ477459_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ922000_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNPND
GQ922001_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ922003_HBSP_P-D          MPLSYPHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ922004_HBSP_P-D          MPLSYPHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ922005_HBSP_P-D          MPLSYPHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGTLND
GU456636_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456637_HBSP_P-D          MPLSCQHFRRLVLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456638_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGSLEEELPRLADEGLNRRVAEDLNLGNLND
GU456639_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPIEEELPRLADEGLNRRVAEDLNLGNLND
GU456640_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456641_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
GU456642_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
GU456643_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456645_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
GU456646_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456647_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDVNLGNLND
GU456648_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456651_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLHD
GU456652_HBSP_P-D          MPLSYQCFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456654_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGTPND
GU456656_HBSP_P-D          MPLSYQHFRRLLLLDD--ESGPLEEELPRLADEDLNRRVAEDLNLGNLND
GU456657_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
GU456665_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456666_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456667_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456668_HBSP_P-D          MPLSYRHFRRLLLLDN--EAGSLEEELPRLADEGLNRRVAEDLNLGNLND
GU456669_HBSP_P-D          MPLSYQHFRRLLLLDP--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456670_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
GU456672_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456673_HBSP_P-D          MPLSYQHFRRLLLLED--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456674_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEDELPRLADEDLNRRIAEDLNLGDLND
GU456675_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456676_HBSP_P-D          MPLSYHHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456677_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456678_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNG
GU456679_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456681_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU456684_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM750151_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM750152_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEKELPRLADEGLNRRVAEDLNLGNLND
HM750155_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ236014_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
HQ236015_HBSP_P-D          MPLSYQHFRRLVLLDD--DAGPLEEELPHLADEGLNRRVAEDLNLGNLND
HQ236016_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
HQ700439_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
HQ700455_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLAXEGXNXRVAKDXNXGNLND
HQ700458_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
HQ700463_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
HQ700467_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
HQ700472_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPTD
HQ700474_HBSP_P-D          MPLSYHHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ700478_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ700481_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ700510_HBSP_P-D          MPLSYQHFRRLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ833465_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ833466_HBSP_P-D          MPLSYQHFRRLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ833467_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ833468_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
JF754588_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF754590_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754591_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF754592_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754593_HBSP_P-D          MPLSYQHFRRLLFLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754594_HBSP_P-D          MPLSYQHFRRLLLLDD--ESGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754595_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
JF754598_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754599_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754600_HBSP_P-D          MPLSYQHFRRLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754602_HBSP_P-D          MPLSYQHFRRLLLLDH--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
JF754603_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754605_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754606_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754607_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JF754611_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754612_HBSP_P-D          MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEDLNRRVADDLNLGTLND
JF754617_HBSP_P-D          MPLSYQCFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JF754619_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
JF754624_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754626_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
JF754629_HBSP_P-D          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JF754630_HBSP_P-D          MPLSCQHFRRLLLLDN--ESGPLEEELPRLADEGLNRRVAEDLNLGNPND
JF754631_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
JF754632_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754635_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
JN040750_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JN040752_HBSP_P-D          MPLSYQSFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN040755_HBSP_P-D          MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
JN040756_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040757_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040765_HBSP_P-D          MPLSYQYFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040766_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRLVAEDLNLGKLND
JN040767_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGHLND
JN040768_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040772_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAENLNLGNLND
JN040773_HBSP_P-D          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
JN040774_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JN040775_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040776_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
JN040777_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
JN040778_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADAGLNRRVAEDLNLGNLND
JN040779_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040782_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPDD
JN040783_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040784_HBSP_P-D          MPLSYQHFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040788_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040790_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040791_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGSLEEELPRLADEGLNRRVAEDLNLGNLND
JN040793_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGSLEEELPRLADEGLNRRVAEDLNLGNLND
JN040795_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
JN040796_HBSP_P-D          MPLSYQRFRSVLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JN040797_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040800_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLDD
JN040802_HBSP_P-D          MPLSYQHFRRLLLLED--DAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN040804_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNL
JN040806_HBSP_P-D          MPLSYQHFRRLLLLDD--ETGSLEEELPRLADEGLNRRVAEDLNLGNLND
JN040807_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040808_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRIAEDLNLGNLND
JN040810_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040811_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
JN040812_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040813_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN040814_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN040815_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040816_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
JN040817_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040818_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040820_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040822_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
JN040824_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAENLNLGNLND
JN040826_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040827_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN040830_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257148_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257149_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257153_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257159_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNXND
JN257160_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRXVAXDLNLGNLND
JN257162_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257163_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257165_HBSP_P-D          MPLSYQHFRRLLFLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
JN257172_HBSP_P-D          MPLSYRHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257176_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNVNX
JN257178_HBSP_P-D          MPLSYQHFRKLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257186_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257187_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257190_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNLRVAEDLNLGNLND
JN257200_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JN257201_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JN257202_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257203_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257211_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257214_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642128_HBSP_P-D          MPLSYQHFPRLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642129_HBSP_P-D          MPLSYQHFRRLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642132_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
JN642133_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JN642134_HBSP_P-D          MPLSYQHFRRLLLLDA--ESGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642135_HBSP_P-D          MPLSYQHFRRLLLLDN--NAGPLEEELPRLADEGLNRRVAEDLSLGNLND
JN642136_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642138_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642140_HBSP_P-D          MPLSYQHFRRLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642143_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642144_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642145_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGRHRRVAEDLNLGNLND
JN642146_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642147_HBSP_P-D          MPLSYQHFPRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642148_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
JN642153_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642154_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
JN642155_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642156_HBSP_P-D          MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
JN642157_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
JN642158_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642159_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
JN642161_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642162_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
JN642163_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN642165_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642166_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
JN642167_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRHVAEELNLGNLND
JN664919_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN664920_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN664927_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN664941_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN664948_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN688678_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN688679_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN688683_HBSP_P-D          MPLSYQHFRRLVLLNN--KAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN688695_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPIEEELPRLADEGLNRRVAEDLNLGNLND
JN688708_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN688710_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADQGLNHRVAEDLNLGDLND
JN688711_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPVEEELPRLADEGLNRRVAEELNLGNLND
JN688712_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLTLGTLND
JN688713_HBSP_P-D          MPLSYQHFRRLLLLDE--KAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JN792904_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN792907_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADQGLNRRVAEDLNLGNLND
JN792911_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEQELPRLADEGLNRRVAEDLNLGNLND
JN792912_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEQELPRLADEGLNRRVAEDLNLGNLND
JQ687530_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLKEELPRLANEDLNRRVAKDLNLGNLND
JQ687531_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
JQ707479_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707487_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707489_HBSP_P-D          MPLSYRHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707490_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707491_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPVEEELPRLADEGLNRRVAEDLNLGNLND
JQ707493_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ707497_HBSP_P-D          MPLSYQQFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707498_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707510_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707511_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707513_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707517_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707682_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ707689_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ927384_HBSP_P-D          MPLSYQHFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JX096955_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JX310733_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX898694_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774440_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
KC774445_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLANEGLNRRVAKDLNLGNLND
KC774459_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774477_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC875279_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC875290_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC875297_HBSP_P-D          MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC875299_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC875301_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC875312_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC875322_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC875324_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPPEEELPRLADEGLNRRVAEDLNLGNLND
KC875325_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC875329_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC875340_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
KC875341_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
KF053178_HBSP_P-D          MPLSYQRFRRLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF061167_HBSP_P-D          MPLSYXHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF170739_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF192830_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF192831_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF192834_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF471641_HBSP_P-D          MPLSYQHFRRLLCLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF471642_HBSP_P-D          MPLSYQHFRRLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF471645_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
KF471647_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF471649_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF471650_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF471653_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF471657_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF471658_HBSP_P-D          MPLSYQHFRRLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF471659_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF584160_HBSP_P-D          MPLSYXRFRXLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNXND
KF584161_HBSP_P-D          MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF679990_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
KF679994_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF679998_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF779220_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
KF779382_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF922432_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ470889_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ470893_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ470894_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ470895_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
KJ470896_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ647350_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ647352_HBSP_P-D          MPLSYQXFRRLLLLDD--ESGPLEEELPRLADEDLNRRVADDLNLGNLSD
KJ647355_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
KM524342_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM524344_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM524346_HBSP_P-D          MPLSYQHFRRLLLLDD--KAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM524348_HBSP_P-D          MPLSYQLFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM524351_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM524356_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM524358_HBSP_P-D          MPLSYQHFRRLLLLDD--ESGPLEEELPRLADEGLNRRVAEDLNLGTLND
KM577668_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KM577669_HBSP_P-D          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KM577670_HBSP_P-D          MPLSYQYFRRLVLLDN--DAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KM577671_HBSP_P-D          MPQSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM606744_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KM606752_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAENLNLGNLND
KM606753_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM606754_HBSP_P-D          MPLSYQHFRSVLLLDD--EAGPLQEELPRLADEDLNRRVAEYLNLGNHND
KP090179_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPQEEELPRLADEGLNRRVAEDLNLGNLND
KP090180_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP090181_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLRNLND
KP168419_HBSP_P-D          MPLSYQHFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KP995100_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KT366493_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KT366494_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KT366499_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KT366511_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KT749821_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEELHLGNLND
KT749823_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT749828_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLANEDLNRRVAEDLNLGNLND
KU736924_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU736926_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU736927_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX196224_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX196235_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276856_HBSP_P-D          MPLSYQHFRSVLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
KX276857_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNXND
KX357622_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
KX357637_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357639_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX827291_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX827300_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY629630_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY629633_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY629634_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVADELNLGNLND
LT992439_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LT992444_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
M32138_HBSP_P-D            MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRHVAEELNLGNLND
MF618349_HBSP_P-D          MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF925363_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF925379_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF925391_HBSP_P-D          MPLSYQHFRSVLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724215_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724216_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLAXEDLNRRVAEXLNLGNLND
MH724225_HBSP_P-D          MPLSYQHFRRLLWLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724226_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724231_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH724232_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724234_HBSP_P-D          MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724235_HBSP_P-D          MPLSYQHFRRLLCLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
MH724236_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724237_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724238_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH724241_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH724242_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
MH724245_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPHLADEGLNRRVAEDLHLGNLND
MH724246_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEELNLGNLND
MH724247_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLANEDLNRRVAEDLNLGNLND
MH724248_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDFNLRNLND
MH724249_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724250_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLGNLND
MH724251_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052947_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDHNLGNLND
MK052948_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052949_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDFNLGNLND
MK052950_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052951_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052952_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052961_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052963_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052971_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRPADEGLNRRVAEDLNLGNLND
MK052972_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052973_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052974_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADDGLNRRVAEDLNLGNLND
MK355501_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MK507913_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK598636_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNN
MK598637_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNLNN
MK598638_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNN
MK598641_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTN
MK598646_HBSP_P-D          MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK598647_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK598648_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEDLNHRVAEDLNLGNLND
MK598649_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK598650_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK598658_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK598661_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK598672_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK598675_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK598676_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK618423_HBSP_P-D          MPLSYQQFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK618427_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK618429_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK618431_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK618437_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK618441_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK693108_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK693109_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN310706_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN310710_HBSP_P-D          MPLSYQHFRRLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN310712_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN310714_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPXLADEGLNRRVAEDLNLGNLND
MN476100_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN507837_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEEIPRLADEGLNRRVAEDLNLGNLND
MN507839_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPCLADEGLNRRVAEDLNLGNLND
MN507852_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEELNLGNLND
MN507853_HBSP_P-D          MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN585095_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN844882_HBSP_P-D          MPLSYPYFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MT114169_HBSP_P-D          MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT114172_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MT114173_HBSP_P-D          MPLSYQHFRRLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT579901_HBSP_P-D          MPLSYQYFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT591276_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT591277_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT591278_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT591279_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT591281_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT603389_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT603390_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT603393_HBSP_P-D          MPLSYQYFRRLLLLDD--EAGPLEEELPRLANEGLNRRVAEDLNLGDLND
MT603396_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT603398_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT603404_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEQELPRLADEGLNRRVAEDLNLGNLND
MW455166_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601228_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601229_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601231_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADQGLNRRVAEDLNLGDLND
MW601233_HBSP_P-D          MPLSYQHFRRLVLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601234_HBSP_P-D          MPLSYQHFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601236_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601237_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADPDLNRRVAEDLGLGNLND
MW601238_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADQDLNRRVAEDLNLGNLND
MW601239_HBSP_P-D          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MW601240_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601242_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
MW601245_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MW601246_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MW601248_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601251_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601253_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601255_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601259_HBSP_P-D          MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEDLNRRVAEDLNLGDLND
MW601261_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601263_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601265_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MW601268_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNVND
MW601270_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MW601273_HBSP_P-D          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601274_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601275_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601276_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601281_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDLND
MW601285_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601286_HBSP_P-D          MPLSYRHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MW601287_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNPND
MW601293_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601297_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLHD
MW601298_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601299_HBSP_P-D          MPLSYQHFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601301_HBSP_P-D          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601306_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLHD
MW601307_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601311_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601312_HBSP_P-D          MPLSYQHFRRLLLLDD--ESGPLEEELPRLADEGLNRRVAEDLNLGNLHD
MW601314_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601320_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601321_HBSP_P-D          MPLSYQHFRNVLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601323_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601326_HBSP_P-D          MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601328_HBSP_P-D          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601329_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW601330_HBSP_P-D          MPLSYQHFRRLLLLDD--ETGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601331_HBSP_P-D          MPLSYQHFRRLVLLDN--EAGSLEEELPRLADEDLNRRVAEDLTLGNLND
MW601332_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLTD
MW601335_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601338_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601339_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW675897_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW847931_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLBD
MW999636_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAKDLNLGDLND
MW999642_HBSP_P-D          MPLSYQHFRSILLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999644_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999648_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGXLND
MW999649_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999650_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999656_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999657_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999658_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097624_HBSP_P-D          MPLSYPHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097627_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDLND
MZ097628_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDLND
MZ097629_HBSP_P-D          MPLSYQHFRKLLLLDE--VAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097631_HBSP_P-D          MPLSYQHFRRLLLLDT--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097632_HBSP_P-D          MPLSYQHFRRLLLLED--KAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MZ097633_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDLND
MZ097634_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097636_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ097637_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MZ097639_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097642_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097643_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLSD
MZ097645_HBSP_P-D          MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MZ097647_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097651_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MZ097654_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MZ097655_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MZ097656_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEXLNRRVAEDLNLGNLND
MZ097658_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097659_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097660_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097661_HBSP_P-D          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097662_HBSP_P-D          MPLSYQHFRRLLLLDH--TAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MZ097663_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097664_HBSP_P-D          MPLSYQHFLRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097665_HBSP_P-D          MPLSYQHFRRLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097668_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEELNLGNLND
MZ097669_HBSP_P-D          MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MZ097670_HBSP_P-D          MPLSYHCFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097672_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097677_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
MZ097678_HBSP_P-D          MPLSYQCFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MZ097681_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097682_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097683_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNXND
MZ097684_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MZ097686_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097688_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097691_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MZ097692_HBSP_P-D          MPLSYQHFRRLLLLDE--ESGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097693_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
MZ097696_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MZ097697_HBSP_P-D          MPLSYQCFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097698_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MZ097699_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MZ097700_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097701_HBSP_P-D          MPLSYQHFRRLLLLDA--XAGXLEEELPRLADEGLNRRVAEDLNLGNPND
MZ097704_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADQGLNRRVAEDLNLGDLND
MZ097705_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
MZ097707_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLSD
MZ097709_HBSP_P-D          MPLSYQHFRRLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
MZ097710_HBSP_P-D          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097711_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGTLND
MZ097713_HBSP_P-D          MPLSYQHFRRLLLLDE--ESGPLEEELPRLADEGLNRRVAEDLNLGTLTD
MZ097715_HBSP_P-D          MPLSYQHFRSVLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097717_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADQDLNRRVAEDLNLGNLND
MZ097720_HBSP_P-D          MPLSYQHFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097728_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGXXND
MZ097730_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGTLTD
MZ097750_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEXELPRLADEDLNRRVAEDLNLGNLND
MZ097751_HBSP_P-D          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097765_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLBD
MZ097771_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097772_HBSP_P-D          MPLSYQHFRRLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097779_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MZ097780_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLXD
MZ097787_HBSP_P-D          MPLSYPHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097789_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097792_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097794_HBSP_P-D          MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097798_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097799_HBSP_P-D          MPLSYRRFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
MZ097800_HBSP_P-D          MPLSYQHFRKLLLLDX--EAGPLEEELPRLADEDLNRRVAEELNLGNLND
MZ097808_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLXLGNLND
MZ097809_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MZ097812_HBSP_P-D          MPLSYQXFRRLLLLDH--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097813_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097815_HBSP_P-D          MPLSYQHFXRLLLLDD--EAGPLEEELPRLADEDLNRRVAEELNLGNLND
MZ097816_HBSP_P-D          MPLSYHHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097817_HBSP_P-D          MPLSYHHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MZ097823_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGILND
MZ097824_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097827_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097828_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097829_HBSP_P-D          MPLSYQHFRKLLLLED--EAGPLEEELPRLADEDLNRRVAEDLNLGNLSD
MZ097830_HBSP_P-D          MPLSYQHFRRLLLLED--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097832_HBSP_P-D          MPLSYQHFRRLLLLDD--DTGPLEEELPRLAEEGLNRRVAEDLNLGNPND
MZ097834_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097835_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
MZ097837_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPTD
MZ097845_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MZ097846_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097847_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097848_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ097851_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097852_HBSP_P-D          MPLSYQHFRRLLLLDA--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097853_HBSP_P-D          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097855_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097856_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097857_HBSP_P-D          MPLSCQRFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097863_HBSP_P-D          MPLSYQHFRRLLLLED--ESGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097865_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097867_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDLND
MZ097871_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLSD
MZ097872_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGSLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097873_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPIEEELPRLADEGLNRRVAEDLNLGNPND
MZ097875_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MZ097877_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGGNRRVAEDLNLGNLND
MZ097879_HBSP_P-D          MPLSYQHFRRLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097880_HBSP_P-D          MPLSYQHFRRLLLLEE--GAGPLEEELPRLADQGLNRRVAEDLNLGNLDD
MZ097881_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097882_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097883_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097884_HBSP_P-D          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
OK143467_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
OK143472_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDLND
OK143473_HBSP_P-D          MPLSYQHFRRLLLLEG--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
OK143474_HBSP_P-D          MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OK143476_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
OK143486_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OK143487_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
OK143488_HBSP_P-D          MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
OK143489_HBSP_P-D          MPLSYQHFRRLVLLDD--DAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OK143496_HBSP_P-D          MHLSYQHFRRLLLLEG--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OK998520_HBSP_P-D          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OK998522_HBSP_P-D          MPLSYQYFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OK998523_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OK998524_HBSP_P-D          MPLSYQQFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OK998525_HBSP_P-D          MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OK998527_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLKEELPRLANEDLNRRVAKDLNLGNLND
OM025254_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OM304310_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OM304313_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OM304316_HBSP_P-D          MPLSYQHFRRLLLLED--DAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OM304317_HBSP_P-D          MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OM304318_HBSP_P-D          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OM304322_HBSP_P-D          MPLSYQCFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OM304323_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
OM304324_HBSP_P-D          MPLSYQHFRRLLLLDP--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
OM304325_HBSP_P-D          MPLSYQHFRRLLLLDI--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OM304327_HBSP_P-D          MPLSYQHFRRLLLLDT--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OM333239_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNPRVADDLDLGDLND
OM721315_HBSP_P-D          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OM721316_HBSP_P-D          MPLSYQRFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
ON585703_HBSP_P-D          MPLSYQHFRRLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
ON585704_HBSP_P-D          MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
X59795_HBSP_P-D            MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
X65258_HBSP_P-D            MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
X80924_HBSP_P-D            MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEDLNHRVAEDLNLGNLND
X80926_HBSP_P-D            MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
X85254_HBSP_P-D            MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
X97848_HBSP_P-D            MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLWNLND
Z35716_HBSP_P-D            MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB091255_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB091256_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB106564_HBSP_C-E          MPLSYQHFRRILLLDE--EAGPLEDELPRLADEDLNRRVAEDLNLQLPND
AB194947_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNLRVAEDLNLQLPND
AB194948_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB201289_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB205188_HBSP_P-E          MPLSYQHFPRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB205189_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEGLPRLADEDLNRRVAEDLNLQLPND
AB205190_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB219529_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB219534_HBSP_P-E          MPLSYQHFRRLLLLDA--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDD
AB274970_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPHLADEDLNRRVAEDLNLQLPND
AB274973_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB274977_HBSP_P-E          MPLSYQHFRRLLFLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB274978_HBSP_P-E          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB274979_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB274980_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB274981_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLHND
AB274982_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLHND
AB274984_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDD
AB274985_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADADLNRRVAEDLNLQLPTD
AB915177_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB915180_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAKDLNLEVPND
AM494689_HBSP_P-E          MPLSYLHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AM494695_HBSP_P-E          MPLSYQHFRRLLLLDT--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AM494699_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AM494705_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AM494711_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AM494712_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AM494714_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLHLPND
AY738144_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPLLADEDLNRRVAEDLNLQLPND
DQ060826_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
DQ060830_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADDDLNRRVAEDLNLQLPND
EU239219_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEDELPRLADEDLNRRVAEDLNLQLPND
EU239220_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
EU239221_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
EU239222_HBSP_P-E          MPLSYQHFLRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
EU239223_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEDELPRLADEDLNRRVAEDLNLQLPND
FJ349226_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
FJ349239_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
FN545821_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
FN545823_HBSP_P-E          MPLSYQHFRRXLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
FN594748_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEDELPRLADEDLNRRVAEDLNLQLPND
FN594749_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
FN594750_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
FN594751_HBSP_P-E          MPLSYQHFRSILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
FN594753_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQVPND
FN594756_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
FN594758_HBSP_P-E          MPLSCQRFRRILLLDE--EAGPLEEELPHLADADLNRRVAEDLNLQLPND
FN594761_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEDELPRLADEDLNRRVAEDLNLQLPND
FN594762_HBSP_P-E          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
FN594765_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDD
FN594766_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPHLADEDLNRRVAEDLNLQLPND
GQ161757_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161759_HBSP_P-E          MPLSYQHFLRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161760_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161762_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161763_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161764_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161765_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161769_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161771_HBSP_P-E          MPLSYQHFRRILLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161775_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDD
GQ161776_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161778_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161779_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161780_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEDLPRLADEDLNRRVAEDLNLQLPND
GQ161783_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAENLNLQLPND
GQ161785_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161786_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPND
GQ161796_HBSP_P-E          MPLSYQHFRRILLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161797_HBSP_P-E          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161799_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNFQLPND
GQ161803_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRHVAEDLNLQLPND
GQ161814_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLANEDLNRRVAEDLNLQLPND
GQ161822_HBSP_P-E          ---SYQQLRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161825_HBSP_P-E          MPLSYQHFRRLLLLDQ---AGPIEEELPHLADEDLNRRVAEDLNLQLPND
GQ161826_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161831_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161833_HBSP_P-E          MPLSYQQLRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
GQ161834_HBSP_P-E          MPLSYQLFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363565_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEDELPRLADEDLNRRVAEDLNLQLPID
HM363566_HBSP_P-E          MPLSYPHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363569_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363574_HBSP_P-E          MPLSYPHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363575_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQVPND
HM363578_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPTD
HM363582_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363588_HBSP_P-E          MPLSYQHFLRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363590_HBSP_P-E          MPLSYQHFLRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363596_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363597_HBSP_P-E          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363600_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRHVAEDLNLQLPDD
HM363601_HBSP_P-E          MPLSYQHFLRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363602_HBSP_P-E          MPLSYQHFRRLLLLDE--DAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363603_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPTD
HM363604_HBSP_P-E          MPLSYPHFRRMLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
HM363605_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQVPND
HM363607_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADADLNRRVAEDLNLHLPTD
HM363611_HBSP_P-E          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLHLPND
JQ000008_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
JQ000009_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KF170741_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNPNPPPD
KF170742_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLHND
KF849713_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KF849716_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KF849718_HBSP_P-E          MPLSYQHFRSVLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KF849720_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KF849723_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KF849724_HBSP_P-E          MPLSYQHFRRLLLLDE--GAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KF849726_HBSP_P-E          MPLSYHHFRSVLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KF849728_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLQLPTD
KF922439_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPHD
KM606738_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KM606739_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPIEEELPRLADEDLNRRVAEDLNLQLPND
KT192626_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPHD
KT749841_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KU736893_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADXDLNRRVAEDLNLQLPND
KU736901_HBSP_P-E          MPLSYQHFRRILLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KU736904_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEELNRRVAEDLNLQLPND
KU736913_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPXD
LT623842_HBSP_P-E          MPLSYQXFRRXLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
LT623844_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLBRRVAEDLNLQLPND
LT623846_HBSP_P-E          MPLSYQHFRRILLLDE--EAGHLEEELPRLADEDLNRRVAEDLNLQLPND
LT623847_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
LT623848_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVADDLNLQLPND
LT623849_HBSP_P-E          MPLSYQHFRRXLLLDE--EAGPLEEELPXLXDEDLNRRVXEDLNLXLPND
LT623851_HBSP_P-E          MPLSYQHFRRLLLLDX--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MF772355_HBSP_P-E          MPLSYQHFLKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MF772356_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLHLPND
MF772357_HBSP_P-E          MPLSYPHFRKLLLLDE--ESGPLEEELPRLADEDLNRRVAEDLNLQLPDD
MF772359_HBSP_P-E          MPLSYQHFRRILLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLQLPTD
MF772361_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAKDLNLQLPND
MF772362_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MH580638_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MH580645_HBSP_P-E          MPLSYQHFRRLLLLDQ--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDD
MH580648_HBSP_P-E          MPLSYQHFLRLLLLDE--EAGPLEEELPRLADEDLNRRVADDLNLHLPND
MN507840_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADVDLNRRVAEDLNLQLPDD
MN967526_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MN967527_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MT427113_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLNND
MT427114_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MT427118_HBSP_P-E          MPLSYQHFRRILLLDA--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MT427126_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MT427138_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRIADEDLNRRVAEDLNLQLPND
MT427142_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MT427152_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MT427156_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MT427170_HBSP_P-E          MPLSYQHFRRILLLDE--EAAPLEEELPRLADEDLNRRVAEDLNLQLPND
MT427171_HBSP_P-E          MPLTYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MT427175_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPNE
MW455162_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPTD
MW455164_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MW455165_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MW679682_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPPLPDEDLNRRVAEDLNLHLPND
MW926548_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADQDLNRRVAEDLNLHVPND
MW926549_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MW926551_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQPPID
MW926554_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MW926555_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVADDLNLHLPND
MW926556_HBSP_P-E          MPQSYQHFRRLLLLDH--EAGPLEEELPRLADEDLNRRVAEDLHLQLPDD
MW926558_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQVHND
MW926559_HBSP_P-E          MPLSYQHFRRLLLLDE--ESGPLEEELPRLADEDLNRRVAEDLNLQLPND
MW926560_HBSP_P-E          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADADLNRRVAEDLNLQLPND
MW926563_HBSP_P-E          MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MW926565_HBSP_P-E          MPLSYQHFRSXLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MW926566_HBSP_P-E          MPLSYQHFRRLLLLDE--EVGPLEEELPRLADEDLNRRVAEDLNLQLPND
MW999659_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MW999661_HBSP_P-E          MPLSYQHFRRILLLDE--ESGPLEEELPRLADEDLNRRVAEDLNLHLPND
MW999678_HBSP_P-E          MPLSYPHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MZ962190_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MZ962191_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MZ962192_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MZ962193_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MZ962196_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MZ962197_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MZ962198_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
MZ962199_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
ON093163_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
ON402785_HBSP_P-E          MPLSYQHFRRILLLDE--EAGPLEEELPRLADVDLNRRVAEDLNLQLPDD
AB056513_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
EF464097_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
EF634480_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
FJ023674_HBSP_P-G          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FR714503_HBSP_P-G          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
GU565217_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
HE981171_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
HE981174_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
JF439792_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLKLPND
JF439794_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
JF439796_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLKLPND
JF439797_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADKDLNRRVAKDLHLQLPND
JQ707671_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
KF767451_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
KF779267_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGLLEEELPRLAEPSPNSRVAEDLHLQLPND
KF779357_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
MT426120_HBSP_P-G          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRIAEDLHLQLPND
AB059659_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLHLPND
AB059660_HBSP_P-H          MPLSCQQFRRLVLLDN--EAGPLEEELPRLADEDLNHRVAEDLHLQLPND
AB059661_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
AB064315_HBSP_P-H          MPLSYQRFLSVLLLDN--EAGPLEEELPRLADEDLNHRVAEDLNLQLPND
AB179747_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNLRVAEDLNLQLPND
AB205010_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNLRVAEDLNLQLPND
AB275308_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNLRVAEDLNLQLPND
AB353764_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNLRVAEDLNLQLPND
AB375159_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNHRVAEDLNLQLPND
AB375163_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNHRVAEDLNLQLPND
AB818694_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNLRVAEDLNLQLPND
AY090457_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNHRVAEDLNLQLPND
AY090460_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNHRVAEDLNLQLPND
EF157291_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNLRVAEDLNLQLPND
FJ356715_HBSP_P-H          MPLSYQRFRRLLLLDN--EAGPLEEELPRLADEDLNHRVAEDLNLQLPND
FJ356716_HBSP_C-H          MPLSYPHFRRLLLLDN--EAGPLEEELPRLADEDLNHRVAEDLNLQLPND
HM066946_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNHRVAEDLNLQLPND
HM117850_HBSP_P-H          MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNHRVAEDLNLQLPND
MT622523_HBSP_P-H          MPLSYQHFRRLLLLDH--EAGPLEEELPRLADEDLNHRVAEDLNLHLPSD
AB033557_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AB033559_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB049609_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB105172_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNPNE
AB188243_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB194949_HBSP_P-RF-AE      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB195950_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB195956_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB205152_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB222708_HBSP_P-RF-AD      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB241109_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB270535_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB270538_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB300369_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EVGPLEEELPRLADEGLNRRVAEELNLGNLNE
AB330368_HBSP_P-RF-DA      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB367393_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLKLGNLNE
AB367400_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB453985_HBSP_P-RF-AC      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB493838_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDDLNRRVAEDLNLGNPNE
AB493840_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNPNE
AB493842_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNLNE
AB642096_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB674412_HBSP_P-RF-DE      MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB674434_HBSP_P-RF-DE      MPLSYQHFRSLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB674436_HBSP_P-RF-DE      MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB674504_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB933279_HBSP_P-RF-AG      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
AB933283_HBSP_P-RF-AG      MPLSYQHFRKLLLLDDXTXAGPLEEELPRLADADLNRRVAZDLNLGNLND
AF233236_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF297619_HBSP_P-RF-DA      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF411409_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AM494716_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011102_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNPNE
AP011103_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNPNE
AP011108_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
AY057948_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
AY161140_HBSP_P-RF-AD      MPLSYQHFRRLLLLDVETEAGSLEEELPRLADEDLNRRFAEDLNLGNLND
AY161145_HBSP_P-RF-AD      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY161147_HBSP_P-RF-DA      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY206374_HBSP_P-RF-CB      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
AY233295_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY236161_HBSP_P-RF-DA      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY247030_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY800249_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY817509_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLDEELSRLADEGLNRRVAEDLNLGNLND
AY817510_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY817512_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY817513_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY862864_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY862865_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY862866_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLRNLND
DQ315777_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ464164_HBSP_P-RF-DE      MPLSYPHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVEEDLNLGNLND
DQ464165_HBSP_P-RF-DE      MPLSYPHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ464166_HBSP_P-RF-DE      MPLSYPHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ464167_HBSP_P-RF-DE      MPLSYPHFRRLLLLDD--EAGPLEEELPRLPDEDLNRRVPEDLNLGNLND
DQ478886_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
DQ478889_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRHVAEDLNLGNLND
DQ478890_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
DQ991753_HBSP_P-RF-DE      MPLSYHHFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
EF103282_HBSP_P-RF-AD      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF103283_HBSP_P-RF-AD      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF103284_HBSP_P-RF-AD      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF103285_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
EF494376_HBSP_P-RF-CA      MPLSYQHFWKLLLLDDGTEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EF494378_HBSP_P-RF-CA      MPLSYQYFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLSLGNLNE
EU185780_HBSP_P-RF-AD      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU589337_HBSP_P-RF-CB      MPLSYQHFRKLLLLDTG--AGPLEEELPRLADEDLNRRVAEDLNLGNLNE
EU594406_HBSP_P-RF-DE      MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU660227_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
EU717211_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
EU787444_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLLHEGLLRRDEKDLNLGNLGE
EU833889_HBSP_P-RF-GA      MHLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPSD
EU833890_HBSP_P-RF-GA      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPDD
EU833891_HBSP_P-RF-GC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
EU835240_HBSP_P-RF-GC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU871995_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871999_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU872014_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU881995_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNG
EU882006_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU916228_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNG
EU919166_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
EU939547_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939620_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939621_HBSP_P-RF-CB      MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLSE
EU939623_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGTLNE
EU939631_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939668_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023659_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ023662_HBSP_P-RF-GC      MPLSYQQFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
FJ023665_HBSP_P-RF-GC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
FJ032343_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
FJ349207_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
FJ349241_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
FJ361772_HBSP_P-RF-GC      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386586_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ386643_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ386674_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ518810_HBSP_P-RF-BE      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562223_HBSP_P-RF-CD      MPLSYHHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
FJ562226_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
FJ562227_HBSP_P-RF-CB      MPLSYQHFRKLLLLDV--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562247_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
FJ562263_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--NAGPLEDELPRLADEGLNRRVAEDLNLGNLND
FJ562317_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ692536_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLRNLND
FJ882610_HBSP_P-RF-GC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ882611_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--AEAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ882612_HBSP_P-RF-GC      MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ882613_HBSP_P-RF-GC      MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ904394_HBSP_P-RF-DE      MPLSYQHFRXLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904396_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
FJ904397_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904398_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGXNRRVAEDLNLGNLND
FJ904400_HBSP_P-RF-DE      MPLSYQSFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
FJ904403_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904404_HBSP_P-RF-DE      MPLSYQHFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904405_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGVNRRVAEELNLGNLND
FJ904407_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLTD
FJ904408_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ904414_HBSP_P-RF-DE      MPLSYQHFRRLLFLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904416_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGXNRRVAEDLNLGNLND
FJ904430_HBSP_P-RF-DE      MPLSYQHFRRLVLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGDLND
FJ904436_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904437_HBSP_P-RF-DE      MPLSYQQFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ904441_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
FJ904442_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLKEELPRLADKGLNLRVAEDLNLGNLND
FJ904444_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
FJ904447_HBSP_P-RF-DE      MPLSYQHFRRLVLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
FN594767_HBSP_P-RF-DE      MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLQLPND
FN594769_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FN594771_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNS
FR714490_HBSP_P-RF-GB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
FR714496_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPNE
GQ161754_HBSP_P-RF-DE      MPLSYQHFRRILLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ161767_HBSP_P-RF-AE      MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ161788_HBSP_P-RF-AE      MPLSYQHFRSVLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ161806_HBSP_P-RF-EA      MPLSYQHFRXLLLLDX--EAGPLEEELPRLADEDLNRRVAEDLNLQLPDD
GQ161837_HBSP_P-RF-AE      MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GQ331048_HBSP_P-RF-AE      MPLSYQHFRKLLLLDEGTEVGPLEEELPRLADEDLNRRVAEDLNLGNPNE
GQ377522_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377539_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377548_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377549_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377556_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--GAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377564_HBSP_P-RF-CB      MPLSYQHFRKLQLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377565_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377592_HBSP_P-RF-CB      MPLSYQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377602_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADDGLNRRVAEDLNLGNLNE
GQ377604_HBSP_P-RF-CB      MPLSYQHFRKLLLLDK--DAGTLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377607_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377611_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
GQ377626_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
GQ377627_HBSP_P-RF-CD      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377635_HBSP_P-RF-BC      MPLSYQRFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475335_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GU177079_HBSP_P-RF-DE      MPLSYQHFRRLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU357843_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GU385774_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GU563560_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HE981180_HBSP_P-RF-GF      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
HF571060_HBSP_P-RF-AE      MPLSYQHFRRILLLDE--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
HM011502_HBSP_P-RF-EB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM146131_HBSP_P-RF-AD      MPLSYQHFRKLLLLDDEAEVGPLEGELPRLADEDLNRRVAEDLNLGNLND
HM750133_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM750147_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
HQ684848_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HQ684849_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ700492_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEELNLGNLND
HQ700493_HBSP_P-RF-DE      MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
HQ700494_HBSP_P-RF-DE      MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGILND
HQ700503_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
HQ700520_HBSP_P-RF-CB      MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAADLNLGNPNE
HQ700523_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
HQ700526_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HQ700527_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
HQ700528_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
HQ700530_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
HQ700531_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
HQ700534_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--ESGPLEEELPRLADEDLNRRVAEDLNLGNLND
HQ700536_HBSP_P-RF-DE      MPLSYQHFRRLVLLDD--EAGPLEEELPRLAXEDLNRRVAEDLNLGNLND
HQ700541_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
HQ700579_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
J02202_HBSP_P-RF-DE        MPLSYQRFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF436922_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JF436923_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVVEDLNLGNLNE
JF439776_HBSP_P-RF-AG      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLHLQLPND
JF440019_HBSP_P-RF-AG      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF440021_HBSP_P-RF-AG      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF491448_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF491451_HBSP_P-RF-DC      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF491455_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF754613_HBSP_P-RF-DE      MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JF828933_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN040803_HBSP_P-RF-DE      MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
JN257154_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
JN257189_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257191_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257204_HBSP_P-RF-DE      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
JN257206_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN257216_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642127_HBSP_P-RF-DE      MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN642137_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNPND
JN642139_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--ESGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN664929_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JN664946_HBSP_P-RF-DA      MPLSYQHFRKLLLLDVEGEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN688689_HBSP_P-RF-DE      MPLSYQHFRRLLLLDN--KAGPLEEELPRLADQGLNRRVAEDLNLGNLND
JN688715_HBSP_P-RF-DE      MPLSYQSFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
JN688717_HBSP_P-RF-DE      MPLSYQLFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLSD
JQ027310_HBSP_P-RF-CB      MPLSYQHFRKLLLLDX--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040142_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
JQ040146_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040174_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ272886_HBSP_P-RF-GF      MPLSYPHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLQLPND
JQ707421_HBSP_P-RF-GA      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
JQ707424_HBSP_P-RF-GA      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPDD
JQ707426_HBSP_P-RF-GA      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPDD
JQ707432_HBSP_P-RF-GA      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
JQ707463_HBSP_P-RF-GA      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
JQ707468_HBSP_P-RF-GA      MPLSYQHFRRLLLLDE--EAGPLGEELPRLADEDLNRRVAEDLHLQLPND
JQ707474_HBSP_P-RF-GA      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEDLNRRVAEDLHLQLPND
JQ732168_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNLRVAEDLNLGNLNE
JQ801477_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGBLND
JX429898_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX504540_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
JX661486_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX661487_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC315400_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774212_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774258_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774305_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774323_HBSP_P-RF-CB      MPLSYHHFGKLLWTHD--EAGPIGALLPRLADEKTNCRVPEDLNLGDLNE
KC774344_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774431_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774442_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774447_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774448_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774449_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
KC774454_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774458_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774463_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774468_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC774478_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774481_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774482_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEDLNRRVAEDLNLGNLND
KC774486_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF053160_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF053166_HBSP_P-RF-BC      MPLSYPHFLRLLLLEHG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF053179_HBSP_P-RF-BC      MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF053188_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVADDLNLGNLNE
KF170740_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF214656_HBSP_P-RF-AC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214680_HBSP_P-RF-GC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KF219922_HBSP_P-RF-GH      MPLSYQHFRRLLLLD--XEAGPLEEELPRLADEDLNRRVAEDLHLQLPND
KF679991_HBSP_P-RF-DE      MPLSYQHFRSVLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF873530_HBSP_P-RF-CB      MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
KF873531_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEXLNRRVAEDLNLGNPND
KF873532_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KF873534_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF873535_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KF873537_HBSP_P-RF-CB      MPLSYQHFRKLLLLDX--EAGPLEEELPRLADEGLNRRVAEDLNLGDPND
KF873540_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KF917451_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173279_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173325_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173329_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLNE
KJ173350_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173358_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ410520_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ470884_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ470887_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ470892_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ470898_HBSP_P-RF-DE      MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ586810_HBSP_P-RF-AF      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLQLPND
KJ647349_HBSP_P-RF-DE      MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ647351_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADQGLNRRVAEDLNLGNLND
KJ647356_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ717794_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRFAEDVNLGNLNE
KJ717800_HBSP_P-RF-CB      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRLAEDLNLGNLNE
KJ717814_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRFAEDLNLGNLNE
KJ717816_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717832_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLNE
KJ803822_HBSP_P-RF-CB      MPLSYQCFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KM524336_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM524337_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM577663_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM577664_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM577666_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KM577667_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM606741_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM606751_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLANEGLNRHVAENLNLGNLND
KP148352_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KP148441_HBSP_P-RF-GC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KP148449_HBSP_P-RF-GC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNPND
KP148450_HBSP_P-RF-GC      MPLSYQQFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KP168420_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP168421_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP276253_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
KP276254_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP288875_HBSP_P-RF-DE      MPLSYQYFRRLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
KP995112_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KR013843_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT003704_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT366503_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU679939_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KU679940_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGBPND
KU679945_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU679952_HBSP_P-RF-CB      MPLSYQHFRKLLLLDN--EAGPLXEELPRLABEGLNRRVAXDLNLGNPND
KU695742_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELHRLADEGLNRRVAEDLNLGNLNE
KU711666_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU736914_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU736915_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU736922_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--XAGPLEEELPRLADEGLNRRVAXDLNLGNLND
KU963862_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964313_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964366_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
KU964367_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
KX096713_HBSP_P-RF-CA      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KX357623_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX357624_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX357625_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX357626_HBSP_P-RF-DE      MPLSYQHFRRLLLLEE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX357628_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLHLGDLND
KX357629_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX357630_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX357631_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KX357636_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX357641_HBSP_P-RF-DE      MPLSYQHFRRLLFLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX660680_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEEXPRXADEGLNRRVAEDLNLGNLND
KX660684_HBSP_P-RF-DC      MPLSYQHFRKLLLVDD--EAGPLEDELPRLADEGLNRRVAKDLNLGNLND
KX660685_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADKGLNRRVAKDLDLGNLND
KX660686_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
KX660689_HBSP_P-RF-DC      MPLSYQDFRKLLLLDD--EAGPLEDELPRLADEDLNRRVAEDLNLGNLND
KX765835_HBSP_P-RF-GC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX827299_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY363263_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470843_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470844_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470845_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--KAGPLEEELPRLADEGLNRRVAEDLNLGNPNE
KY470854_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470856_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470996_HBSP_P-RF-GC      MPLSYQQFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
KY470998_HBSP_P-RF-GC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
KY629632_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
KY670781_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
LC416040_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
M38454_HBSP_P-RF-CB        MPLSYQHFRKLLLLDXXXEAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF488702_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLKEELPHLADEGLNRRVAEDLNLGNLND
MF488705_HBSP_P-RF-AD      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNPND
MF618346_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF925381_HBSP_P-RF-CB      MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925382_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925384_HBSP_P-RF-DB      MPLSYQHFRRLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF925386_HBSP_P-RF-AC      MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLND
MF925388_HBSP_P-RF-DC      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF925389_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF925396_HBSP_P-RF-DC      MPLSYQYFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF925402_HBSP_P-RF-BD      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG826141_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG826142_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG826144_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
MG826145_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEKELPRLADEDLNRRVAEDLNLGNPND
MG826146_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MG826147_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG826149_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MG826150_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG826151_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPPLAEEGFNRRVAEDLNLGNLND
MG893561_HBSP_P-RF-CB      MPLSYQHFGKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MH368022_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--VEAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MH464835_HBSP_P-RF-DE      MPLSYQHFRRLVLLDDEXXAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH464846_HBSP_P-RF-DE      MPLSYQHFRRLLLLDDEXXAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH464850_HBSP_P-RF-DA      MPLSYQHFRKLLLLDDEXXAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464851_HBSP_P-RF-DE      MPLSYQHFRRLLLLDDEXXAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH481858_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH481859_HBSP_P-RF-DE      TPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH481860_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEGLPRLADEDLNRRVAEDLNLGNLND
MH685719_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724239_HBSP_P-RF-DE      MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH724240_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH724243_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEEVPRLADEGLNLRVAEDLNLGNLND
MH746811_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPSD
MH746812_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MH746813_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEKELPRLADEDLNRRVAEDLNLGNPND
MK052967_HBSP_P-RF-BD      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052968_HBSP_P-RF-BD      MPLSYQHFRKLLLLDE--EAGPLEEELPRPADEGLNRRVAEDLNLGNLND
MK052969_HBSP_P-RF-DE      MPLSYQHFRRLLLLED--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052970_HBSP_P-RF-BD      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADKGLNRRVTKDLNLGNLND
MK052976_HBSP_P-RF-BD      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534555_HBSP_P-RF-BC      MPLSYQHFRKLLLLEE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534560_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534566_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MK534582_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MK534583_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNPND
MK534585_HBSP_P-RF-CB      MPLSYQHFRKLPLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534587_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MK534589_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
MK534590_HBSP_P-RF-BC      MPLSYQCFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534594_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MK534606_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534615_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534632_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534663_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
MK534665_HBSP_P-RF-CB      MPLSYPHFRRLVLLDN--GAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534669_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MK534700_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534701_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MK534706_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534715_HBSP_P-RF-BC      MPLSYQHFRKLLLLEE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534718_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534719_HBSP_P-RF-CB      MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MK534725_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534726_HBSP_P-RF-BC      MPLSYQHFRKLPLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534730_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534734_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
MK534735_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK618440_HBSP_P-RF-DE      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN507835_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDPND
MN650072_HBSP_P-RF-DC      MPLSYLHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN650076_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN650079_HBSP_P-RF-DC      MPLSYQHFRRLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN650083_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN650087_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN657317_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPR--DEGLNRRVAEDLNLGNLND
MN683571_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN683581_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683582_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683588_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683590_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683592_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN683609_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683612_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683618_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADQGLNRRVAEDLNLGDPND
MN683622_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683624_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683626_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683628_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN683634_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683656_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683657_HBSP_P-RF-DC      MPLSYQHFRKLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683662_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683673_HBSP_P-RF-DC      MPLSYRHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683675_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN683680_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN683688_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN683699_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN683712_HBSP_P-RF-DC      MPLSYQHFRKLLLLDN--DAGPLEDELPRLADEGLNRRVAEDLNLGNPND
MN683718_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDVLPRLADEGLNRRVAEDLNLGNLND
MN683721_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN683722_HBSP_P-RF-DC      MPLSYRHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MN683725_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MN683730_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
MT210033_HBSP_P-RF-DE      MPLSYQHFRRLLLLDDEAXXGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426114_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426455_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426463_HBSP_P-RF-CB      MPLSYQHFRKLLLLDDA--AGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426464_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426465_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNHNE
MT426471_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426472_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEALNRRVAEDLNLGNLNE
MT426473_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426481_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426483_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426491_HBSP_P-RF-CB      MPLSYQHFRKLLLSDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426500_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426501_HBSP_P-RF-CB      MPLSYQHFRKPLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426523_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426524_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426526_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426531_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426533_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426539_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426540_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426544_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426546_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLANEGLNRRVAEDLNLGNLNE
MT426550_HBSP_P-RF-CB      MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426553_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426562_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT591274_HBSP_P-RF-DE      MPLSYQHFRRLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645039_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
MT645045_HBSP_P-RF-BC      MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645048_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645056_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645062_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645067_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645070_HBSP_P-RF-DC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601227_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601235_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601241_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601260_HBSP_P-RF-DE      MPLSYQHFRRLLLLDN--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601264_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MW601296_HBSP_P-RF-DE      MPLSYQHFRRLVLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601310_HBSP_P-RF-DE      MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW601317_HBSP_P-RF-DE      MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ043066_HBSP_P-RF-AC      MPLSYQHFRKLLLLDVGTDTGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ097652_HBSP_P-RF-DE      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGDLND
MZ097680_HBSP_P-RF-DE      MPLSYQHFRRLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097703_HBSP_P-RF-DE      MPLSYQHFRRLLLLDH--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097758_HBSP_P-RF-DE      MPLSYQHFRRLLLLXD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097766_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEXLNRRVAEDLNLGNLND
MZ097806_HBSP_P-RF-DE      MPLSYQHFRRLVLLDN--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097814_HBSP_P-RF-DE      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLXNXND
MZ097822_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ097826_HBSP_P-RF-DE      MPLSYQHFRRLLLLDV--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ097838_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ439768_HBSP_P-RF-GC      MPLSYQHFRKLLLLDH--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
OK143485_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
OK143491_HBSP_P-RF-DE      MPLSYQHFRRLLLLED--EAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OK143494_HBSP_P-RF-DE      MPLSYQHFRRLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
ON854595_HBSP_P-RF-EA      MPLSYQRFRRILLLDEEAEAGPLEEELPRLADEDLNRRVAEDLNLQLPND
X65259_HBSP_P-RF-DA        MPLSYQHFRRLLLLHD--EAGPLEEELPRLPDQGLNRRVAEDLNLGNLND
X68292_HBSP_P-RF-DA        MPLSYQHFRKLLLLDD--GTGPLEEELPRLADEGLNRRVAEDLNLGNLNV
Y18856_HBSP_P-RF-CB        MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNPRVAEDLNLGNLNE
Y18857_HBSP_P-RF-CB        MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU747320_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ184323_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707553_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707556_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707558_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707559_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707572_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779365_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749825_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749826_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749842_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KY886219_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043025_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
ON854561_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854573_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854574_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854580_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854583_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854585_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854589_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854592_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854593_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB116079_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB116080_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB222707_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB246337_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB246338_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB300366_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB300367_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453979_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453980_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453981_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453983_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB453984_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB480036_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB480038_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB480039_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB480040_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB480041_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB549213_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697487_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697488_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697489_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697491_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697492_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697495_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697496_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697497_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697498_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697499_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697501_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697503_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697504_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697505_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697507_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697508_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697509_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB697512_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB775198_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB775199_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB775200_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB775201_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB937792_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB937793_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB937794_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF043580_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AF297624_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AJ012207_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AM295795_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AM295797_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY128092_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY862867_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY862868_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EF208113_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU086721_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU414133_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594383_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594384_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594385_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594387_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594389_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594390_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594391_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594392_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594393_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594394_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU594395_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859899_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859900_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859901_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859902_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859903_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859904_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859905_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859906_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859907_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859908_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859909_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859910_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859911_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859913_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859914_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859915_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859916_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859917_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859918_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859919_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859920_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859921_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859922_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859923_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859924_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859925_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859926_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859927_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859928_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859929_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859930_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859931_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859932_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859933_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859935_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859936_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859937_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859939_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859940_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859941_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859942_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859943_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859945_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859946_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859947_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859948_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859949_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859950_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859953_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FJ349222_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FJ349224_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ414522_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477461_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477467_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477470_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477479_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477482_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477487_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477490_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477503_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563546_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563553_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563554_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563555_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563557_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563558_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563562_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ687529_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707534_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707541_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707544_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707546_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707547_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707548_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707552_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707555_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707557_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707560_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707562_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707563_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707564_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707565_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707566_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707567_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707568_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707570_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707573_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707609_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707610_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707611_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707612_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707613_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707614_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707615_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707616_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707617_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707618_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707619_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707620_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707621_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707622_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707623_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707624_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707625_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707626_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707627_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707628_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707629_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707630_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707631_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707632_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707633_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707634_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707636_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707637_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX096953_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX310721_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX310722_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX310723_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX310724_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JX310725_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779211_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779227_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779231_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779243_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779244_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779245_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779246_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779247_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779248_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779249_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779251_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779252_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779253_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779254_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779255_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779256_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779257_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779258_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779259_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779262_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779271_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779273_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779274_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779275_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779277_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779279_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779281_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779282_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779286_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779287_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779290_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779291_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779294_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779299_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779304_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779305_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779306_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779307_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779309_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779310_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779313_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779314_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779315_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779316_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779317_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779319_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779320_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779321_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779322_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779323_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779324_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779325_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779326_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779328_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779330_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779333_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779335_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779336_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779338_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779339_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779342_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779346_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779347_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779350_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779352_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779355_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779362_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779363_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779364_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779366_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779368_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779369_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779370_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779371_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779372_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779373_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779378_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779379_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779383_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779385_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779386_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ586809_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843166_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843173_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843184_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843188_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843192_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843214_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843215_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ854708_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ854710_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KM606742_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KM606746_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KM606749_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP274927_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP274928_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718087_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718088_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718090_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718091_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718092_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718093_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718094_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718096_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718097_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718098_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718099_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718100_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KP718101_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749824_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749829_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749830_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749831_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749832_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749835_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749836_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749837_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749840_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749843_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749844_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749850_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KU605532_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KX827293_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KX827298_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KY003230_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KY382410_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
L13994_HBSP_P-A            MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC074724_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC311241_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC311242_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC311243_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC430617_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC458430_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC458431_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC517161_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC592168_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC592169_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC592170_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC677081_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC677082_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
LC677083_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MH932713_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426093_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426094_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426095_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426097_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999477_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999478_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999479_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999480_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999481_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999484_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999486_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999488_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999489_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999490_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999491_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999492_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999493_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999495_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999496_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999497_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999498_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999499_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999500_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999501_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999502_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999504_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999505_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999507_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999508_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999509_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999513_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999514_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999515_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999516_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999518_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999520_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999521_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999522_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999524_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999527_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999528_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999529_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999530_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999531_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999532_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999535_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999537_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999539_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999540_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999541_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999542_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999545_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999547_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999548_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999549_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999550_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999551_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999554_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999556_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999557_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999558_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999559_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999560_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999562_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999563_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999564_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999565_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999566_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999571_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999572_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999573_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999574_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999577_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999578_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999579_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999580_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999583_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999584_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999586_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999587_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999589_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999590_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999592_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999596_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999599_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999600_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043026_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043036_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043040_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043042_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043047_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043055_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043069_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043072_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043084_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
OK106253_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
X70185_HBSP_P-A            MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
Z35717_HBSP_P-A            MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AB933282_HBSP_P-RF-AG      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859898_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLANADLNRRVAEDLNLGNLND
AF536524_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
HM363613_HBSP_P-A          MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB246335_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB453986_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF090842_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY161143_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY161144_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY373432_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214657_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214661_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214663_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214665_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ194506_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KM243029_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366469_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366471_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925361_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925372_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MT426088_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999476_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999485_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999523_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999525_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999543_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999544_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999561_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999570_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999585_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999588_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925404_HBSP_P-RF-AC      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF297621_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233290_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357647_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
OK274310_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233277_HBSP_P-RF-AC      MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB453987_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB937791_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB937796_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF297625_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233278_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233282_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY233283_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934769_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934770_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934771_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934774_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU410082_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692557_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692562_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692563_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692574_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199974_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199978_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FM199979_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GU563545_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
GU563548_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
HM535200_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JX154579_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JX154580_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JX154581_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JX154582_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922424_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922425_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922426_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922427_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922428_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854693_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854695_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854700_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854707_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KM519452_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KM519453_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KM606748_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168423_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168425_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP718085_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP718086_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT347088_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT347091_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT347092_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU605535_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU736920_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357642_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357645_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357650_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF772351_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925368_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464812_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464815_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464828_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512456_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512457_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512458_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512459_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512461_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512465_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512467_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512470_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512472_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512473_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999553_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043088_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON585702_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854582_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999526_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999536_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999552_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999575_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859938_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477466_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MG877723_HBSP_P-A          MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MG877724_HBSP_P-A          MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MG877725_HBSP_P-A          MPLSYQHFRKLLLLDNDTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP718089_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749846_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749847_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749849_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ184324_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707531_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707533_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707535_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707538_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707539_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707540_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707542_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707543_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707545_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707561_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707569_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707571_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ854686_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854691_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854692_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854694_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854696_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854702_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854705_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357640_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512471_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MK512476_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999494_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999555_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999567_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999576_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999591_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999595_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MZ043030_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AF090840_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY902775_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477464_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707303_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707304_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707307_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707309_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707310_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707312_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707315_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707318_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707321_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707323_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707332_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707334_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707336_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707338_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707343_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707371_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707372_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707373_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707374_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707375_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707376_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707377_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707378_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707379_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707380_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707381_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707382_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707383_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707384_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707385_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707386_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707387_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707388_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707389_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707390_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707391_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707392_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707393_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707394_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707396_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707399_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779234_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779260_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779263_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779269_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779283_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779298_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779312_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779331_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779337_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779344_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779345_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779348_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779349_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779351_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779354_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779356_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779358_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779359_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779361_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779374_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779375_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KX827294_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KX827295_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KX827296_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772350_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043083_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
X51970_HBSP_P-A            MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
DQ788728_HBSP_P-A          MPLSYQHLRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNFGNLND
AJ309371_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AM184126_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU054331_HBSP_C-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY707087_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNE
ON093162_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLNE
EU859951_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859954_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
EU859956_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GU563550_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439833_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439834_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439835_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439837_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439839_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439841_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439844_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439845_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439847_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439848_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439851_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439852_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439853_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439857_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439859_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439867_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707595_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707638_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707639_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707640_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707641_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707642_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707643_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707644_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707645_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707646_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707647_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707648_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707649_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707650_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707651_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707652_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707653_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707654_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707655_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707656_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707658_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707659_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707661_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707662_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707663_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707664_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707665_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707667_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707669_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707670_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707672_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707675_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707676_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707681_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KM519454_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY161139_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779367_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426098_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426099_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY934773_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854557_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854578_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854586_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY934766_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692566_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875251_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875252_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875253_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875254_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875255_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KC875256_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF214658_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854687_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854688_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854690_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168430_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP168432_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925385_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925407_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999568_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999569_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AY738140_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY738141_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY738142_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
AY738143_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ161813_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU736918_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU736919_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
EU185789_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KT749838_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JQ707574_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707579_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707580_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707584_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707587_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707588_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707591_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707593_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707596_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707600_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707601_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707602_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707605_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
FJ692579_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692580_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692581_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692582_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692583_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692584_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692585_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854698_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692591_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357644_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KX357649_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MF925400_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
ON854566_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
FJ692598_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692601_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692602_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
FJ692604_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEDELPRLADEDLNHRVAEDLNLGNLND
MW999533_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707551_HBSP_P-A          MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779381_HBSP_P-A          MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043075_HBSP_P-A          MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
GQ477500_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779266_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843182_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843186_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KJ843218_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043062_HBSP_P-A          MPLSYQHFRKLLLLDVGTDAGPLEEELPRLADADLNRRVAEDLNLGNLND
MF772348_HBSP_P-A          MPLSYQHFRKLLLLDDGTESGPLEEELPRLADADLNRRVAEDLNLGNLND
MT426089_HBSP_P-RF-AB      MPLSYQHFRKLLLLDDETEVGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP995108_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
MZ043054_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
MZ043077_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439722_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439729_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439730_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439742_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439743_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439745_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439746_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439723_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439724_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439732_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439733_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439735_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439736_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439737_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439738_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439751_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439896_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439897_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439898_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439899_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439900_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439901_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439902_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439903_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439904_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439905_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439906_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439907_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439908_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439909_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439910_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439727_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439728_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439740_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439741_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439750_HBSP_P-A          MPLSYQHFLKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JF439753_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439754_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439755_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439756_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439757_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439758_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439759_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439761_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439762_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439763_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439764_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439765_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439766_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439981_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779238_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779240_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999538_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999582_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439768_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439769_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439770_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439771_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439772_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439773_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439774_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439775_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439777_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439778_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF440016_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF440020_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF440022_HBSP_P-RF-AG      MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439827_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439825_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439826_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439828_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439829_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439830_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439831_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439840_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439850_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439855_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439858_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439860_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439861_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439862_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439866_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707576_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707585_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707586_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707590_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707592_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707597_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707608_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439856_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439890_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439888_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439891_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439892_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439893_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439894_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439895_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439912_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439913_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439915_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439916_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439918_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439920_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439921_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439922_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439924_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439927_HBSP_P-A          MPLSYQHFRNVLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGDLND
JF439930_HBSP_P-A          MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439933_HBSP_P-A          MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439939_HBSP_P-A          MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439941_HBSP_P-A          MPLSYQHFRNVLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439934_HBSP_P-A          MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439936_HBSP_P-A          MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439940_HBSP_P-A          MPLSYQHFRNVLLLDEGTGAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439935_HBSP_P-A          MPLSYQHFRNVLLLDEGTRAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439944_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439945_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439946_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439947_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439948_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439949_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439950_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439952_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439953_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439955_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439956_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439957_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439958_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439959_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439960_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439961_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439962_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439968_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439972_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439973_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439974_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439977_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439978_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439980_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439983_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439986_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439989_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439991_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439992_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439993_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439976_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELSRLADADLNRRVAEDLNLGNLND
JF439985_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439988_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JF439990_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JN182319_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182320_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182321_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182322_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182323_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182324_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182325_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182326_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182327_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182328_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182329_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182330_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182332_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JN182333_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
JQ707301_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707302_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707311_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707316_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707319_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707320_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707333_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707337_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707341_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707342_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707313_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707314_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707317_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707322_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707328_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707330_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707331_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707326_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707344_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043057_HBSP_P-A          MPLSYQHFRKLLLLDDGTEVGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707349_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707350_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707352_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707353_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707355_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707356_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707358_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707359_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707360_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707363_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707365_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707366_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707369_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707370_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707348_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707351_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707354_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707357_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707361_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707362_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707364_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707367_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707400_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707402_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707403_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707404_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707405_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707406_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707409_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707410_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707411_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707412_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707413_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707414_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707416_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707417_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707418_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707420_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707408_HBSP_P-A          MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707415_HBSP_P-A          MPLSYQHFRKLLLLDEGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707554_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043078_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707578_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707583_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707603_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707604_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707606_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707594_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707598_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
JQ707607_HBSP_P-A          MPLSYQHFRKLLLLDVGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779215_HBSP_P-A          MPLSYQHFRKLLLIDDGTEAGPLEEELPRLADADLNRRVAEDLHLRNLND
MZ043061_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KF779311_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADPNRRVAEDLNLGNLND
KF922408_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922409_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ010776_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ010777_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ010778_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922416_HBSP_P-A          MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922417_HBSP_P-A          MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922418_HBSP_P-A          MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922419_HBSP_P-A          MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922420_HBSP_P-A          MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922421_HBSP_P-A          MPLSYHHFRKLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KF922430_HBSP_P-A          MPLSYQLFRRLLLLDDEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT347087_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922436_HBSP_P-A          MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KF922437_HBSP_P-A          MPLSYQSFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KJ854697_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MN476101_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KP274925_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADGDLNRRVAEDLNLGNLND
MZ043050_HBSP_P-A          MPLSYQHFRKLLLLDDXTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
KU605533_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU605534_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366466_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KR905431_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366468_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT366470_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151617_HBSP_P-A          MPLSYQHFRKLLLLEEEAEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151614_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151615_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151616_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KT151618_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU605537_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU605538_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
KU605539_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464813_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464814_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464818_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464819_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464821_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464822_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464824_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464826_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464827_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH464830_HBSP_P-A          MPLSYQHFRKLLLLDDETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH580639_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH580642_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MH580643_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999483_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
MW999534_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAELNRRVAEDLNLGNLND
MW999597_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADAELNRRVAEDLNLGNLND
MW999581_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999594_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MW999593_HBSP_P-A          MPLSYQHFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
MZ043097_HBSP_P-A          MPLSYQCFRKLLLLDDGTEAGPLEEELPRLADADLNRRVAEDLNLGNLND
OK143484_HBSP_P-A          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADADLNRRVAEDLNLGNLND
ON854587_HBSP_P-A          MPLSYQHFRKLLLLDVETEAGPLEEELPRLADEDLNRRVAEDLNLGNLND
AB010291_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB900102_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
AB368295_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
FJ023638_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674383_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674400_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674405_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674447_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674469_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674477_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674491_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674498_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674511_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MT426101_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
AB115551_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011088_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011089_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011090_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011091_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU330992_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU330994_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU330995_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU330996_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU330997_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU330998_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU330999_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU331000_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU331001_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358140_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358146_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358149_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358150_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358151_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ358152_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924621_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924656_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HQ700549_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341604_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774418_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148457_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU234318_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881944_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674392_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674393_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674394_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674395_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674409_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674413_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674423_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674436_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674443_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674451_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674452_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674461_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674464_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674482_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674483_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674495_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674500_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674510_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534621_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534634_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534659_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845286_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ675796_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ675803_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534637_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534641_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534653_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534686_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073827_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073828_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073829_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073831_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073833_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073834_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073840_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB205119_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB300364_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB471854_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB471855_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB675676_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF100308_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF100309_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF121249_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF282918_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY167097_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY217356_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY293309_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ448620_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ448621_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ448623_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ448625_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ448626_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993697_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993703_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993705_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993708_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993709_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993710_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF134945_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF134946_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306700_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306701_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306702_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306703_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306705_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306706_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306708_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306709_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306710_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306712_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU350409_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU439018_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU439020_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU439021_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU439022_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU439023_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU487257_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU522067_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU522074_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU796068_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939663_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939664_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939666_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386583_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386584_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386668_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386684_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562231_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562253_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562289_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ787444_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377519_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377537_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377547_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377588_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377612_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377638_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377639_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377643_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ475340_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924603_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924627_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924644_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924653_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU434373_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU451682_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815579_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815581_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815583_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815584_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815585_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815586_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815587_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815588_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815589_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815590_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815591_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815593_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815594_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815595_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815596_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815597_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815598_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815599_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815600_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815601_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815602_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815603_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815604_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815605_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815606_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815607_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815608_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815609_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815610_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815611_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815612_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815613_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815614_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815617_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815618_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815619_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815620_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815621_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815622_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815623_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815624_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815626_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815632_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815633_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815639_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815646_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815647_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815648_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815649_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815651_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815652_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815653_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815654_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815656_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815657_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815658_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815659_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815660_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815661_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815663_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815664_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815665_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815666_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815667_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815668_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815669_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815670_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815672_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815674_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815675_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815676_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815677_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815678_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815713_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815716_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815717_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815718_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815719_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815724_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815725_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815729_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815733_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815739_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815747_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815748_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815749_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815750_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815751_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815752_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815753_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815754_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815757_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815759_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815761_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815762_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815764_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815766_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815767_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815768_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815769_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815770_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815771_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815773_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815775_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815776_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815777_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815778_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815779_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815780_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815781_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815782_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815783_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011480_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
HM011484_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF412801_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JF899335_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JN406371_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ040173_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341550_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341558_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341568_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341570_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341573_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341574_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341591_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ688405_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ801479_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ801507_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ801514_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX429899_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX429900_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX429902_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661470_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661472_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661479_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661481_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661483_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510641_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510647_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510652_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510653_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510656_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510660_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774365_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774366_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774367_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774371_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774373_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774375_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774376_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774377_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774378_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774381_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774384_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774385_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774386_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774387_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774391_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774392_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774393_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774395_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774402_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774404_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774405_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774406_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774411_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774413_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774416_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792667_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792756_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792951_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792982_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF053192_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173339_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173340_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173345_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173351_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173352_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173353_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173354_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173355_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173356_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173357_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173359_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173361_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173365_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173366_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173367_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173368_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173369_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173370_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173373_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173374_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173376_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173380_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173381_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173382_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173405_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173406_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173407_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173408_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173409_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173410_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173411_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173412_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173413_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173414_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173415_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173416_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173417_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ410490_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ410516_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ410517_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ717796_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803763_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM392083_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM875416_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM875417_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM875421_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP036970_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148317_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148318_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148319_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148320_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148321_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148322_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148324_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148327_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148329_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148330_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148331_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148332_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148333_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148357_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148359_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148360_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148361_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148362_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148363_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148364_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148365_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148366_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148579_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148580_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148582_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148583_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406165_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406171_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406173_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406276_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406277_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406281_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406285_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406287_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406289_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406292_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406293_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406306_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406307_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406308_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406309_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406310_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406313_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406315_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406316_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406317_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KR232337_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963976_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963977_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963978_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963979_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963980_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963981_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963982_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963983_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963984_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963985_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963986_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963987_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963988_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963989_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964093_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964095_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964096_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964097_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964099_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964100_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964101_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964102_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964103_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964104_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964105_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964106_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964107_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964117_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964246_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX765856_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470953_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470954_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470956_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470960_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470961_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881826_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881844_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881847_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881848_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881852_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881854_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881855_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881856_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881857_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881858_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881859_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881860_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881863_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881866_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881868_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881893_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881894_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881895_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881896_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881897_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881898_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881900_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881901_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881902_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881903_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881904_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881905_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881906_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881907_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881908_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881909_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881910_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881911_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881912_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881914_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC677084_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674427_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674480_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674485_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674512_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571342_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571356_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571362_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571365_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052962_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK052964_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK075117_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534572_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534573_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534576_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534599_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534600_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534601_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534602_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534693_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534711_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534732_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534733_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT111595_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426891_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427016_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427017_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427018_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427020_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427021_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427022_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427023_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427024_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427025_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427026_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427027_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427028_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427029_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427030_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427031_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427032_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427033_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427034_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427035_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427036_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427037_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427038_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427039_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427040_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427041_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427042_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427043_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427044_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427045_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427046_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427047_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427048_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427049_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427050_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427051_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427052_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427053_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427054_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427055_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427056_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427057_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427058_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427059_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427060_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427061_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427062_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427063_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427065_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427066_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427068_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427069_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427072_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427074_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427075_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427076_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427077_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427078_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427079_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427082_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427083_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427084_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427085_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427086_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427087_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427088_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427089_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427091_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427092_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427093_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427094_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427095_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427096_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427098_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427099_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427100_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427101_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427102_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427103_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427104_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427107_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427108_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645041_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645058_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW310262_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW310264_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845308_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999606_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999607_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ934438_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OK106254_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OM688314_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
OM688315_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
X97851_HBSP_P-B            MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939627_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534556_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534558_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534564_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534567_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534568_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534569_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534579_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534580_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534598_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534625_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534633_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534639_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534646_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534651_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534685_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534731_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386582_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562236_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924611_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661480_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792798_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881833_HBSP_P-B          MPLSYQRFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
D00330_HBSP_P-B            MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674426_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993681_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993683_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993684_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB246340_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB073845_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB073854_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB106884_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
D23678_HBSP_P-B            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB205121_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB246341_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB246342_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
AB900103_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
LC279268_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
LC279269_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
LC279270_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
LC279271_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
LC279272_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
LC279273_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
MH932712_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
MW887648_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
DQ993686_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
AP011084_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939635_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562259_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377561_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341575_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406220_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406221_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406222_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406223_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406224_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406225_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406226_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406227_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406228_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406229_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406230_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406231_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406232_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406233_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406234_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406235_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406236_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406237_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406238_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406239_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406240_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406241_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406242_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406243_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB195935_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757436_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757437_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757440_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757441_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757444_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757446_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757450_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757454_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757456_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC349869_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC349875_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534630_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB241117_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB287328_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
AB287315_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
AB287318_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
AB287319_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
DQ463787_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
DQ463790_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
DQ463798_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
DQ463802_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
JN792899_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659219_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659224_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659237_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659246_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659247_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659248_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
KP659252_HBSP_P-B          MPLSYQYFRKLLLLDD--EAGPLEEELPRLADEDLNHRVAEDLNLGNPND
AB555498_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF121250_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY206375_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY596102_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY766463_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ448619_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF494380_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU522066_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939672_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386615_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386636_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386658_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ899784_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ899785_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ899786_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377582_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377610_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815679_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815680_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815681_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815683_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815684_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815685_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815686_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815687_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815688_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815689_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815691_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815692_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815693_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815694_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815695_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815696_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815697_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815698_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815699_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815700_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815701_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815702_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815703_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815704_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815705_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815706_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815707_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815708_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815710_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815711_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815721_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815730_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815731_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815732_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815735_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815737_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815740_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815742_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815755_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ040138_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341584_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341593_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661471_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661474_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX978431_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510644_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510649_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510650_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774363_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774399_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774403_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173422_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173423_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ410502_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406262_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406266_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406272_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406273_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406275_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406318_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406319_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406320_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406321_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406322_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406323_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406324_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406325_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406326_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406327_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406328_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406329_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406330_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406332_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406333_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406334_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406335_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963816_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963828_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963829_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963830_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963831_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963832_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963833_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963834_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963835_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963836_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963837_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963838_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963839_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963840_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963841_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963855_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964138_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964139_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964140_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964142_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964143_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964144_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964145_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964146_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964147_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964148_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964149_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964150_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964151_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964152_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964244_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964247_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964248_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964249_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964251_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964253_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964254_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964255_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964256_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964394_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881780_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881781_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881783_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881784_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881785_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881786_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881788_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881789_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881791_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881793_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881796_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881797_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881798_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881799_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881800_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881801_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881823_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881824_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881825_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881827_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881828_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881829_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881830_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881831_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881834_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881836_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881838_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881839_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881842_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881843_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881850_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534627_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426100_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426104_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT645025_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW497299_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999614_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ934426_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ934427_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ934435_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ934436_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ934437_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ934439_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ934440_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB302943_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB302944_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AB713532_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011085_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924625_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ027316_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ429081_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ429082_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276830_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC349871_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC349878_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC349879_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC416037_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674479_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534626_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW999609_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY596106_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AF121244_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
AF121245_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
AF121246_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
KJ717805_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
KJ717806_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
KJ803795_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
AY217361_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY220703_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY220704_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU919173_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ801524_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661478_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510651_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792948_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173347_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173348_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148325_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406288_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406296_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406299_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406300_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406301_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406303_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406311_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674391_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH663473_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ671237_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ671238_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534660_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534712_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924631_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341579_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276773_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011095_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AP011096_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674515_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY163870_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNVND
AY596109_HBSP_P-B          MPLSCQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534728_HBSP_P-RF-BC      MPLSYQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341563_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792945_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC793132_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276808_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571350_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX504538_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306679_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306680_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173418_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173419_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406282_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406283_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674506_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY217358_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY596110_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY596112_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU570070_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU570071_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774374_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774388_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963945_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963947_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963949_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963950_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963951_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963952_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963953_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963954_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963956_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963957_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963958_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963959_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY220697_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939633_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU939634_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815650_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX507215_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173363_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173364_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964123_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964124_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964125_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964126_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964127_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964128_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964129_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964130_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964131_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964132_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964133_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964134_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964135_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964136_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964137_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EF473974_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ032349_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386675_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571327_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571328_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571344_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774362_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
AY800392_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC603638_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
EU306695_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
EU306697_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
EU306698_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MK534696_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDGLNRRVAEDLNLGNLND
FJ032357_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ463796_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNPND
DQ463797_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDDLNRRVAEDLNLGNPND
JN792895_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDDLNRRVAEDLNLGNPND
JN792896_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADDDLNRRVAEDLNLGNPND
JN792897_HBSP_P-B          MPLSYQHFRKLLLLD--SDAGPLEEELPRLADEDLNHRVAEDLNLGNPND
JN792898_HBSP_P-B          MPLSYQHFRKLLLLD--SDAGPLEEELPRLADEDLNHRVAEDLNLGNPND
JN792893_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNLRVAEDLNLGNPND
DQ993699_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
DQ993701_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
DQ993702_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JX661482_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173297_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406163_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571371_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534575_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534709_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377630_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534561_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534577_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534610_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU487256_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534607_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534609_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534616_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534684_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU306678_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ801512_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148356_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU330990_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU522073_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU522075_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
EU564824_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KP406162_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
KP406166_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNPND
EU589335_HBSP_P-B          MPLSYQHFRNILLLDK--DAGPLEEELPRLADQGLNRRVAEDLGLGNLND
FJ386656_HBSP_P-B          MPLSYQHFRNILLLDK--DAGPLEEELPRLADQGLNRRVAEDLGLGNLND
EU796071_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571346_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534603_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427080_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148336_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148338_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148339_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148340_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148342_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148343_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148344_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148345_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148346_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148347_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148348_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148349_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276788_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470830_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470832_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470833_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470834_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470835_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470836_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470837_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470838_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470839_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470840_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY470841_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534570_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534578_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534581_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534591_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534629_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534705_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534707_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148337_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534562_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534584_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534617_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534618_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534623_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534654_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534655_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534662_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534664_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534670_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534672_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534675_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534687_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534688_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534689_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534690_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534723_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534736_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ386642_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ801471_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ562237_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774400_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406261_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU434372_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815715_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815722_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815726_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815728_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815734_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815736_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815738_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815744_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815745_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815746_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX504532_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510657_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571322_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276784_HBSP_P-B          MPLSYQHFRKLLLLEEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674422_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964157_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ899790_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
FJ899791_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
FJ386634_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377550_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
FJ349236_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707734_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707735_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707737_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707738_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707739_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707742_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707743_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707744_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707746_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707749_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707753_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707755_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707758_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707759_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707762_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707763_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707764_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707765_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707766_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
JQ707767_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674384_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674387_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674410_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674416_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674421_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674424_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674431_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674438_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674453_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674470_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674481_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674487_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674490_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674497_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MF674509_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MW847940_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MW999605_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MW999611_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
FJ032354_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534554_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964094_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571373_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774414_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--KAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774398_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148367_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148368_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148369_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148370_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148371_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148372_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148375_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148376_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148378_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148379_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148380_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148382_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148383_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148384_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148385_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148386_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148388_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148389_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148390_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148391_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148392_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148394_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148395_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148396_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148397_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148400_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148402_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148403_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148419_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148427_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148451_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534697_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924610_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341566_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341598_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX507210_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510655_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510658_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774383_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774389_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173424_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173425_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ410507_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM359440_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881820_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881821_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674449_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ671236_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ671239_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ675786_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377569_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377568_HBSP_P-B          MPLSYQHFRKLQLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815756_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173387_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173388_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774178_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774364_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MH094410_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534559_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924634_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173371_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173372_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534658_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX429897_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX504531_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510642_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510648_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC510659_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774368_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774396_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ717831_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803817_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KM392072_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963960_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963961_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963962_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963963_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963964_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963965_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963966_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963967_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963968_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963969_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963970_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963971_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963972_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963973_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963974_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963975_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964153_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964158_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964159_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964160_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964163_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964164_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KX276781_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924660_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406244_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406245_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406246_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406247_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406248_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406249_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406250_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406251_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406252_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406253_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406254_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ924654_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534611_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN689120_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MN689121_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534681_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534716_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534722_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815549_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815551_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815552_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815553_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815555_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815556_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815557_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815558_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815559_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815560_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815561_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815562_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815563_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815564_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815565_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815566_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815567_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815568_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815569_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815570_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815572_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815575_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815576_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661475_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC774408_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427019_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815577_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815625_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815627_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815628_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815629_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815630_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815631_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815634_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815635_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815636_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815637_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815638_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815640_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815642_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815643_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815644_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GU815645_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964108_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964111_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964113_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964115_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX661476_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148326_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571355_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881867_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX870001_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEEPPRLADEGLNRRVAEDLNLGNLND
KJ717807_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803796_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
LC349870_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ027331_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KJ173386_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JQ341583_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLXDEGLNRRVAEDLNLGNLND
JQ341555_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173362_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881835_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792885_HBSP_P-B          MPLSYQYFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
JX504533_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845309_HBSP_P-B          MPLSYQHFRKLLLLD--XEAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674414_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MF674499_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPHLADEGLNRRVAEDLNLGNLND
JQ341599_HBSP_P-B          MPLSYQHFRKLLLLDD--XAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674432_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
MK534694_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148314_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
KP148323_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
KP148334_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
MF674450_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
KJ173377_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
GQ377595_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963842_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963843_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963844_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963845_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963846_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963847_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963848_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963849_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963850_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963851_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963852_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963853_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MG571372_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173389_HBSP_P-B          MHLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173390_HBSP_P-B          MHLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534702_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KC792994_HBSP_P-B          --LSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KF053165_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803755_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803758_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803756_HBSP_P-B          MPLSYQHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803764_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADKGLNRRVAEDLNLGNLND
KJ803768_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
KJ803773_HBSP_P-B          MPLSYPHFRRLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLGLGNLND
KJ803775_HBSP_P-B          MPLSYPHFRKLLLLDQ--EAGPLEEELPRLADEGLNRRVAEDLGLGNLND
KF053194_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVADDLNLGNLND
KJ803781_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVADDLNLGNLND
KJ803783_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVADDLNLGNLND
KJ803784_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173342_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173398_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPHLADEGLNRRVAEDLNLGNLND
KJ173400_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADDGLNRRVAEDLNLGNLND
KJ173402_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173404_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173421_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803787_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRFAEDLNLGNLND
KJ803789_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803797_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRFADDLNLGNLND
KJ803801_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803805_HBSP_P-B          MPLSYQHFRKLVLLDE--EAGPLEEELPRLADEGLNRRVAEELNLGNLND
KJ803808_HBSP_P-B          MPLSYQHFRKLLLLDK--DAGPLEDELPRLADEGLNRRVAEDLTLGNLNE
KJ803816_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRFAEDLNLGTLND
KJ803819_HBSP_P-B          MPLSYQHFRKLLLLDN--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803820_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717815_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ803803_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534717_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ803821_HBSP_P-B          MPLSYQRFRKLLLLD--TDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ803824_HBSP_P-B          MPLSYQHFRKLLLFDN--AAGPLEEELPRLADEGLNRRVAEDLNLGNLDD
KJ803825_HBSP_P-B          MPLSYQRFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534704_HBSP_P-B          MPLSYQHFRKLPLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534729_HBSP_P-RF-BC      MPLSYQHFRKLPLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148398_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148409_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148410_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148411_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148413_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148414_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148415_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148421_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148423_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148424_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148425_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148430_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148432_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148435_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148439_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148440_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534721_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148416_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148418_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148433_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881946_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881949_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881950_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881955_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674433_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674434_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674445_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674448_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674466_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534680_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534635_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148455_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148456_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148458_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148460_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP148461_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406169_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KP406264_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406270_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406278_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406259_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KP406263_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964292_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964296_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MT622522_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KP406260_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNIND
KP406271_HBSP_P-B          MPLSYQHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406286_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406294_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406305_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406312_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KP406314_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963800_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963801_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963802_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963803_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963804_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963805_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963806_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963807_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963808_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963809_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963810_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963811_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963812_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963813_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963817_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963818_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963819_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963820_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963821_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963822_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963823_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963824_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963825_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963826_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU963827_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964080_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964081_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964082_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964083_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964084_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964085_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964086_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964087_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964088_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964089_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964090_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964091_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964092_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964110_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964112_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964114_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964116_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964118_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964119_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964121_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964122_HBSP_P-B          MPLSYQHFRKLLLLDE--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964162_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964167_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964161_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964166_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964168_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964260_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964261_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964262_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964263_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964264_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964266_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964268_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964269_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964270_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964271_HBSP_P-B          MPLSYQHFRKLLLLDEG--AGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964288_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964289_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964290_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964291_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964294_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964295_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964297_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964298_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964299_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964300_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964301_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KU964382_HBSP_P-B          MPLSYQHFRNVLLL--GEDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964383_HBSP_P-B          MPLSYQHFRNVLLL--GEDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964384_HBSP_P-B          MPLSYQHFRNVLLL--GEDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964385_HBSP_P-B          MPLSYQHFRNVLLL--GEDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964388_HBSP_P-B          MPLSYQHFRNVLLL--GEDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964391_HBSP_P-B          MPLSYQHFRNVLLL--GEDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964393_HBSP_P-B          MPLSYQHFRNVLLL--GEDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964395_HBSP_P-B          MPLSYQHFRNVLLL--GEDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KU964397_HBSP_P-B          MPLSYQHFRNVLLL--GEDAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845293_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MF674476_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MW845300_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534620_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534668_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534714_HBSP_P-RF-BC      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ675802_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881722_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881723_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881724_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881725_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881726_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881727_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881728_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881729_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881730_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881731_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881732_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881733_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881734_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881735_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881740_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881741_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881745_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881746_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881747_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881752_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881753_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881756_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881757_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881759_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881760_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881761_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881778_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881779_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ410497_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881947_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881948_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881951_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881958_HBSP_P-B          MPLSYQHFRKLLLLDD--DAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KY881953_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
KY881954_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLND
MF674493_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPHLADEGLNRRVAEELNLGNLND
MK052965_HBSP_P-B          MPLSYQHFRKLLLLDK--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
KJ173306_HBSP_P-C          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562229_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377594_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377634_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX429896_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX661494_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173280_HBSP_P-RF-CB      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534563_HBSP_P-RF-BC      MPLSYQHFRKLPLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MK534648_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVADDLNLGNLND
MK534695_HBSP_P-RF-BC      MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426860_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426861_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426862_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426867_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426868_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426869_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426871_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426872_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426873_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426874_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426875_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426876_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426877_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426879_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426880_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426881_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426883_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426884_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426885_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426886_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426887_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426888_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426892_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426893_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426894_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426895_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426898_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426899_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426900_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426901_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426902_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426903_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426904_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426905_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426864_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426865_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426866_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426870_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426878_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426882_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426889_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426896_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426897_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEDELPRLADEGLNRRVAEDLNLGNLND
MT426907_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426908_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426910_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426913_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426914_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426915_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426916_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426918_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426919_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426920_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426921_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426922_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426923_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426924_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426925_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426926_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426927_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426928_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426929_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426930_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426931_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426932_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426933_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426934_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426935_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426936_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426937_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426938_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426939_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426941_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426943_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426944_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426945_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426946_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426947_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426948_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426949_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426950_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426952_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426953_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426954_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426955_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426957_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426958_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426961_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426962_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426963_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426964_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426966_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426967_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426968_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426969_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426971_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426972_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426973_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426975_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426977_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426978_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426979_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426980_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426981_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426982_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426983_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426984_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426985_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426986_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426987_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426988_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426989_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426990_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426991_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426992_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426993_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426994_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426996_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426997_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426998_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426999_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427000_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427001_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427003_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427004_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427005_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427006_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427007_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427008_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427010_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427011_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427012_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427013_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427014_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427015_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426911_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426912_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426917_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426959_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426960_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426970_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT426995_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427002_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRIADEGLNRRVAEDLNLGNLND
MT427105_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427106_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT427109_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757451_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757452_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757449_HBSP_P-B          MPLSYPHFRRLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757453_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MT757457_HBSP_P-B          MPLSYPHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ675785_HBSP_P-B          MPLSYQHFRKLLLLDE--EAGPLEEELPRLADEGLNRRVAEDLNLGNLND
MZ439518_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439519_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439521_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439522_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439523_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439524_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439527_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439529_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439530_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439536_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439537_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439542_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439543_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439545_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439546_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439549_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439550_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439551_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLND
MZ439526_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
MZ439528_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
MZ439534_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNPND
MZ439539_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGTLND
MZ439540_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGTLND
MZ439544_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGTLND
MZ439548_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGTLND
MZ439547_HBSP_P-B          MPLSYQHFRKILLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGTLND
MZ675795_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNIND
MZ675797_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNIND
MZ675805_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNIND
MZ675806_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNIND
MZ675807_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNIND
MZ675804_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGFNHRVAEDLNLGNLND
MZ675801_HBSP_P-B          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNIND
AB014362_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014376_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014394_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB026815_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB195942_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB195947_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB195948_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB198076_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB198078_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB198079_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB246345_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB288026_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB300359_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB300365_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367424_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB367435_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB471848_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB471849_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB471850_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB485808_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB640730_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB642099_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670247_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670255_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670256_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670266_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670269_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670276_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670283_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670287_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670290_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670291_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670295_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670297_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670301_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670307_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670311_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB675677_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB900099_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF411410_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF461359_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AP011098_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY247032_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
D23681_HBSP_P-C            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
D50519_HBSP_P-C            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089793_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ377161_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ377162_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ377163_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ377165_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ975273_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ980550_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306673_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306674_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306675_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306713_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306714_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306719_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306720_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306721_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU439005_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU439013_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU439014_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU439015_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU554536_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU554537_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU554538_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU554539_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU554542_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU562218_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU570068_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916213_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916217_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916229_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939537_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939538_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939544_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939546_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939548_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939554_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939561_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939563_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939576_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939580_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939585_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939587_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939597_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939604_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939610_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939618_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939640_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032332_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032345_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386575_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386587_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386592_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386596_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386597_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386598_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386605_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386627_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386637_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386651_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386662_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386685_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386687_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562218_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562239_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562243_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562244_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562249_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562268_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562274_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562275_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562283_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562285_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562290_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562301_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562329_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562330_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562332_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562333_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715358_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715375_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715376_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715377_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715378_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715380_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715381_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715383_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715389_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715392_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715403_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715407_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715409_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715421_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715424_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ787468_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ899763_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ899764_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ899771_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ899775_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ227694_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ227695_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ227696_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ259588_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377523_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377527_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377530_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377535_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377540_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377541_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377543_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377546_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377553_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377554_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377559_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377562_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377563_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377574_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377579_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377580_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377585_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377598_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377603_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377617_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377618_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377619_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377621_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377637_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377640_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475314_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475319_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475322_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475324_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475325_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475326_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475330_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475332_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475337_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475348_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ872210_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GU434374_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM011489_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040129_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040144_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040162_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040165_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040166_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341648_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341658_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ688404_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX026885_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX429903_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX429904_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX429906_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX429912_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX429916_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX504541_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX504546_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX661488_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX661491_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX661493_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX661495_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774181_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774185_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774190_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774192_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774203_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774218_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774224_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774233_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774241_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774244_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774248_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774249_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774250_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774251_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774255_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774257_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774259_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774268_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774270_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774274_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774275_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774276_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774292_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774293_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774295_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774299_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774309_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774310_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774312_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774314_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774326_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774327_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774329_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774339_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774356_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774357_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774360_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC875262_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF779300_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173283_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173284_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173294_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173310_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173315_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173316_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173395_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173396_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173426_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173427_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173428_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173429_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173433_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173434_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ410505_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598680_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598681_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KP027477_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KP784761_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013761_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013763_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013765_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013767_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013769_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013773_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013774_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013776_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013777_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013850_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013851_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013858_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013873_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013877_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013909_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013919_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014049_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014092_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT284756_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963871_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963872_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963873_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963874_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963875_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963876_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963877_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963878_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963879_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963880_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963881_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963884_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963885_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963992_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963997_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964004_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964065_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964066_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964067_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964068_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964069_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964070_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964071_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964072_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964073_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964074_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964075_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964076_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964077_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964078_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964171_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964172_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964173_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964175_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964180_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964334_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964336_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964337_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964338_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964339_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964340_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964342_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964344_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964345_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964346_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964347_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964348_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY022423_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363268_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363281_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470894_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470896_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470897_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470900_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470901_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470902_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470904_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470905_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881736_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881738_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881739_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881742_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881743_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881748_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881749_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881750_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881751_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881754_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881755_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881758_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881762_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881763_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881764_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881766_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881767_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881768_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881769_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881770_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881771_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881772_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881773_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881774_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881775_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881776_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881777_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881813_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881870_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881875_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881876_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881877_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881879_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881881_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881884_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881960_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881961_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881962_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881971_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881974_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881978_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881981_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881984_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881987_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881988_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881989_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881990_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881993_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY882001_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY882002_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC090200_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279258_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC373511_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC373512_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG893556_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MH094411_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534674_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MN683726_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MN683727_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MN683729_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645022_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645028_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645031_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645034_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645042_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645043_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645044_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MW999617_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
OM688312_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
OM688318_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
OM732334_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
OM732335_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670303_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF461361_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871997_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU872015_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939551_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386581_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386585_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386633_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562267_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562305_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562314_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562336_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715345_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715346_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715347_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715385_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715387_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715411_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715412_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715413_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715414_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377516_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377520_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377534_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377544_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040130_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX026887_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774263_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774294_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774332_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774341_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173326_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173349_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963883_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963990_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963991_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963993_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963994_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963995_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963998_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963999_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964001_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964003_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470893_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279263_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279264_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279265_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279266_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279267_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MG893559_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645029_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645035_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
OM732333_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB113875_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB113876_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670282_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670289_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF458665_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU554535_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939545_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939550_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939560_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939595_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939607_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939609_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386672_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562248_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562269_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562325_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715372_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715398_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715400_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ899783_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475345_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475349_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475357_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ872211_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774239_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774301_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774358_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173289_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173293_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173301_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173311_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173312_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173337_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173445_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598679_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598686_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598687_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598705_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598706_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598707_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598708_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598709_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598710_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598711_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598712_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598713_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ598717_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014055_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR014060_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963886_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963887_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963888_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963889_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963890_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963891_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963892_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963893_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963894_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963895_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963896_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963897_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963898_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU963899_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363283_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534592_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645026_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645072_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871981_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871983_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871984_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871985_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871986_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871987_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871988_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871989_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871990_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871991_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871992_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871993_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871994_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871996_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939589_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ715384_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT645071_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB042285_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670278_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670288_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670292_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY306136_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY641561_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916233_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU916234_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562264_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562288_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173338_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173430_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964170_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881871_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881874_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881878_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY881886_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774188_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB697500_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
D23680_HBSP_P-C            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014397_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB026811_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB026812_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB026813_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB026814_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670294_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY641558_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032331_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386577_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN400088_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173288_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013791_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
D23684_HBSP_P-C            MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB300362_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY247031_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU871982_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU872012_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU872013_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032338_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032339_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386619_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562225_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562252_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475305_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475329_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475339_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475346_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363276_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB014375_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN400086_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB106895_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB033556_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670254_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB697494_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY066028_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ032341_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ386663_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ518813_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377578_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM750137_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN315779_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774247_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF485389_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT284755_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964169_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964174_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964176_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964177_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964178_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964179_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964181_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964182_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964183_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU964184_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HQ700547_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB042283_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGDLNE
AB362932_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939590_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939591_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ899777_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173281_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173282_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY363252_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774328_HBSP_P-RF-CB      MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB111124_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB111125_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB246344_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU939652_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562307_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ562331_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377515_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ377531_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ475338_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
HM750134_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774264_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774338_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ410510_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KM359441_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013779_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013781_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013782_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013784_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013785_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT284753_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279245_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279246_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279247_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279248_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
LC279249_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023649_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924615_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF053167_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF053169_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF214671_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ803759_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ803761_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013810_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765830_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MW999622_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ671242_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MZ671243_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801504_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KJ410504_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEDLNRRVAEDLNLGNLNE
KR013835_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
KR013836_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674388_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674390_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674402_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674408_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674412_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674418_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674454_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674467_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674468_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674472_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674484_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674501_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MF674504_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MZ671249_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
MZ671251_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNHRVAEDLNLGNLNE
AB300363_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AB670258_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF068756_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF223954_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF223956_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF223957_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF223958_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AF223959_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AP011097_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
AY862869_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089762_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089763_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089765_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089767_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089768_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089779_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089782_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ089789_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ315782_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
DQ361533_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EF494379_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306685_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306687_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306689_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306690_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306691_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
EU306694_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023641_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023642_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023643_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023644_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023647_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023650_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023651_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023653_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023657_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ023658_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
FJ349225_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924604_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924623_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924649_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924650_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GQ924658_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
GU563561_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JN827416_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ027333_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ040133_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341622_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341637_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341642_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341644_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341654_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341668_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ341669_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ688403_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801470_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801480_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801481_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801483_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801486_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801488_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801502_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801511_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801513_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JQ801519_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
JX507214_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC774228_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC875270_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC875271_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC875272_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KC875274_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KF053187_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173323_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ173324_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ410501_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ410508_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ410513_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717810_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717811_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717812_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717834_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ717844_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ803780_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ803799_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ803800_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ803818_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KJ803826_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KM875404_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KR013927_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT364718_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT364721_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT987424_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT987425_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KT987426_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KU051423_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX276844_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX276848_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX276854_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765818_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765820_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765823_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765824_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765826_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765829_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765831_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765832_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765833_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765834_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765837_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765838_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765846_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765848_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765850_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765851_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX765853_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX774503_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KX774504_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470906_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470907_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470908_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470909_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470910_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470912_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470913_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470916_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470917_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
KY470918_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674386_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674398_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674403_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674411_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674435_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674442_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674444_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674474_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674489_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF674494_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925365_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925367_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925369_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925377_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925387_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925406_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MF925408_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534595_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534604_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534628_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534643_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534650_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534656_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MK534657_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT111596_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426107_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426346_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426347_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEGLNRRVAEDLNLGNLNE
MT426349_HBSP_P-C          MPLSYQHFRKLLLLDD--EAGPLEEELPRLADEG