HBVdb

Dataset for protein MHBs of genotype RF

[Download (right click)] [Sequences] [Repertoires]

1345 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KY470853_MHBs_P-RF-DC      TQWNSTTFLRALQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB031265_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB033557_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB033558_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIG
AB033559_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB048702_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
AB048703_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB049609_MHBs_P-RF-CB      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB105172_MHBs_P-RF-CB      MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
AB188243_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
AB188245_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
AB194949_MHBs_P-RF-AE      VQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVSPVPNIASHISSISSRTG
AB195939_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
AB195940_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
AB195950_MHBs_P-RF-CB      VQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195955_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
AB195956_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
AB198084_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB205152_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB210819_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
AB222708_MHBs_P-RF-AD      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB241109_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
AB270535_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB270538_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
AB300369_MHBs_P-RF-CB      VQWNSTTFQQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB330368_MHBs_P-RF-DA      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB367393_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367400_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367419_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB367800_MHBs_P-RF-CB      VQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AB453985_MHBs_P-RF-AC      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB493837_MHBs_P-RF-CB      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVHPVPTIASPISSIFLRTG
AB493838_MHBs_P-RF-CB      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
AB493840_MHBs_P-RF-CB      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRIG
AB493842_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
AB583679_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
AB642096_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB674432_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLNLPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB674433_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRSLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
AB674434_MHBs_P-RF-DE      MQWNSTTFHQPLQDPRVRGLSFPAGGSSSGTVNPVPTTVSHISSIFSRIG
AB674436_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSETVNPVPTTVSHISSIFSRIG
AB674504_MHBs_P-RF-DC      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB933279_MHBs_P-RF-AG      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
AB933282_MHBs_P-RF-AG      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
AB933283_MHBs_P-RF-AG      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARXG
AF233236_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF297619_MHBs_P-RF-DA      MQWNSTALHQALQDPRDRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
AF297620_MHBs_P-RF-DA      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
AF330110_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AF411409_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
AF461361_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGL--PAGGSSSGTVNPVPTTASPISSIFSRTG
AJ344117_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
AJ627221_MHBs_P-RF-DE      MQWNSTTFHQTLQDPTVRGLNFPAGGSSSGAVNPVPTTASPLSSIFSRIG
AM494716_MHBs_P-RF-DE      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSILSRIG
AP011102_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFLRTG
AP011103_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
AP011104_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTSASPISSIFSRTG
AP011108_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPVSSIFSKTG
AY040627_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY057948_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AY123424_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY161140_MHBs_P-RF-AD      MQWNSTAFHQALQDPRVRGLYSPAGGSSSGTLNPVPIIAPLISSISSRIG
AY161141_MHBs_P-RF-AD      MQWNSTAFHQALQDPRVRGLYLLAGGSSSGTLNPVPTIASHISSISSRIG
AY161145_MHBs_P-RF-AD      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
AY161147_MHBs_P-RF-DA      ----STTFHQTLQDPGVRGLHFLAGGSSSGTVNAVPTIASHISSISSRIG
AY167095_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY206374_MHBs_P-RF-CB      TQWNSTTFLQTLLDPKVRGLYFPVGGSSSGTVNPVPTTASPISSIFSRTG
AY233277_MHBs_P-RF-AC      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGILNPVPNTASHISSISSRTG
AY233293_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AY233295_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
AY236161_MHBs_P-RF-DA      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
AY247030_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY341335_MHBs_P-RF-DE      MKWNSTTFRQILQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AY373430_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
AY800249_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AY817509_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRIG
AY817510_MHBs_P-RF-DC      IQWNSTTFHQTLQDPRVRGLYFPVGGSSSGTVNPVPTTVSPISSIFSRIG
AY817511_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AY817512_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AY817513_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AY817515_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRIG
AY862864_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AY862865_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSTFSRIG
AY862866_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
DQ089798_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
DQ315779_MHBs_P-RF-DE      MQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
DQ464164_MHBs_P-RF-DE      IQWNSTTFYQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPSSSISSRIG
DQ464165_MHBs_P-RF-DE      IQWNSTTFKQTLQDPRVRGLYLPAGGSSSRTVNPVPTTASPLSSIFSRIG
DQ464166_MHBs_P-RF-DE      IQWNSTTFKQTLQDPRVRGLYLPAGGSSSRTVNPVPTTASPLSSIFSRIG
DQ464167_MHBs_P-RF-DE      IQWNSTAFKQTLQDPRVRGLYLPAGGSSSRTVNPVPTTASPLSSIFSRIG
DQ478886_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
DQ478887_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
DQ478890_MHBs_P-RF-DC      MHWNSTTFHQTLQDPKVRGLYFPAGGSSSGTTNPVPTTASPISTIFSRIG
DQ478892_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
DQ478898_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
DQ991753_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPITASHISSIFSRIG
EF103283_MHBs_P-RF-AD      MQWNSTAFHQALQDPTVRGLYFPAGGSSSRTLNPVPTIASHISTISSRIA
EF103284_MHBs_P-RF-AD      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTHNPVPTIASHISSISSRIG
EF103285_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
EF464099_MHBs_P-RF-AG      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
EF494376_MHBs_P-RF-CA      IKWNSTTFHQALLDPRVRDLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
EF494378_MHBs_P-RF-CA      IQWNSTTFHHTLLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
EU185780_MHBs_P-RF-AD      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
EU522070_MHBs_P-RF-CB      MQWNSTTFQQALLDPRVRGLYFPAGGSNSGTVNPVPTTASPISSIFSRTG
EU589337_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGL--PAGGSSSGTVNPVPTTASPISSIFSRTG
EU594406_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU594435_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
EU594436_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGFSSGTVNPVPTTASHLSSIFSRIG
EU660227_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
EU717211_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU787435_MHBs_P-RF-DC      TQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
EU787444_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU833890_MHBs_P-RF-GA      MQWNSTAVHQALQDPRVRGLNFPAGGSSSGTVNPAPNIASHISSISARTG
EU833891_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
EU835240_MHBs_P-RF-GC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
EU871981_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871984_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871988_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871991_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871995_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871996_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871997_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU871999_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU881995_MHBs_P-RF-CB      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU882006_MHBs_P-RF-CB      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASAISSILSKTG
EU916228_MHBs_P-RF-CB      ----STTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU916232_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
EU916239_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
EU916240_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
EU919166_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939547_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939551_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939565_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939577_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939581_MHBs_P-RF-CB      ----STTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
EU939589_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939606_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939620_MHBs_P-RF-CB      IRWNSTTFHQTLQDPRVRALYSPAGGSSSGTVSPAQNTVSPISSILSKTG
EU939621_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTG
EU939623_MHBs_P-RF-CB      MQWNSTKFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTG
EU939627_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
EU939629_MHBs_P-RF-BC      IQWNSTTFHQALLDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTG
EU939630_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSTISSILSKTG
EU939631_MHBs_P-RF-BC      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU939668_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ023659_MHBs_P-RF-BC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
FJ023662_MHBs_P-RF-GC      MQWNSTNFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFARIG
FJ023666_MHBs_P-RF-GC      MQWNSTTFXQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSISARTG
FJ023667_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ023670_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ032337_MHBs_P-RF-CB      MQWNSTTFHQALLDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ349207_MHBs_P-RF-DE      MHWNSTTFHQTLQDPKVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ349212_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGAVNPVPTTASPLSSIFSRIG
FJ349221_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLNFPAGGSSSGTVNPVPTTASPASSIFSRIG
FJ349241_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ386586_MHBs_P-RF-CB      TQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386635_MHBs_P-RF-CB      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386649_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ386674_MHBs_P-RF-BC      TQWNSTTFHQTLQDPRVRALYFPAGGSSSGTLSPAQNTVSTTSSISSKTG
FJ562223_MHBs_P-RF-CD      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTXSXISSIFSRTG
FJ562226_MHBs_P-RF-CB      MQWNSTTFHQTLLGPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIG
FJ562227_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYIPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562229_MHBs_P-RF-CB      IQWNSSTFHQTLQDPRVRALHSPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562247_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTG
FJ562263_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ562267_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVDPVPTTASPISSIFSRTG
FJ562278_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISLIFSRIG
FJ562287_MHBs_P-RF-CB      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562294_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
FJ562305_MHBs_P-RF-CB      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562314_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ562317_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTINPVPTTASPTSSIFSRTG
FJ562328_MHBs_P-RF-CB      MKWNSPTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
FJ562336_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSICSRTG
FJ715345_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSRTG
FJ715346_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSRTG
FJ715347_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSRTG
FJ715384_MHBs_P-RF-CB      MQWNSTTFHQALLGPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715385_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715387_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715411_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787446_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ787480_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ882610_MHBs_P-RF-GC      MQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ882613_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ882617_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ904394_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSVFSRIG
FJ904396_MHBs_P-RF-DE      TQWNSTTFHQNLQDPRVRDLNSPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ904398_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ904400_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904403_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904404_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904405_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904406_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904407_MHBs_P-RF-DE      MQWNSTIFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904408_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRIG
FJ904409_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRIG
FJ904414_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ904416_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904425_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904430_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904436_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904437_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
FJ904440_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904441_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904442_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
FJ904444_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ904447_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FN594767_MHBs_P-RF-DE      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
FN594769_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
FN594770_MHBs_P-RF-DE      MQWNSTTFHXTLQDPRVRGLYLPAGGSISGTVNPAPTTASPISSTSARIG
FN594771_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FR714490_MHBs_P-RF-GB      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
FR714496_MHBs_P-RF-CB      IQWNSSKFHQALLDPRVRGLYSPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ161753_MHBs_P-RF-AE      MQWNSTNFHQALQDPRVRGLYFPAGGSSSETVNPVPNIASHILSISSRTG
GQ161754_MHBs_P-RF-DE      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
GQ161806_MHBs_P-RF-EA      MQWNSTTFHQPLQBPRVRGQDFPAGGSSSGTVNPVPTTASLISSIFSRIG
GQ161837_MHBs_P-RF-AE      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVTPVPNIASHISSISSRTG
GQ161838_MHBs_P-RF-AE      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVTPVPNIASHISSISSRTG
GQ205377_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
GQ205379_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIG
GQ331048_MHBs_P-RF-AE      IQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVQNIASHISSISSRTG
GQ377516_MHBs_P-RF-CB      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377520_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
GQ377522_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
GQ377534_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377544_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377549_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
GQ377556_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377560_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377564_MHBs_P-RF-CB      MQWNSXTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
GQ377565_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377573_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
GQ377581_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVXGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377590_MHBs_P-RF-CB      MKWNSPTFHQTLQDPRVRXLYFPAGGSSSGTVXPXXXTXSXISSIFSXTG
GQ377592_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
GQ377594_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377595_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
GQ377596_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
GQ377602_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377604_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTG
GQ377613_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
GQ377614_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
GQ377626_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
GQ377627_MHBs_P-RF-CD      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTXSHISSIFSRXG
GQ377630_MHBs_P-RF-BC      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
GQ377633_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTXNPVPTTASPISSIFSRTG
GQ377634_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
GQ377635_MHBs_P-RF-BC      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ924618_MHBs_P-RF-CB      MQWNSSTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GU177079_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSILSRIG
GU357843_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSILSKTG
GU385774_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
GU563560_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRSLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
HE981179_MHBs_P-RF-FG      MQWNSTQFHQALLDPRVRALYVPAGGSSSETQNPAPTIASLTSSIFSKTG
HF571060_MHBs_P-RF-AE      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSISSRTG
HM011502_MHBs_P-RF-EB      ----SXTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM146131_MHBs_P-RF-AD      IQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRIG
HM750143_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HM750144_MHBs_P-RF-DC      MQWNSTTFHQTPQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HM750145_MHBs_P-RF-DC      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HM750146_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ684848_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALFFPAGGSSSGTVSPAQNTVSAISSILSKTG
HQ684849_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSILSKTG
HQ700462_MHBs_P-RF-CB      IQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700485_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
HQ700492_MHBs_P-RF-DE      MQWNSTTFHQNLQDPRVRGLYFPAGGSSSGTVNPVPTXASPXSSIFSRIG
HQ700493_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700494_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700498_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGAVNPVPTTASPISSIFSRTG
HQ700500_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700503_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700505_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700507_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700508_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700509_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
HQ700515_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
HQ700518_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTIASPISSIFSRTG
HQ700519_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTANPVPTTASPISSIFSRTG
HQ700520_MHBs_P-RF-CB      MQWNAKTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTAFPISSIFSRTG
HQ700521_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700523_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTLNLVPTTAYPISSIFSRTG
HQ700526_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVTPVPTSASTISSILSRTG
HQ700527_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRTG
HQ700528_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700530_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTLNLVPTTASPISSIXXTTG
HQ700531_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTLNPVPTTASPISSILSRTG
HQ700532_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTLNPVPTTASPISSILSRTG
HQ700533_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700534_MHBs_P-RF-DE      MQWNSTTFHQTLQDPXVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700535_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSLGTVNPVPTTASPISSIFSRIG
HQ700536_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700537_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700538_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700539_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700540_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700542_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGAVNPVPTTASPTSSIFSRTG
HQ700547_MHBs_P-RF-CB      MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRTG
HQ700554_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700557_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700560_MHBs_P-RF-CB      MQWNXTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700579_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700580_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700582_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
J02202_MHBs_P-RF-DE        MHWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTTSPISSIFSRIG
JF436919_MHBs_P-RF-CB      TQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JF436922_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JF436923_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JF439994_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439998_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440000_MHBs_P-RF-DE      MQWNSTTFHQALQDPRARGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440001_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSPGAVNPVPTTASPLSSIFSRIG
JF440004_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440006_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440011_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440013_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440019_MHBs_P-RF-AG      MQWNSTALHQALQDPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF440022_MHBs_P-RF-AG      MQWNSTAFHQALQNPRVRGLYFPAGGSSSGTVNPAPNIASHISSISARTG
JF491448_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIYSRIG
JF491451_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRIG
JF491455_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF491456_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF754613_MHBs_P-RF-DE      MQWNSTPFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSIFSRIG
JF754616_MHBs_P-RF-DE      MQWNITTFHQTLQDPRVKGLYYHAGGSSSGTVNPVPTTVSHTSSIFSRIG
JF828933_MHBs_P-RF-CB      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828934_MHBs_P-RF-CB      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828936_MHBs_P-RF-CB      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JF828938_MHBs_P-RF-CB      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN040798_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVGGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN040803_MHBs_P-RF-DE      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVHPVPTTVSPISSTFSRIG
JN257154_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257164_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257174_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257189_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVKGLYXPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257191_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257204_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
JN257206_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVXGLYLPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257210_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN257216_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
JN642127_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN642137_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN642139_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN642141_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN642152_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JN642160_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JN664915_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
JN664925_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
JN664929_MHBs_P-RF-DE      MQWNSTTFHQALQDPRVRGQNFPAGGSSSGTVNPVPTTASHISSIFSKIG
JN664933_MHBs_P-RF-DA      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
JN664934_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRIG
JN664935_MHBs_P-RF-DC      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSIFSRTG
JN664940_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
JN664943_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN664946_MHBs_P-RF-DA      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
JN688689_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN688715_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
JN688717_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JQ027310_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040142_MHBs_P-RF-CB      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040146_MHBs_P-RF-CB      MQWNSTTFXQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040148_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ040174_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPVQNTVSAISSILSKTG
JQ040175_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ272886_MHBs_P-RF-GF      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ272887_MHBs_P-RF-GF      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
JQ412091_MHBs_P-RF-BC      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ732168_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801476_MHBs_P-RF-CG      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JQ801477_MHBs_P-RF-BC      MHWNSTTFRQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
JX036328_MHBs_P-RF-CD      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
JX036329_MHBs_P-RF-CD      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
JX036330_MHBs_P-RF-DC      MQWNSTTFHQTQQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
JX036332_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRIG
JX036358_MHBs_P-RF-DC      MQWNPTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX504540_MHBs_P-RF-CB      VQGNSTTFQQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRIG
JX661485_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYLPGGGSSSGTVNPVPTTASPISSIFSRTG
JX661486_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661487_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661498_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX898686_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898690_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898693_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898695_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPAPTTASPLSSIFSRIG
KC172106_MHBs_P-RF-GB      RQWNSTTFHQALQDPRIRGLYLPAGGSSSGTVNPAPNIASHISSIFTRIG
KC315400_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAPTTASPISSIFSRTG
KC774178_MHBs_P-RF-BC      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSILSKTG
KC774183_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774186_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774188_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774193_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIG
KC774212_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPTSSIFSRTG
KC774222_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
KC774234_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KC774263_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774291_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774305_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRTG
KC774307_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774323_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
KC774324_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
KC774344_MHBs_P-RF-CB      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774414_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
KC774420_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774422_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774425_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRIG
KC774428_MHBs_P-RF-DC      MQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTPIPVPTTASPISSIFSRIG
KC774430_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774431_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774435_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPILSIFSRIG
KC774439_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774442_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPILSIFSRIG
KC774447_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774448_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774449_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPILSIFSRIG
KC774452_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPILSIFSRIG
KC774453_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774456_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774458_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIG
KC774461_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPITASPISSIFSRIG
KC774463_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASPISSIFSRIG
KC774466_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC774474_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774478_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774479_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774481_MHBs_P-RF-DC      MQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRIG
KC774483_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774484_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIG
KC774485_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774486_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC774487_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIG
KC774489_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLNTASPISSIFSRIG
KC774490_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774492_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KC774494_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774495_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774498_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIG
KC793112_MHBs_P-RF-BC      MRWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTG
KC875339_MHBs_P-RF-DE      MQWTSTTFHQALQDPKVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
KF053160_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KF053166_MHBs_P-RF-BC      MQWNSSTFHPTLQDPRVRALYFPAGGSSSGTVNPVQNTASPISSILSTTG
KF053179_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTG
KF053186_MHBs_P-RF-BC      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPAQNTVSTTSSHLSKTG
KF053188_MHBs_P-RF-CB      MQWNSTTVHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASPISSILSRTG
KF170740_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHTSSIFSRIG
KF192833_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF192835_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF192840_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASHLSSIFSRIG
KF214656_MHBs_P-RF-AC      IQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISLRIG
KF219922_MHBs_P-RF-GH      MQWNSTAFHQALQNPKVRGLYFPAGGSSSGIVNPVPTIASHISSIFSRIG
KF471643_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KF873511_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KF873513_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KF873515_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KF873517_MHBs_P-RF-BC      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KF873518_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KF873519_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KF873521_MHBs_P-RF-BC      MQWNSTAFHQALQDPRVRGLYFPAGGSSFGAVNPVPNTVSPISSIFTKTG
KF873522_MHBs_P-RF-CB      MQWNSXTFQQALLDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTKTG
KF873523_MHBs_P-RF-CB      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIXTKTG
KF873524_MHBs_P-RF-CB      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTKTG
KF873527_MHBs_P-RF-CB      MQWNSSAFHQALQDPRVRGLYFPAGGSSSGTVSPVQNTVSHISSIFTKTG
KF873530_MHBs_P-RF-CB      MQWNTTTFHQALQDXRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
KF873531_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KF873532_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KF873534_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVKGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KF873535_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KF873537_MHBs_P-RF-CB      MQWNSTAXHQALQDPRVRXLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KF873540_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIXTTTG
KF917451_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KJ173279_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173280_MHBs_P-RF-CB      ----STTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173320_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KJ173325_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIG
KJ173326_MHBs_P-RF-CB      MQWNLTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRIG
KJ173329_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRTG
KJ173330_MHBs_P-RF-CB      ----STTFHQALLDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRTG
KJ173349_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173350_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173358_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ410497_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
KJ410520_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ470884_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KJ470887_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KJ470891_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KJ470897_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KJ470898_MHBs_P-RF-DE      MQWNSTTFXQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KJ586803_MHBs_P-RF-AF      MQWNSTQFHQALSDPRVRALYFPAGGPSSETQNPAPTIASLTSSIFSKTG
KJ586810_MHBs_P-RF-AF      MQWNSTQFHQALLDPRVRALYFPAGGSSSETLNPVPNIASHISSISSRTG
KJ586811_MHBs_P-RF-DF      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
KJ598675_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ647349_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KJ647351_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
KJ647356_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KJ717800_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTANPVPTSASPISSIFSRTG
KJ717814_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717815_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717832_MHBs_P-RF-CB      MQWNSTTFHQALLAPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803771_MHBs_P-RF-DB      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASPISSIFSRIG
KJ803785_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803798_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803804_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803822_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSETVNLVPNTASPISSIFWRIG
KM359442_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KM386676_MHBs_P-RF-DE      -QWTSSTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRTG
KM524357_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KM524359_MHBs_P-RF-DE      MHWNSTTFHQTLQDPRVRGLYFPAGGSNSGTVNPVPTTASHLSSIFSRIG
KM577663_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM577664_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM577665_MHBs_P-RF-DE      MQWNSTTFHQTLQNPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
KM577666_MHBs_P-RF-DE      MQWNSTTFHQTLQDTRVTGLNFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KM577667_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KM606741_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLHFPVGGSSSGTVNPVPTTASPISAIFPRTG
KM606750_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTINPVPTTASPISSIFSRIG
KM606751_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGCSSSGTVNPVPTTASPISSIFSRIG
KM875422_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KP148337_MHBs_P-RF-BC      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSKTG
KP148352_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
KP148441_MHBs_P-RF-GC      MQWNSTTFHQALQDPKIRGLYFPAGGSSSGTVNPAPNIVSHISSIFARTG
KP148442_MHBs_P-RF-BC      MQWNSTNFHQALQDPRIRGLYLPAGGSSSGTVNPAPNIVSHISSIFARTG
KP148449_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGYSSGTVNPAPNIVSHISSIFARTG
KP148450_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYLPAGGSSSGTVNPAPNIVSHITSIFARTG
KP148586_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIVSHISSIFARIG
KP168421_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHILSIFSRIG
KP274926_MHBs_P-RF-GA      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPTIASHISSIFSRIG
KP288875_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP995112_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPAPTTASLISSIFSKIG
KR013806_MHBs_P-RF-CB      VQWNSTTFHQALLDPRVRGLYFPAGGSGSGTVNPVPTTASPISSIFSRTG
KR013816_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KR013843_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
KT003704_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
KT366492_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KT366503_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT991417_MHBs_P-RF-DC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPISLIFSRIG
KT991419_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISLIFSRIG
KT991420_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISLIFSRIG
KT991423_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT991424_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
KT991427_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTIASPISSIFSRIG
KU668440_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KU679939_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KU679940_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYXPAGGSSSGTVNPVPNTVSHISSIFTTTG
KU679942_MHBs_P-RF-CB      MQWNSSAFHQALQDPRVRGLYFPAGGSSSGTVSPVPNTVSHISSIFTKTG
KU679943_MHBs_P-RF-BC      MQWNSSAFHQALQDPXVRGLYFPAGGSSSGTVSPVPNTVSHISSXFTKTG
KU679944_MHBs_P-RF-BC      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KU679945_MHBs_P-RF-CB      MQWNSTAFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KU679946_MHBs_P-RF-BC      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KU679948_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KU679950_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVXPISSIFTKTG
KU679953_MHBs_P-RF-BC      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGAVNPVPNTVSPISSIFTKTG
KU679954_MHBs_P-RF-CB      XQWNSSAFHQALQDPXVRGLYXPAGGSSSGTVSPVPNTVSHISSIFTKTG
KU679956_MHBs_P-RF-CB      MQWNSSAFHQALQDPRIRGLYFPAGGSSSGTVNPVPNTVSHISSIFTKTG
KU679958_MHBs_P-RF-CB      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFXKTG
KU695741_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU695742_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU695744_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSNFARTG
KU695745_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGAVNPVPTTASPISSIFSRTG
KU695746_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSSFVRIG
KU711666_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KU736914_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHILSIFSRIG
KU736916_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRIG
KU736917_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHILSIFSRIG
KU963859_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963862_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963868_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFPRTG
KU963869_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTALPISSIFSRTG
KU963883_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRSLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963993_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964005_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964306_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964316_MHBs_P-RF-CB      MQWNSTTFHQDLLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964351_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX096713_MHBs_P-RF-CA      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KX357623_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASHISSIFSRIG
KX357624_MHBs_P-RF-DE      -QWNSTTFHQTLQDPRVRGL--PAGGSSSGTVSPVPTTASHISSIFSRIG
KX357625_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASHISSIFSRIG
KX357626_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASHISSIFSRIG
KX357627_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASHISSIFSRIG
KX357628_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASHISSIFSRIG
KX357629_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVSPVPTTASHISSIFSRIG
KX357631_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGL--PAGGSSSGTVSPVPTTASHISSIFSRIG
KX357634_MHBs_P-RF-DE      WKWNSTTFHQTLQDPRVRGLYSPAGGSSSGTVSPVPTTASHISSIFSRIG
KX357636_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHISSIFSRIG
KX357641_MHBs_P-RF-DE      MQWNSTTFHQTLQDSRVRGLYFPAGGSSSGTVNPVPTTASHILSTFSRIG
KX660677_MHBs_P-RF-DC      YKWNSTTFHQTLQDPRVRGLYFPAGGFSSGTVNPVPTTASPISSIFSRIG
KX660684_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX660685_MHBs_P-RF-DC      XQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX660686_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX660689_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX765835_MHBs_P-RF-GC      MQWNSTAFHQALQNPKVRGLYLPAGGSSSGIVNPVPTIASHISSIFSRIG
KX774505_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSTTG
KX827299_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX827302_MHBs_P-RF-DE      MQWNSTTFHQTLQDPKVRGLTFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KY363263_MHBs_P-RF-CB      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470843_MHBs_P-RF-DC      VQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRIG
KY470844_MHBs_P-RF-DC      VQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRIG
KY470854_MHBs_P-RF-DC      VQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRIG
KY470856_MHBs_P-RF-DC      VQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSISSRIG
KY470893_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KY470997_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
KY470998_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
KY470999_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRVG
KY471004_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIAPHISSIFTRIG
KY629632_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRIG
KY670781_MHBs_P-RF-DC      LQWNSTTFHQTLQDPRVRGL--PAGGSSSGTVNPVPTTASPISSIFSRIG
LC279263_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC416040_MHBs_P-RF-CB      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTSASPISSIFSRTG
LC458432_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
M38454_MHBs_P-RF-CB        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF488699_MHBs_P-RF-DE      VRWNSTTFHQALQDPRVRGLNRPAGGSTSGTVNPVPTTASPILSIFSKIG
MF488702_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MF488705_MHBs_P-RF-AD      VQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
MF618346_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MF925360_MHBs_P-RF-DB      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925370_MHBs_P-RF-CB      MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925371_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKDLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925382_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925384_MHBs_P-RF-DB      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSILSRIG
MF925386_MHBs_P-RF-AC      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISTRTG
MF925389_MHBs_P-RF-DC      MQWNSRTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MF925396_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925397_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSHTSSTLSTTG
MF925401_MHBs_P-RF-DB      MQWNSTTFNQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925402_MHBs_P-RF-BD      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTASAISSIFSKTG
MF925404_MHBs_P-RF-AC      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTLNPVPTIASHISSISSRTG
MF967563_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
MG826141_MHBs_P-RF-CB      MQWNSTTFHQALLGPKVRGLDLPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826142_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLDLPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826144_MHBs_P-RF-CB      MQWNTTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPTSSIFSRTG
MG826145_MHBs_P-RF-BC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MG826146_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYYPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826147_MHBs_P-RF-CB      AQWNSTTFHQALLGPKVRALNLPAGGSSSGTVNPFPTIASPISSIFSRAG
MG826148_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826149_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG826150_MHBs_P-RF-BC      AQWNSTTFHQTLQDPKVRALYFPAGGSSSGTVSPAQNTVSAISSISSTTG
MG826151_MHBs_P-RF-BC      AQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MG877711_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
MG893554_MHBs_P-RF-CB      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG893555_MHBs_P-RF-CB      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MH094410_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MH464835_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464846_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464851_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH481858_MHBs_P-RF-DE      MQWXSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRIG
MH481859_MHBs_P-RF-DE      MQWXSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRIG
MH481860_MHBs_P-RF-DE      MQWXSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRIG
MH481861_MHBs_P-RF-DE      MQWXSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRIG
MH685719_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
MH724222_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH724239_MHBs_P-RF-DE      MQWNSTTFHQTLQDPKVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH724240_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPESSTFSRIG
MH724243_MHBs_P-RF-DE      MQWNSTTFHQTLQDPTARGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH746811_MHBs_P-RF-BC      MQWNITTFHQTLQDPRVRALYFPAGGSSAGTVSPAQNTVSTISSILSKTG
MH746812_MHBs_P-RF-BC      MQWNITTFHQTLQDPRVRALYFPAGGSGSGTVSPAQNTVSTISSILSKTG
MH746813_MHBs_P-RF-BC      MQWNSTTFHQALQDPRIRGLYFPAGGSGSGTVSPAQNTVSAISSILSKTG
MK052957_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052967_MHBs_P-RF-BD      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTG
MK052968_MHBs_P-RF-BD      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTG
MK052969_MHBs_P-RF-DE      MQWNSTTFHHTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK052970_MHBs_P-RF-BD      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTG
MK052976_MHBs_P-RF-BD      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSTLSKTG
MK321265_MHBs_P-RF-CB      MQWNSTTFHQALLXPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK516279_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIG
MK534555_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534556_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534558_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534559_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTVSAISSILSKTG
MK534560_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
MK534562_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534574_MHBs_P-RF-CB      MQWNSNTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534579_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534582_MHBs_P-RF-BC      MQWNSSTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSISSKTG
MK534585_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534587_MHBs_P-RF-BC      VRWNSTAFLQTLQDPRVRALYMPAGGSSSGTVSPAQNTVSSISSILSKTG
MK534589_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534594_MHBs_P-RF-BC      VRWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534606_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534607_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSISSKTG
MK534609_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534610_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534613_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534615_MHBs_P-RF-BC      MQWNSNTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSSFSRTG
MK534616_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534620_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534623_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534630_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYLPAGGSSSGTVNPVQNTVSSISSILSKTG
MK534632_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534633_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534635_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534637_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSKTG
MK534641_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534646_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534653_MHBs_P-RF-BC      MKWNSTTFHQTLQDPRVRALFFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534660_MHBs_P-RF-BC      IQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNSVSTISSILSKTG
MK534663_MHBs_P-RF-CB      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFARIG
MK534664_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534665_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534668_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534669_MHBs_P-RF-CB      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFARIG
MK534670_MHBs_P-RF-BC      MQWNATTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534679_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534681_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALFFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534686_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALFFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534688_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534690_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534695_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534701_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTVSSISSILSTTG
MK534706_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534712_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534714_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534715_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534716_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTVFSISSILSKTG
MK534718_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534719_MHBs_P-RF-CB      MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTANPVPTSASPISSIFSRTG
MK534721_MHBs_P-RF-BC      MHWNSTKFQQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534722_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTG
MK534723_MHBs_P-RF-BC      MQWNSSTFHQTLQDPRVRALYFPAGGSSSGTVNPAQNTASAISSILSKTG
MK534725_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534728_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534730_MHBs_P-RF-BC      IQWNSTKFHQTLQDPRVRDLYFPAGGSSSGTANPVQNTASSISSILSKTG
MK534731_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSNLSKTG
MK534734_MHBs_P-RF-BC      MHWNSTKFQQTLQDPRVRALYFPAGGSSSGTVSPVQNTVSAISSILSKTG
MK541689_MHBs_P-RF-DE      MQWTSKTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSLFSKIG
MK598652_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
MK598653_MHBs_P-RF-DE      MQWNSTTFHQTLQDPTVRGLYFPAGGSSSGTVNPLPTTASHISSIFSRIG
MK598654_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
MK598656_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
MK618438_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK618439_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRNG
MK618445_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
MN507850_MHBs_P-RF-DE      MQWNSTTFHRTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
MN650068_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFARIG
MN650069_MHBs_P-RF-DC      MLWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650076_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRIG
MN650083_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683571_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASPISSIFSRIG
MN683572_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683574_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFLRIG
MN683581_MHBs_P-RF-DC      MQWNSITFLQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSISLRIG
MN683582_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683586_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683588_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683592_MHBs_P-RF-DC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTASPISSIFSRIG
MN683596_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683603_MHBs_P-RF-DC      MQWNSPTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683610_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683611_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683612_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683618_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTASPISSIFSKIG
MN683619_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSRIG
MN683620_MHBs_P-RF-DC      MQWNSTTFLQTLQDPRGRDLCFPAGGSSSGTVNPVPTTASPILSIFSRIG
MN683622_MHBs_P-RF-DC      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683624_MHBs_P-RF-DC      MQWNSTNFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
MN683625_MHBs_P-RF-DC      MKWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683626_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683627_MHBs_P-RF-DC      MQWTSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTAFPISSIFSRIG
MN683628_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTLNPVPTTASPISSIFSRIG
MN683634_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683635_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683637_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683638_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683640_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683641_MHBs_P-RF-DC      MQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683642_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683655_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683656_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683662_MHBs_P-RF-DC      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRTG
MN683668_MHBs_P-RF-DC      MKWNSTTFHQTLQDPRVRGLYFPAGGFSSGTVNPVPTTASPISSIFSRIG
MN683671_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683673_MHBs_P-RF-DC      MQWNSTNFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683675_MHBs_P-RF-DC      MQWNSITFLQTLQDPRGKGLCFPAGGSSSGTVNPVPNTASPISSTFLRIG
MN683676_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRIG
MN683677_MHBs_P-RF-DC      MQWNSTNFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683683_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683684_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683688_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683692_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683694_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683700_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683712_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSILSRIG
MN683713_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683716_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683717_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683718_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683720_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683721_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683722_MHBs_P-RF-DC      MQWNSTTFLQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683725_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683730_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MT426089_MHBs_P-RF-AB      MQWNSTTFHQALQDPRVRGLYLPAGGSSSGTLHPVPNIASHISSISSRTG
MT426110_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
MT426112_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
MT426113_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPISSIFSRIG
MT426114_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHILSIFSRIG
MT426455_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426456_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426457_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426461_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426462_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426466_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426469_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426471_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426473_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426478_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426479_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426480_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426481_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426483_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426485_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
MT426486_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426488_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426489_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426492_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426499_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426500_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426503_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426504_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426508_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426509_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426512_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTGNPVPTTASPISSIFSRTG
MT426514_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426517_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426518_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426519_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426523_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGIYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426526_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426530_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426531_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426533_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426537_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426538_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426539_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426540_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426542_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRTG
MT426544_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426546_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426553_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426555_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426557_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426558_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426560_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426563_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFARTG
MT426564_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426569_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT591274_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
MT591280_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MT645015_MHBs_P-RF-CB      IQWNSSTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MT645029_MHBs_P-RF-CB      MQWNSTTFHQALVDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT645035_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MT645039_MHBs_P-RF-CB      VQWNTTTFHQALVDPRVRGLYLPAGGSGSGTVNPVPTTASPTSSIFSRTG
MT645045_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSTTG
MT645056_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MT645062_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MT645063_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVDPVPTTASPISSIFSRIG
MT645065_MHBs_P-RF-DC      IQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MT645067_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPVGGSSSGTVNPVPTTASPISSIFLRIG
MT645069_MHBs_P-RF-CB      MQWNTTTFHQALLDPRVRGLYLPAGGSNSGTVNPVPTTASPISSIFSRTG
MT645070_MHBs_P-RF-DC      TQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKIG
MT645071_MHBs_P-RF-CB      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MW601227_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MW601230_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
MW601241_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
MW601264_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MW601284_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MW601296_MHBs_P-RF-DE      MQWNSTTFHQTLQDPXXXXXXXPAGGSSSGTVNPVPTTASHLSSIFSRIG
MW601310_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHSSSISSRIG
MW601317_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
MW887645_MHBs_P-RF-CD      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MZ043066_MHBs_P-RF-AC      MQWNSTAFHQALQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
MZ097652_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MZ097667_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
MZ097680_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHTSSTSSRTG
MZ097687_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
MZ097703_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIXSRIG
MZ097716_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MZ097745_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MZ097806_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MZ097814_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MZ097822_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSKIG
MZ097826_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MZ439768_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
MZ439798_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
OK143485_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRDLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
OK143494_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
ON854595_MHBs_P-RF-EA      MQWKSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTVSLISSIFSRIG
X65259_MHBs_P-RF-DA        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSISARTG
X68292_MHBs_P-RF-DA        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVLTTASPLSSISARTG
X75656_MHBs_P-RF-CB        MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPTTASLISSIFSRTG
X80925_MHBs_P-RF-DE        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
Y18857_MHBs_P-RF-CB        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700524_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700525_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
AB195941_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
AB195951_MHBs_P-RF-CB      VQWNSTTFHQALLDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AB195957_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSKTG
MZ097766_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
AB493847_MHBs_P-RF-CB      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
GQ358155_MHBs_P-RF-CB      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
GQ358156_MHBs_P-RF-CB      MQWNSTAFHQALLDPRVRGLYFPAGGSSSGTVNPVPTIASPISSIFSRTG
AJ627217_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
DQ111987_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
GQ183486_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KC774450_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KT366504_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MW601235_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MW601260_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MZ097721_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MZ097740_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
OK143491_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
AB933280_MHBs_P-RF-AG      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
AB933281_MHBs_P-RF-AG      MQWNSTAFHQTLQDPRVRGLYLPAGGSSSGTVNPAPNIASHISSISARTG
AP011105_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVLTSASPISSIFSRTG
KC774230_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
AY161146_MHBs_P-RF-AD      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTLNPVPNIASHISSISSRTG
FJ386585_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX026887_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX661494_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774198_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774201_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774246_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774258_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774317_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774322_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774328_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173299_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ173300_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963990_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963991_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963994_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963995_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963998_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963999_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964001_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964003_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG893559_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MG893561_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK720627_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK720628_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MW887644_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
Y18856_MHBs_P-RF-CB        MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM750142_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HM750147_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HM750148_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HM750149_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HM750150_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700497_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700501_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700541_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700581_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700583_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
HQ700584_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774482_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP168417_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP168418_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP276253_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP276256_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KU736921_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KU736922_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KU736923_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650072_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650073_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650074_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650075_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650077_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650078_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650079_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650080_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650081_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650082_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650084_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650085_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650086_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN650087_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683584_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683679_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683680_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683685_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683687_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683689_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683690_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683691_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683695_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683697_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683699_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683703_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683715_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683719_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683723_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KT366505_MHBs_P-RF-DE      MQWNSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
DQ478889_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
DQ478897_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
EU787434_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF491449_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JX429898_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774423_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774424_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774426_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774432_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774433_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774434_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774457_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774470_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774471_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774472_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774475_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774488_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774493_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774497_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774499_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP276254_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KP276255_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KU519422_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX660675_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN657316_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683579_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683590_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683607_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683613_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683614_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683615_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683617_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683630_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683636_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683643_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683644_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683647_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683649_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683650_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683651_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683653_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683654_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683666_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683669_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683672_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MT645049_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MT645066_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MW999633_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC012653_MHBs_P-RF-AD      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
FJ032343_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGL--PAGGSSSGTVNPVPTTASPISSIFSRTG
JQ687532_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MZ097850_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ692536_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KF779353_MHBs_P-RF-DA      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KP168416_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
FJ023664_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ023665_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ023668_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ023673_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ882612_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ882618_MHBs_P-RF-GC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
EU871983_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871986_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871987_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871989_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871990_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871992_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871993_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871985_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
EU871994_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSATVNPVPTTASPISSIFSRTG
FJ386581_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377611_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HM750133_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JN400086_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX429896_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774294_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963856_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963857_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963858_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963860_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963861_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963863_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963864_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963865_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963866_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963867_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU963870_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
EU916241_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRTG
EU919167_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MN683686_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683693_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683724_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
FJ715412_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715413_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ715414_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
FJ882614_MHBs_P-RF-GC      MQWNSTTFHQALQDPKVRGLYFPAGGSSSGTVNPVPNIASHISSIFARTG
FJ904417_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
GQ205378_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
GQ205386_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
GQ205387_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
KC875338_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSTSGTVNPVPTTASPILSIFSKIG
KC774332_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KM213033_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
OM732333_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
GQ377607_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
HQ700499_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGAVNPVPTTASPISSIFSRTG
HQ700585_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
JF439995_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439996_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF439999_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440002_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440003_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440007_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440009_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440010_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440012_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440014_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440015_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440017_MHBs_P-RF-DA      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF440005_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JF828935_MHBs_P-RF-CB      IQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MZ097838_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSHISSIFSRIG
MN683696_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683587_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KR905422_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925388_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MF925392_MHBs_P-RF-DB      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN507835_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KJ410506_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534682_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
JX898687_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898688_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898698_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898699_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
MT426111_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
U95551_MHBs_P-RF-DE        MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPLSSIFSRIG
JX898696_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPAPTTASPLSSIFSRIG
KC774364_MHBs_P-RF-BC      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSILSKTG
KC774341_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KC774349_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534726_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534736_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
KC774454_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774476_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX660674_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KX660680_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN657315_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683580_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683597_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683605_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683639_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683652_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683664_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683665_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683670_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683678_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MT645060_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTANPVPTTASPISSIFSRIG
KC774468_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683616_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KC774443_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPILSIFSRIG
KC774455_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGAVNPVPTTASPILSIFSRIG
KC774480_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KU519423_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN657317_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683632_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683660_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683661_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683663_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683674_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683714_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
KJ803753_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803827_MHBs_P-RF-BC      MQWNSSTFHPTLQDPRVRALYFPAGGSSSGTVNPVQNTASPISSILSTTG
KJ803772_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVNPVQNTASSISSILSKTG
KJ803778_MHBs_P-RF-BC      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVSPAQNTVSTTSSHLSKTG
KJ803782_MHBs_P-RF-CB      MQWNSTTVHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASPISSILSRTG
KF192836_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF192837_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF192838_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF192839_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KF192841_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MF618347_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KU679955_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSFGAVNPVPNTVSPISSIFTKTG
KU679941_MHBs_P-RF-CB      MQWNSTTFQQALLDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTKTG
KF873533_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KF873538_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KF873542_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KF873543_MHBs_P-RF-CB      MQWNSTAFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTVSHISSIFTTTG
KJ173322_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASHISSIFSRIG
KJ470886_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KJ470888_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KJ470890_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
KJ803791_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTANPVPTSASPISSIFSRTG
KJ803802_MHBs_P-RF-CB      MQWNSTTFHQTLLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ717816_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KJ803803_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU695743_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
KU964006_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964007_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964008_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964009_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964010_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964303_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964304_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964305_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964307_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964308_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964309_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964310_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964311_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964312_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964313_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964314_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964315_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KU964317_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTINPVPTTASPTSSIFSRTG
KX357630_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASHISSIFSRIG
KX357633_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASHISSIFSRIG
KX357635_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVSPVPTTASHISSIFSRIG
MN683706_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683707_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683711_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
KY470846_MHBs_P-RF-DC      VQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRIG
KY470847_MHBs_P-RF-DC      VQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRIG
KY470849_MHBs_P-RF-DC      VQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRIG
KY470850_MHBs_P-RF-DC      VQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRIG
KY470855_MHBs_P-RF-DC      VQWNSTTFLQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSISSRIG
KY471003_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
KY471005_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
KY471006_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
KY471007_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
KY471001_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRIG
KY471000_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRVG
KY471002_MHBs_P-RF-GC      MQWNSTTFHQALQDPRIRGLYFPAGGSSSGTVNPAPNIASHISSIFTRVG
LC279264_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279265_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279266_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
LC279267_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MH464850_MHBs_P-RF-DA      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH464852_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MT210033_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPLSSIFSRIG
MH481862_MHBs_P-RF-DE      MQWXSTTFHQTLQDPRVRGLYFPAGGSSSGIVNPVPTTASPISSIFSRIG
MK516280_MHBs_P-RF-DE      MQWTSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPTTASPILSIFSKIG
MK534561_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534563_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534564_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534566_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534567_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534568_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534577_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534580_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534583_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534598_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534625_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534639_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534651_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534685_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534700_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534569_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534584_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534590_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534617_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534618_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534654_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534655_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534662_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534675_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534729_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534648_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534684_MHBs_P-RF-BC      MQWNSTTFHQTLQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534713_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534735_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534687_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534689_MHBs_P-RF-BC      MQWNSTTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534672_MHBs_P-RF-BC      MQWNATTFHQALQDPRVRALYFPAGGSSSGTVSPAQNTVSAISSILSKTG
MK534717_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK534724_MHBs_P-RF-CB      MQWNSSTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTG
MK618440_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK618442_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
MK618444_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
MN683609_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPNTASPISSIFSRIG
MN683594_MHBs_P-RF-DC      MQWNSTTFHQALQDPRVRGLYFPAGGSSSGTVNPVPNTASPISSIFSRIG
MN683657_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVKGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683621_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MN683623_MHBs_P-RF-DC      MQWNSTNFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683658_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683659_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTVSPISSIFSRIG
MN683645_MHBs_P-RF-DC      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRIG
MT426463_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426465_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426467_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426468_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426470_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426472_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426475_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426476_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426477_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426482_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426484_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426490_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426491_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426493_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426494_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426495_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426497_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426498_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426501_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426502_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426505_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426506_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426510_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426511_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426513_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426520_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426521_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426522_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426524_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426525_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426527_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426528_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426529_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426532_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426535_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426536_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426541_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426545_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426550_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426551_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426554_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426556_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426561_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426565_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426566_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426567_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426568_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426570_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426571_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426573_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426574_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426576_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426459_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426460_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426464_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426487_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426496_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426507_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426547_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426549_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426572_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426543_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426559_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426515_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426562_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426534_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT426575_MHBs_P-RF-CB      MQWNSTTFHQALLDPRVRGLYLPAGGSSSGTVNPVPTTASPISSIFSRTG
MT591275_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVKGLYLPAGGSSSGTVNPVPTTASPISSIFSRIG
MZ097719_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTVSPISSIFSRIG
MZ097724_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYLPAGGSSSGTVNPVPTTASHLSSIFSRIG
MZ097758_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHLSSIFSRIG
MZ097777_MHBs_P-RF-DE      MQWNSTTFHQTLQDPRVRGLYFPAGGSSSGTVNPVPTTASHSSSISSRIG
                                                   *                        .

KY470853_MHBs_P-RF-DC      DPALNMEKITSGFLKPLLALQAGFFSLTRILTIPQSLDSWWTSLSFLGGT
AB031265_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB033557_MHBs_P-RF-CB      DPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB033558_MHBs_P-RF-DE      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB033559_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB048702_MHBs_P-RF-DE      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB048703_MHBs_P-RF-DE      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB049609_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB105172_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
AB188243_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGT
AB188245_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB194949_MHBs_P-RF-AE      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGES
AB195939_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195940_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195950_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195955_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195956_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB198084_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB205152_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB210819_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB222708_MHBs_P-RF-AD      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB241109_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB270535_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB270538_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB300369_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AB330368_MHBs_P-RF-DA      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB367393_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367400_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367419_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB367800_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLGLQAGFFLLTKILTIPQSLDLWWTSLNFLGGA
AB453985_MHBs_P-RF-AC      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB493837_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
AB493838_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
AB493840_MHBs_P-RF-CB      DPAQNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
AB493842_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
AB583679_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB642096_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB674432_MHBs_P-RF-DE      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674433_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674434_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFSWLTKILTIPQSLDSWWTSLNFLGGT
AB674436_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB674504_MHBs_P-RF-DC      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB933279_MHBs_P-RF-AG      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB933282_MHBs_P-RF-AG      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AB933283_MHBs_P-RF-AG      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGX
AF233236_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AF297619_MHBs_P-RF-DA      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF297620_MHBs_P-RF-DA      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AF330110_MHBs_P-RF-CB      DPAPNMESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF411409_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AF461361_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AJ344117_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AJ627221_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
AM494716_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
AP011102_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
AP011103_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
AP011104_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AP011108_MHBs_P-RF-CB      DPASNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
AY040627_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY057948_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY123424_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY161140_MHBs_P-RF-AD      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSIDSWWTSLNFLGGS
AY161141_MHBs_P-RF-AD      DPAPNMENITSGFHGPLLVLQAGFFLLTRILTIPQSIDSWWTSLNFLGGS
AY161145_MHBs_P-RF-AD      DPAPNMENITSGFLGPLLVLQAGFFLLTSFLTIPQSLDSWWTSLNFLGGS
AY161147_MHBs_P-RF-DA      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY167095_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY206374_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY233277_MHBs_P-RF-AC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
AY233293_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY233295_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY236161_MHBs_P-RF-DA      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY247030_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY341335_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY373430_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY800249_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY817509_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY817510_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY817511_MHBs_P-RF-DC      DPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY817512_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY817513_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY817515_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY862864_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY862865_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AY862866_MHBs_P-RF-DC      DPAPSMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ089798_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
DQ315779_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ464164_MHBs_P-RF-DE      DPALNMENITSGFLQPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
DQ464165_MHBs_P-RF-DE      DPALNMENITSGFLQPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
DQ464166_MHBs_P-RF-DE      DPALNMENITSGFLQPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
DQ464167_MHBs_P-RF-DE      DPALNMESITSGFLQPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
DQ478886_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ478887_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ478890_MHBs_P-RF-DC      DPVRNMENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ478892_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ478898_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ991753_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGT
EF103283_MHBs_P-RF-AD      DPATNMHKITSGFLGPLLVLQAGFILLTRILSLPQSLDSWWTSLNFLGGS
EF103284_MHBs_P-RF-AD      DPAPNMENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EF103285_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EF464099_MHBs_P-RF-AG      DPATNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EF494376_MHBs_P-RF-CA      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EF494378_MHBs_P-RF-CA      DLAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU185780_MHBs_P-RF-AD      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
EU522070_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU589337_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU594406_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594435_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU594436_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU660227_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
EU717211_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU787435_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU787444_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU833890_MHBs_P-RF-GA      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
EU833891_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
EU835240_MHBs_P-RF-GC      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGES
EU871981_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871984_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871988_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871991_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGA
EU871995_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871996_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871997_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871999_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU881995_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU882006_MHBs_P-RF-CB      DPVPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU916228_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU916232_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGT
EU916239_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU916240_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU919166_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939547_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939551_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
EU939565_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939577_MHBs_P-RF-CB      DPAPKMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939581_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939589_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939606_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939620_MHBs_P-RF-CB      DPVPNMENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939621_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939623_MHBs_P-RF-CB      DPALNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939627_MHBs_P-RF-BC      DPVPNMENIASGLXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXT
EU939629_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGT
EU939630_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU939631_MHBs_P-RF-BC      DPAPNMESTTSGFPGPLLVLQAGYFSLTKILTIPQSLDSWWTSLNFQRET
EU939668_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ023659_MHBs_P-RF-BC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FJ023662_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FJ023666_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ023667_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ023670_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ032337_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ349207_MHBs_P-RF-DE      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGT
FJ349212_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ349221_MHBs_P-RF-DE      DPVLSMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGP
FJ349241_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ386586_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386635_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386649_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ386674_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGT
FJ562223_MHBs_P-RF-CD      DPALNMESITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGA
FJ562226_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562227_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562229_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562247_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGA
FJ562263_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ562267_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562278_MHBs_P-RF-DC      DXAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
FJ562287_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562294_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562305_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562314_MHBs_P-RF-CB      DPALNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562317_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ562328_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWLSLNFLGGA
FJ562336_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGA
FJ715345_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FJ715346_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFQGGA
FJ715347_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFQGGA
FJ715384_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715385_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715387_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715411_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787446_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ787480_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ882610_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ882613_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ882617_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFXGGS
FJ904394_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGT
FJ904396_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904398_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904400_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
FJ904403_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
FJ904404_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
FJ904405_MHBs_P-RF-DE      DLALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904406_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
FJ904407_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904408_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904409_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904414_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904416_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904425_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904430_MHBs_P-RF-DE      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ904436_MHBs_P-RF-DE      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
FJ904437_MHBs_P-RF-DE      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904440_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904441_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ904442_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGT
FJ904444_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
FJ904447_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
FN594767_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FN594769_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FN594770_MHBs_P-RF-DE      DPALNMENITSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
FN594771_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FR714490_MHBs_P-RF-GB      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
FR714496_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ161753_MHBs_P-RF-AE      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ161754_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ161806_MHBs_P-RF-EA      DXAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ161837_MHBs_P-RF-AE      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ161838_MHBs_P-RF-AE      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ205377_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ205379_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ331048_MHBs_P-RF-AE      DPVPNMENITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
GQ377516_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377520_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377522_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377534_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377544_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377549_MHBs_P-RF-CB      DPVPNMENIASGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ377556_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGA
GQ377560_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377564_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
GQ377565_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377573_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ377581_MHBs_P-RF-CB      DPAPNMENTXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377590_MHBs_P-RF-CB      DPXPNMENXXSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377592_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
GQ377594_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377595_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
GQ377596_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGA
GQ377602_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377604_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGA
GQ377613_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGA
GQ377614_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ377626_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377627_MHBs_P-RF-CD      DPALNMENXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377630_MHBs_P-RF-BC      DPAPNMENTASGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGT
GQ377633_MHBs_P-RF-CB      DPAPNMEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377634_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
GQ377635_MHBs_P-RF-BC      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ924618_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GU177079_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GU357843_MHBs_P-RF-CB      DPAPNMENITSGLLGPLLVLQAGFFLLTKILTMPQSLDSWWTSHNFLGGT
GU385774_MHBs_P-RF-CB      DPAPSMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GU563560_MHBs_P-RF-DE      DPALNMANSISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HE981179_MHBs_P-RF-FG      GPAMNMDNITSGLLGPLLVLQAVCFLLTKILTIPQSLDSWWTSLNFLGGL
HF571060_MHBs_P-RF-AE      DPAPTMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
HM011502_MHBs_P-RF-EB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM146131_MHBs_P-RF-AD      DPAPNMENIASGYLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
HM750143_MHBs_P-RF-DC      DPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750144_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750145_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750146_MHBs_P-RF-DC      DPALKMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ684848_MHBs_P-RF-CB      DPVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ684849_MHBs_P-RF-BC      DPVTNMENTASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGET
HQ700462_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700485_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700492_MHBs_P-RF-DE      VPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLXFLGGT
HQ700493_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700494_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700498_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700500_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700503_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700505_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700507_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700508_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700509_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXA
HQ700515_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700518_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700519_MHBs_P-RF-CB      DPALSMESTTSGFLGPLLXLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700520_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700521_MHBs_P-RF-CB      DPALNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700523_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700526_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700527_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700528_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700530_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700531_MHBs_P-RF-CB      DPALNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700532_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700533_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700534_MHBs_P-RF-DE      DPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700535_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
HQ700536_MHBs_P-RF-DE      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
HQ700537_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700538_MHBs_P-RF-DE      DXALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700539_MHBs_P-RF-DE      DXALNMENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGT
HQ700540_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700542_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700547_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700554_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLXLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700557_MHBs_P-RF-CB      DPALNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700560_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700579_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700580_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEX
HQ700582_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
J02202_MHBs_P-RF-DE        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF436919_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGA
JF436922_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF436923_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTEILTIPQSLDSWWTSLNFLGGT
JF439994_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439998_MHBs_P-RF-DE      DPVLNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440000_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440001_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440004_MHBs_P-RF-DE      DPALSMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440006_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440011_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440013_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440019_MHBs_P-RF-AG      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF440022_MHBs_P-RF-AG      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
JF491448_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF491451_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF491455_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF491456_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF754613_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGN
JF754616_MHBs_P-RF-DE      DPVLNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF828933_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828934_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828936_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JF828938_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN040798_MHBs_P-RF-DE      DPALNMENITSGFPGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN040803_MHBs_P-RF-DE      DLALNMENITSGFLGPLLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGT
JN257154_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVFQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JN257164_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257174_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257189_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGT
JN257191_MHBs_P-RF-DE      DXALNMENITSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257204_MHBs_P-RF-DE      DPALNMENITSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257206_MHBs_P-RF-DE      DLALNMENITSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGT
JN257210_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN257216_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642127_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642137_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN642139_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642141_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN642152_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLVTRILTIPQSLDSWWTSLNFLGGT
JN642160_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664915_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664925_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664929_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
JN664933_MHBs_P-RF-DA      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664934_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664935_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664940_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664943_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN664946_MHBs_P-RF-DA      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688689_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JN688715_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGT
JN688717_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ027310_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLEGA
JQ040142_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040146_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040148_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGA
JQ040174_MHBs_P-RF-CB      DPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ040175_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTLPQSLDSRWTSLNFLGGA
JQ272886_MHBs_P-RF-GF      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ272887_MHBs_P-RF-GF      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
JQ412091_MHBs_P-RF-BC      DPAQNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JQ732168_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801476_MHBs_P-RF-CG      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ801477_MHBs_P-RF-BC      DPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGET
JX036328_MHBs_P-RF-CD      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSRDSWWTSLNFLGGA
JX036329_MHBs_P-RF-CD      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX036330_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX036332_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX036358_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX504540_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGV
JX661485_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661486_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661487_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661498_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
JX898686_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898690_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898693_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898695_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC172106_MHBs_P-RF-GB      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KC315400_MHBs_P-RF-CB      DPVPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774178_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGT
KC774183_MHBs_P-RF-CB      DLAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774186_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774188_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774193_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774212_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774222_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774234_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774263_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774291_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774305_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774307_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774323_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774324_MHBs_P-RF-CB      DPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774344_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774414_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KC774420_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774422_MHBs_P-RF-DC      DPAPNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774425_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774428_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774430_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774431_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774435_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774439_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774442_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774447_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774448_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774449_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774452_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774453_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774456_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774458_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774461_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774463_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774466_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774474_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774478_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774479_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774481_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774483_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774484_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774485_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774486_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774487_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774489_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774490_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774492_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774494_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774495_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774498_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC793112_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGT
KC875339_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF053160_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KF053166_MHBs_P-RF-BC      DPAPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGET
KF053179_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGET
KF053186_MHBs_P-RF-BC      DPVPNMENIASGLLEPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGGT
KF053188_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
KF170740_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192833_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192835_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192840_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF214656_MHBs_P-RF-AC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGP
KF219922_MHBs_P-RF-GH      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KF471643_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF873511_MHBs_P-RF-CB      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873513_MHBs_P-RF-CB      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873515_MHBs_P-RF-CB      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873517_MHBs_P-RF-BC      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873518_MHBs_P-RF-CB      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873519_MHBs_P-RF-CB      DPAANMENTPSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873521_MHBs_P-RF-BC      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873522_MHBs_P-RF-CB      DPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873523_MHBs_P-RF-CB      DPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873524_MHBs_P-RF-CB      DPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873527_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873530_MHBs_P-RF-CB      DPASNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873531_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873532_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873534_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873535_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873537_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGA
KF873540_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGA
KF917451_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ173279_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173280_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173320_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173325_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173326_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSXNFLGGA
KJ173329_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173330_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173349_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173350_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173358_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ410497_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGET
KJ410520_MHBs_P-RF-CB      DPAPNMENTTSRFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ470884_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ470887_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ470891_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ470897_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ470898_MHBs_P-RF-DE      DLAQNMENITSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGT
KJ586803_MHBs_P-RF-AF      GPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ586810_MHBs_P-RF-AF      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KJ586811_MHBs_P-RF-DF      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ598675_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
KJ647349_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGN
KJ647351_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ647356_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
KJ717800_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFPGGA
KJ717814_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KJ717815_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ717832_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803771_MHBs_P-RF-DB      VPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ803785_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEA
KJ803798_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803804_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803822_MHBs_P-RF-CB      GPAPNMENTTSGFLGPPIVLQAGFFLLTRILAMPQSGDSCRNSFNFLGGA
KM359442_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGT
KM386676_MHBs_P-RF-DE      DLALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524357_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM524359_MHBs_P-RF-DE      DPALNMESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM577663_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM577664_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM577665_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
KM577666_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGR
KM577667_MHBs_P-RF-DE      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM606741_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM606750_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM606751_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KM875422_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KP148337_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KP148352_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KP148441_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KP148442_MHBs_P-RF-BC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KP148449_MHBs_P-RF-GC      DPATIMENITSGFLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KP148450_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KP148586_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KP168421_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP274926_MHBs_P-RF-GA      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KP288875_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP995112_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGT
KR013806_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013816_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KR013843_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KT003704_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KT366492_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366503_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT991417_MHBs_P-RF-DC      DLVPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
KT991419_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT991420_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
KT991423_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
KT991424_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT991427_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGT
KU668440_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU679939_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679940_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679942_MHBs_P-RF-CB      DPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679943_MHBs_P-RF-BC      DPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679944_MHBs_P-RF-BC      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679945_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679946_MHBs_P-RF-BC      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679948_MHBs_P-RF-CB      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KU679950_MHBs_P-RF-CB      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679953_MHBs_P-RF-BC      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679954_MHBs_P-RF-CB      DPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679956_MHBs_P-RF-CB      DPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679958_MHBs_P-RF-CB      DPAXNMESTXXGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGEA
KU695741_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
KU695742_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
KU695744_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
KU695745_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
KU695746_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
KU711666_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU736914_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU736916_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU736917_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU963859_MHBs_P-RF-CB      DPAPNMESTTSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963862_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963868_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963869_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963883_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963993_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964005_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964306_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964316_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964351_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX096713_MHBs_P-RF-CA      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
KX357623_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357624_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLSFLGGP
KX357625_MHBs_P-RF-DE      DPVLNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGT
KX357626_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357627_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357628_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357629_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
KX357631_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357634_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357636_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357641_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX660677_MHBs_P-RF-DC      DPAPIMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX660684_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGT
KX660685_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAALFLLTRMLTIPLSLYSRWTSLGFLGGS
KX660686_MHBs_P-RF-DC      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX660689_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
KX765835_MHBs_P-RF-GC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
KX774505_MHBs_P-RF-BC      DPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KX827299_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX827302_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY363263_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KY470843_MHBs_P-RF-DC      DPALNMENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY470844_MHBs_P-RF-DC      DPALNMENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY470854_MHBs_P-RF-DC      DPALNMENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY470856_MHBs_P-RF-DC      DPALNMENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY470893_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLNFLGEA
KY470997_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY470998_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY470999_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY471004_MHBs_P-RF-GC      DPATNMENIRSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY629632_MHBs_P-RF-DC      DPAPNMENITSGLLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
KY670781_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
LC279263_MHBs_P-RF-CB      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC416040_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
LC458432_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
M38454_MHBs_P-RF-CB        DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLHSWWTSLNFLGAA
MF488699_MHBs_P-RF-DE      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
MF488702_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF488705_MHBs_P-RF-AD      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF618346_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925360_MHBs_P-RF-DB      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925370_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925371_MHBs_P-RF-DC      VPALNMENITSGFLGPLLVLLAGFSLLTRILTIPQSLDSWWTSLNFLGGT
MF925382_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
MF925384_MHBs_P-RF-DB      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925386_MHBs_P-RF-AC      DPVANMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF925389_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MF925396_MHBs_P-RF-DC      DLVQNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925397_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
MF925401_MHBs_P-RF-DB      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
MF925402_MHBs_P-RF-BD      DPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MF925404_MHBs_P-RF-AC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MF967563_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MG826141_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVYRAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826142_MHBs_P-RF-CB      DPAPNMESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826144_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826145_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MG826146_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826147_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826148_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826149_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG826150_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGT
MG826151_MHBs_P-RF-BC      DPVPKMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MG877711_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MG893554_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
MG893555_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGEA
MH094410_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MH464835_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGN
MH464846_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464851_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH481858_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH481859_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTISQSLDSWWTSLNFLGGT
MH481860_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGT
MH481861_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGT
MH685719_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH724222_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSGWTSLNFLGET
MH724239_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGN
MH724240_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
MH724243_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH746811_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MH746812_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLPAGFFLLTNILTIPQSLDSRWTSLNFLGGT
MH746813_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLPAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK052957_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052967_MHBs_P-RF-BD      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK052968_MHBs_P-RF-BD      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK052969_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK052970_MHBs_P-RF-BD      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK052976_MHBs_P-RF-BD      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK321265_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK516279_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK534555_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534556_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534558_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534559_MHBs_P-RF-BC      DPVPNMENISSGLLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGT
MK534560_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534562_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534574_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534579_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534582_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534585_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534587_MHBs_P-RF-BC      DPVQNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGET
MK534589_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534594_MHBs_P-RF-BC      DPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGET
MK534606_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534607_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGT
MK534609_MHBs_P-RF-BC      DPVPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGT
MK534610_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534613_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534615_MHBs_P-RF-BC      DPAPNMESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGA
MK534616_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGT
MK534620_MHBs_P-RF-BC      DPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGT
MK534623_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534630_MHBs_P-RF-BC      DPAPTMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534632_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534633_MHBs_P-RF-BC      DPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534635_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534637_MHBs_P-RF-BC      DPAPNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534641_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534646_MHBs_P-RF-BC      DPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534653_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534660_MHBs_P-RF-BC      DPVPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGT
MK534663_MHBs_P-RF-CB      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MK534664_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534665_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534668_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLSFLGGT
MK534669_MHBs_P-RF-CB      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MK534670_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534679_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEA
MK534681_MHBs_P-RF-BC      DPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534686_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534688_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534690_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534695_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534701_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGT
MK534706_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534712_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGT
MK534714_MHBs_P-RF-BC      DPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534715_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534716_MHBs_P-RF-BC      DPAPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGET
MK534718_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534719_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MK534721_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534722_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534723_MHBs_P-RF-BC      DPAPNMENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534725_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534728_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534730_MHBs_P-RF-BC      DPAPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534731_MHBs_P-RF-BC      DPVPNMENISSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534734_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK541689_MHBs_P-RF-DE      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK598652_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLSRILTIPKSLDSWWTSLNFLGGT
MK598653_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
MK598654_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPKSQDSWWTSLNFLGGT
MK598656_MHBs_P-RF-DE      DPALNMENITSGFLGPLHVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGT
MK618438_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK618439_MHBs_P-RF-DE      GPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK618445_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN507850_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650068_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650069_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650076_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650083_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683571_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683572_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683574_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683581_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683582_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MN683586_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683588_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683592_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683596_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683603_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683610_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683611_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683612_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683618_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683619_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683620_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGT
MN683622_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683624_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683625_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683626_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683627_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683628_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683634_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683635_MHBs_P-RF-DC      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683637_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDTRGTSLNFLGGT
MN683638_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683640_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683641_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAALFLLTRMLTIPLSLYSRWTSLGFLGGS
MN683642_MHBs_P-RF-DC      DPAPNMDNITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683655_MHBs_P-RF-DC      DLAPNMENITSGFLGPLLVLQAGFSWLTRILTIPQSLDSWWTSLNFLGGT
MN683656_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683662_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683668_MHBs_P-RF-DC      DPAPIMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683671_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683673_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683675_MHBs_P-RF-DC      DHAPNMENITSGFLRPLRVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MN683676_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683677_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683683_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
MN683684_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683688_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683692_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MN683694_MHBs_P-RF-DC      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683700_MHBs_P-RF-DC      DPALNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGET
MN683712_MHBs_P-RF-DC      DPAMNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683713_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683716_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
MN683717_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683718_MHBs_P-RF-DC      DPARNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683720_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683721_MHBs_P-RF-DC      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
MN683722_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683725_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683730_MHBs_P-RF-DC      DHAPNMENITSGFLGPLHVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
MT426089_MHBs_P-RF-AB      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MT426110_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT426112_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MT426113_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT426114_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT426455_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426456_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426457_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426461_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWGTSLNFLGGA
MT426462_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426466_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426469_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426471_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426473_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426478_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426479_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLKAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426480_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426481_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426483_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426485_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426486_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426488_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLLLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426489_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426492_MHBs_P-RF-CB      DPAPKMKNTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426499_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426500_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426503_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSRHSWWTSLNFLGGA
MT426504_MHBs_P-RF-CB      DPAPNMENTASGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426508_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGA
MT426509_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426512_MHBs_P-RF-CB      DPAPNMENTASGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426514_MHBs_P-RF-CB      DPAPNMENTASGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426517_MHBs_P-RF-CB      DPAPNMENTASGFLVPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426518_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426519_MHBs_P-RF-CB      DPAPNMKNTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426523_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFIGGA
MT426526_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSIDSWWTSLNFLGGA
MT426530_MHBs_P-RF-CB      DTAPNMENTASGFLGALLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGA
MT426531_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426533_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSIDSWWTSLNFLGGA
MT426537_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426538_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426539_MHBs_P-RF-CB      DPAPNMKNTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426540_MHBs_P-RF-CB      DPAPNMKNTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426542_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426544_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426546_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426553_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426555_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWCTSLNFLGGA
MT426557_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426558_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFIGGA
MT426560_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGA
MT426563_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426564_MHBs_P-RF-CB      DPAPDMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426569_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT591274_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT591280_MHBs_P-RF-DE      DPALNMETITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT645015_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT645029_MHBs_P-RF-CB      DPAQNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT645035_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT645039_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLGLQAGFFLLTRILTIPQRLDSWWTSLNFLGGA
MT645045_MHBs_P-RF-BC      DPVPKMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGT
MT645056_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGET
MT645062_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT645063_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT645065_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGT
MT645067_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT645069_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT645070_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT645071_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MW601227_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MW601230_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MW601241_MHBs_P-RF-DE      GPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MW601264_MHBs_P-RF-DE      DPAQNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
MW601284_MHBs_P-RF-DE      DPALNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MW601296_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
MW601310_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MW601317_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MW887645_MHBs_P-RF-CD      DPAPNMENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGET
MZ043066_MHBs_P-RF-AC      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
MZ097652_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097667_MHBs_P-RF-DE      DPVLNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097680_MHBs_P-RF-DE      DLAWNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097687_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGN
MZ097703_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097716_MHBs_P-RF-DE      DPXLNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097745_MHBs_P-RF-DE      DPAQNMENXTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGXT
MZ097806_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097814_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MZ097822_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097826_MHBs_P-RF-DE      DPALNMENITSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ439768_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
MZ439798_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
OK143485_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
OK143494_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
ON854595_MHBs_P-RF-EA      DPAPNMESITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
X65259_MHBs_P-RF-DA        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
X68292_MHBs_P-RF-DA        DPVTIMENITSGFLGPLLVLEAGFFLLTRILTIPQSLDSWWTSLNFLGGT
X75656_MHBs_P-RF-CB        DPVTNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSGWTSLNFLGEA
X80925_MHBs_P-RF-DE        DPALNMENITSDFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
Y18857_MHBs_P-RF-CB        DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700524_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700525_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB195941_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195951_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AB195957_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MZ097766_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB493847_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
GQ358155_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
GQ358156_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
AJ627217_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ111987_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ183486_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774450_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366504_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MW601235_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MW601260_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097721_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097740_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
OK143491_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
AB933280_MHBs_P-RF-AG      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AB933281_MHBs_P-RF-AG      DPVTNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGV
AP011105_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KC774230_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
AY161146_MHBs_P-RF-AD      DPAPNMENITSGFLGPLLVLQAGFFLLTSFLTIPQSLDSWWTSLNFLGGS
FJ386585_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX026887_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX661494_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774198_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774201_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774246_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774258_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774317_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774322_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774328_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173299_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173300_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963990_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963991_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963994_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963995_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963998_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963999_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964001_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964003_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG893559_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MG893561_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK720627_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK720628_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MW887644_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
Y18856_MHBs_P-RF-CB        DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM750142_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750147_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750148_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750149_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HM750150_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700497_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700501_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700541_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700581_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700583_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
HQ700584_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774482_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP168417_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP168418_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP276253_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP276256_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU736921_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU736922_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU736923_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650072_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650073_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650074_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650075_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650077_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650078_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650079_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650080_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650081_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650082_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650084_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650085_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650086_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN650087_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683584_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683679_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683680_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683685_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683687_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683689_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683690_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683691_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683695_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683697_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683699_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683703_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683715_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683719_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683723_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KT366505_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ478889_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
DQ478897_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
EU787434_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF491449_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX429898_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774423_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774424_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774426_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774432_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774433_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774434_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774457_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774470_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774471_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774472_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774475_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774488_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774493_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774497_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774499_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP276254_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP276255_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU519422_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX660675_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN657316_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683579_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683590_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683607_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683613_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683614_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683615_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683617_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683630_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683636_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683643_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683644_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683647_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683649_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683650_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683651_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683653_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683654_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683666_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683669_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683672_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT645049_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT645066_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MW999633_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC012653_MHBs_P-RF-AD      DPVTNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGS
FJ032343_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JQ687532_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097850_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ692536_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF779353_MHBs_P-RF-DA      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KP168416_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ023664_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ023665_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ023668_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ023673_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ882612_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ882618_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
EU871983_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871986_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871987_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871989_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871990_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871992_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871993_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871985_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU871994_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGA
FJ386581_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377611_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HM750133_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JN400086_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX429896_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774294_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963856_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963857_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963858_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963860_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963861_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963863_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963864_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963865_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963866_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963867_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU963870_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU916241_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
EU919167_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MN683686_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683693_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683724_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
FJ715412_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715413_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ715414_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
FJ882614_MHBs_P-RF-GC      DLAPNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGS
FJ904417_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ205378_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ205386_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
GQ205387_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC875338_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774332_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KM213033_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
OM732333_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
GQ377607_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
HQ700499_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEA
HQ700585_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JF439995_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439996_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF439999_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440002_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440003_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440007_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440009_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440010_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440012_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440014_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440015_MHBs_P-RF-DE      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440017_MHBs_P-RF-DA      DPALNMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF440005_MHBs_P-RF-DE      DPALSMENITSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
JF828935_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MZ097838_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683696_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683587_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KR905422_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925388_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF925392_MHBs_P-RF-DB      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN507835_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ410506_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534682_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
JX898687_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898688_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898698_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898699_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT426111_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
U95551_MHBs_P-RF-DE        DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
JX898696_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774364_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGT
KC774341_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KC774349_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534726_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534736_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KC774454_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774476_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX660674_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX660680_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN657315_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683580_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683597_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683605_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683639_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683652_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683664_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683665_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683670_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683678_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT645060_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774468_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683616_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774443_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774455_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KC774480_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU519423_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN657317_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683632_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683660_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683661_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683663_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683674_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683714_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ803753_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KJ803827_MHBs_P-RF-BC      DPAPNMENISSGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGET
KJ803772_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGET
KJ803778_MHBs_P-RF-BC      DPVPNMENIASGLLEPLLVLQAGFFLLTKILTIPQSLDSWWTSLSSLGGT
KJ803782_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGET
KF192836_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192837_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192838_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192839_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KF192841_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MF618347_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KU679955_MHBs_P-RF-CB      DPAANMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU679941_MHBs_P-RF-CB      DPATNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873533_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873538_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873542_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KF873543_MHBs_P-RF-CB      DPATNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ173322_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ470886_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ470888_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ470890_MHBs_P-RF-DE      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KJ803791_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFPGGA
KJ803802_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
KJ717816_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KJ803803_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU695743_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964006_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964007_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964008_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964009_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964010_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964303_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964304_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964305_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964307_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964308_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964309_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964310_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964311_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964312_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964313_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964314_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964315_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KU964317_MHBs_P-RF-CB      DPAPNMENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
KX357630_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357633_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KX357635_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683706_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683707_MHBs_P-RF-DC      DLALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683711_MHBs_P-RF-DC      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGT
KY470846_MHBs_P-RF-DC      DPALNMENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY470847_MHBs_P-RF-DC      DPALNMENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY470849_MHBs_P-RF-DC      DPALNMENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY470850_MHBs_P-RF-DC      DPALNMENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY470855_MHBs_P-RF-DC      DPALNMENITSGFLTPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
KY471003_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY471005_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY471006_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY471007_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY471001_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY471000_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
KY471002_MHBs_P-RF-GC      DPATNMENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGA
LC279264_MHBs_P-RF-CB      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279265_MHBs_P-RF-CB      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279266_MHBs_P-RF-CB      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
LC279267_MHBs_P-RF-CB      DPAPNMESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MH464850_MHBs_P-RF-DA      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH464852_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT210033_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MH481862_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK516280_MHBs_P-RF-DE      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK534561_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534563_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534564_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534566_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534567_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534568_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534577_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534580_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534583_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534598_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534625_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534639_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534651_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534685_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534700_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534569_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534584_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534590_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534617_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534618_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534654_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534655_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534662_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534675_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534729_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534648_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534684_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534713_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534735_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534687_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534689_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534672_MHBs_P-RF-BC      DPVPNMENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGT
MK534717_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK534724_MHBs_P-RF-CB      DPAPNMESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MK618440_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK618442_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MK618444_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683609_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683594_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683657_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683621_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683623_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683658_MHBs_P-RF-DC      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683659_MHBs_P-RF-DC      DPAQNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MN683645_MHBs_P-RF-DC      DPAPNMENITSGFLGPLLVVQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MT426463_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426465_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426467_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426468_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426470_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426472_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426475_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426476_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426477_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426482_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426484_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426490_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426491_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426493_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426494_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426495_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426497_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426498_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426501_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426502_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426505_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426506_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426510_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426511_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426513_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426520_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426521_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426522_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426524_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426525_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426527_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426528_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426529_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426532_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426535_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426536_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426541_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426545_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426550_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426551_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426554_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426556_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426561_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426565_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426566_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426567_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426568_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426570_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426571_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426573_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426574_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426576_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426459_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426460_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426464_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426487_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426496_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426507_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426547_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426549_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426572_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426543_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426559_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426515_MHBs_P-RF-CB      DPAPNMENTASGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426562_MHBs_P-RF-CB      DPAPNMENTASGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426534_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGA
MT426575_MHBs_P-RF-CB      DPAPNMENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFIGGA
MT591275_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097719_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097724_MHBs_P-RF-DE      GPALNMENITSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097758_MHBs_P-RF-DE      DPALNMENITSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
MZ097777_MHBs_P-RF-DE      DPALNMENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGT
                                *         .     *     : .*::.        *       

KY470853_MHBs_P-RF-DC      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB031265_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB033557_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB033558_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB033559_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCLIFLL
AB048702_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMFLRRFIIFLFILLLCLIFLL
AB048703_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB049609_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB105172_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB188243_MHBs_P-RF-DE      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB188245_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB194949_MHBs_P-RF-AE      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB195939_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB195940_MHBs_P-RF-CB      PKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLW
AB195950_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB195955_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB195956_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB198084_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB205152_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLL
AB210819_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB222708_MHBs_P-RF-AD      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB241109_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB270535_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLL
AB270538_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB300369_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB330368_MHBs_P-RF-DA      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB367393_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB367400_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB367419_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB367800_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB453985_MHBs_P-RF-AC      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB493837_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB493838_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB493840_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB493842_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB583679_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB642096_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674432_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674433_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674434_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674436_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB674504_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB933279_MHBs_P-RF-AG      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB933282_MHBs_P-RF-AG      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AB933283_MHBs_P-RF-AG      PVCXGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AF233236_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AF297619_MHBs_P-RF-DA      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AF297620_MHBs_P-RF-DA      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFFL
AF330110_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AF411409_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AF461361_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AJ344117_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AJ627221_MHBs_P-RF-DE      TVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIXFLFILLLCLIFLL
AM494716_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AP011102_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AP011103_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AP011104_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AP011108_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY040627_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY057948_MHBs_P-RF-DC      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY123424_MHBs_P-RF-CB      PTCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY161140_MHBs_P-RF-AD      PVCLGQNSQSPTSNHSPTSCAPICTGYRWMCLRRFIIFLFILLLCLIFLL
AY161141_MHBs_P-RF-AD      PVCLGQNSQSPTSNHSPTSCAPICTGYRWMCLRRFIIFLFILLLCLIFLL
AY161145_MHBs_P-RF-AD      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIYLFILHACLIFLL
AY161147_MHBs_P-RF-DA      PVCLGQNSQSPTSNHSPTSWAPTCPGYRWMCLRRFIIFRFILLLCLIFLL
AY167095_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY206374_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY233277_MHBs_P-RF-AC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY233293_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY233295_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY236161_MHBs_P-RF-DA      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY247030_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
AY341335_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY373430_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY800249_MHBs_P-RF-DC      TVCLGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY817509_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY817510_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY817511_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY817512_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY817513_MHBs_P-RF-DC      TVCLGQNSQFPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY817515_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY862864_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY862865_MHBs_P-RF-DC      TVCLGLNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AY862866_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ089798_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
DQ315779_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLL
DQ464164_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCVGYRWMCLRRFIIFLFILLLCLIFLL
DQ464165_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCVGYRWMCLRRFIIFLFILLLCLIFLL
DQ464166_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCVGYRWMCLRRFIIFLFILLLCLIFLL
DQ464167_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCAPTCVGYRWMCLRRFIIFLFILPVCLIFLL
DQ478886_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ478887_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ478890_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ478892_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
DQ478898_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
DQ991753_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF103283_MHBs_P-RF-AD      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EF103284_MHBs_P-RF-AD      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EF103285_MHBs_P-RF-DE      TVCLAQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EF464099_MHBs_P-RF-AG      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EF494376_MHBs_P-RF-CA      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EF494378_MHBs_P-RF-CA      PTCPGQNSQSPTSNHLLTSCPPTCPGYRWMCLRRFIIFLFVLLLCLIFLL
EU185780_MHBs_P-RF-AD      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU522070_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU589337_MHBs_P-RF-CB      PTCPGRNSQSQTSNHSPTSCPPTCPGYRLMCLRRFIIFLFILLLCLIFLL
EU594406_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU594435_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU594436_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU660227_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
EU717211_MHBs_P-RF-CB      PMCPDQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU787435_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU787444_MHBs_P-RF-CB      PTCPGPNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU833890_MHBs_P-RF-GA      PVCPGLNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU833891_MHBs_P-RF-GC      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU835240_MHBs_P-RF-GC      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU871981_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU871984_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU871988_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU871991_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU871995_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU871996_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU871997_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU871999_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU881995_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFLIFLFILLLCLIFLL
EU882006_MHBs_P-RF-CB      PTCPGQNSQSPTSSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
EU916228_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU916232_MHBs_P-RF-CB      TTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU916239_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU916240_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFPFILLLCLIFLL
EU919166_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU939547_MHBs_P-RF-CB      LKCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU939551_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU939565_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU939577_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU939581_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU939589_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU939606_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU939620_MHBs_P-RF-CB      PTCPGQNSQSPTSSHSPTSCPPICPGYRWICLRRFIIFLFILLLCLIFLL
EU939621_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFIVLLCLIFLL
EU939623_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
EU939627_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
EU939629_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU939630_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
EU939631_MHBs_P-RF-BC      PVCHGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
EU939668_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ023659_MHBs_P-RF-BC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ023662_MHBs_P-RF-GC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ023666_MHBs_P-RF-GC      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ023667_MHBs_P-RF-GC      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ023670_MHBs_P-RF-GC      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ032337_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWVCLRRFIIFLFILLLCLTFLL
FJ349207_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLL
FJ349212_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIICLFILLLCLIFLL
FJ349221_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ349241_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ386586_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ386635_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ386649_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ386674_MHBs_P-RF-BC      PVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
FJ562223_MHBs_P-RF-CD      PKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562226_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMWLRRFIIFLFILLLCLIFLL
FJ562227_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562229_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562247_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562263_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562267_MHBs_P-RF-CB      PKCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562278_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
FJ562287_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562294_MHBs_P-RF-CB      PTCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562305_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562314_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562317_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562328_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ562336_MHBs_P-RF-CB      PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ715345_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ715346_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ715347_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ715384_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ715385_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ715387_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ715411_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ787446_MHBs_P-RF-CB      PTCPAQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ787480_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ882610_MHBs_P-RF-GC      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ882613_MHBs_P-RF-GC      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ882617_MHBs_P-RF-GC      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904394_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904396_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904398_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904400_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904403_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904404_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904405_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904406_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904407_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904408_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904409_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTWPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904414_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904416_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
FJ904425_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904430_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFXIFLFXLLLCLIFLL
FJ904436_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904437_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904440_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904441_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904442_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904444_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FJ904447_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FN594767_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FN594769_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FN594770_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FN594771_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
FR714490_MHBs_P-RF-GB      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
FR714496_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161753_MHBs_P-RF-AE      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161754_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161806_MHBs_P-RF-EA      PVCRGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161837_MHBs_P-RF-AE      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ161838_MHBs_P-RF-AE      PVCLGQNSQSPTSNHSPXSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ205377_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GQ205379_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLL
GQ331048_MHBs_P-RF-AE      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377516_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377520_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377522_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377534_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLLFLL
GQ377544_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377549_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377556_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377560_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILQLCLIFLL
GQ377564_MHBs_P-RF-CB      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377565_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377573_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377581_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377590_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377592_MHBs_P-RF-CB      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377594_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377595_MHBs_P-RF-BC      PECLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
GQ377596_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377602_MHBs_P-RF-CB      PKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377604_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377613_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377614_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377626_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377627_MHBs_P-RF-CD      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377630_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
GQ377633_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377634_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GQ377635_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
GQ924618_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GU177079_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
GU357843_MHBs_P-RF-CB      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GU385774_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
GU563560_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HE981179_MHBs_P-RF-FG      PGCPGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HF571060_MHBs_P-RF-AE      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM011502_MHBs_P-RF-EB      PTCPGQNSQSPTSNHSPTSCPPIXPGYRWMCLRRFIIFLFILLLCLIFLL
HM146131_MHBs_P-RF-AD      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HM750143_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM750144_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM750145_MHBs_P-RF-DC      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HM750146_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ684848_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ684849_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
HQ700462_MHBs_P-RF-CB      PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700485_MHBs_P-RF-CB      PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700492_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLL
HQ700493_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700494_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700498_MHBs_P-RF-CB      PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700500_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
HQ700503_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700505_MHBs_P-RF-CB      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700507_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLX
HQ700508_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700509_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700515_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700518_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700519_MHBs_P-RF-CB      PACPGQNSQSPTSNHLPTSCPPICPGYRWMCLRRFIIVLFILLLCLIFLL
HQ700520_MHBs_P-RF-CB      PMCPGQNSQSLTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700521_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700523_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700526_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700527_MHBs_P-RF-CB      XVCXGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700528_MHBs_P-RF-CB      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700530_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700531_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700532_MHBs_P-RF-CB      PMCPGQSSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700533_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700534_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700535_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700536_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700537_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMXLRRFIIFLFILLLCLIFLL
HQ700538_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700539_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700540_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700542_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700547_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700554_MHBs_P-RF-CB      PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700557_MHBs_P-RF-CB      PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700560_MHBs_P-RF-CB      PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700579_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700580_MHBs_P-RF-CB      PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700582_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
J02202_MHBs_P-RF-DE        TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF436919_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLICLL
JF436922_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JF436923_MHBs_P-RF-CB      PVCLGQNSQPQISSHSPTCCPPICPGYRWMCLRRFVIFLFILLLCLIFLL
JF439994_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF439998_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF440000_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF440001_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF440004_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF440006_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF440011_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF440013_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
JF440019_MHBs_P-RF-AG      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JF440022_MHBs_P-RF-AG      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JF491448_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRHFIIFLFILLLCLIFLL
JF491451_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF491455_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF491456_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF754613_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF754616_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JF828933_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JF828934_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JF828936_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JF828938_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JN040798_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN040803_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257154_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
JN257164_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257174_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257189_MHBs_P-RF-DE      TVCLGQNSQFPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257191_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257204_MHBs_P-RF-DE      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257206_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257210_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN257216_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTXPGYRWMCXRRFIIFLFILLLCLIFLL
JN642127_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642137_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642139_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642141_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642152_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN642160_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN664915_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGCRWMCLRRFIIFLFILLLCLIFLL
JN664925_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN664929_MHBs_P-RF-DE      TVCRGQNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLL
JN664933_MHBs_P-RF-DA      TVCLGQNSQSPTSNHSPTSCPPTCPGCRWMCLRRFIIFLFILLLCLIFLL
JN664934_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN664935_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN664940_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLL
JN664943_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN664946_MHBs_P-RF-DA      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688689_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688715_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JN688717_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ027310_MHBs_P-RF-CB      PACPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIISLFILLLCLIFLL
JQ040142_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ040146_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ040148_MHBs_P-RF-CB      PTCPGXNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILXLCLIFLL
JQ040174_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ040175_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIXFLXILLLCLIFLL
JQ272886_MHBs_P-RF-GF      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ272887_MHBs_P-RF-GF      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JQ412091_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
JQ732168_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ801476_MHBs_P-RF-CG      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JQ801477_MHBs_P-RF-BC      PVCLGQNSQSPISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
JX036328_MHBs_P-RF-CD      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JX036329_MHBs_P-RF-CD      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFIPLLCLIFLL
JX036330_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX036332_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX036358_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX504540_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JX661485_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX661486_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRHFIIFLFILLLCLIFLL
JX661487_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX661498_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
JX898686_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX898690_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX898693_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
JX898695_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC172106_MHBs_P-RF-GB      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC315400_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774178_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
KC774183_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774186_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774188_MHBs_P-RF-CB      PKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLW
KC774193_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774212_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774222_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774234_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774263_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774291_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774305_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774307_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774323_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774324_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774344_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KC774414_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
KC774420_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774422_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774425_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774428_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774430_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774431_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774435_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774439_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774442_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774447_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
KC774448_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774449_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRLMYLRRFIIFLFILLLCLIFLL
KC774452_MHBs_P-RF-DC      TVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774453_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774456_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774458_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774461_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774463_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774466_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774474_MHBs_P-RF-DC      TACLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774478_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774479_MHBs_P-RF-DC      TVCLGQNSQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774481_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRSMCLRRFIIFLFILLLCLIFLL
KC774483_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774484_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774485_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774486_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774487_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774489_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774490_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774492_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774494_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774495_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC774498_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KC793112_MHBs_P-RF-BC      PVCLGQNSQSQISNHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
KC875339_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF053160_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSLTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF053166_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
KF053179_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF053186_MHBs_P-RF-BC      TVCLGQNSQFQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
KF053188_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF170740_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF192833_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
KF192835_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
KF192840_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
KF214656_MHBs_P-RF-AC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KF219922_MHBs_P-RF-GH      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF471643_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873511_MHBs_P-RF-CB      PACLGQNLQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873513_MHBs_P-RF-CB      PACLGQNXQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873515_MHBs_P-RF-CB      PACLGQNSQSQTSNHSXTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873517_MHBs_P-RF-BC      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873518_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873519_MHBs_P-RF-CB      PACLGQNSQSQTSNHSXTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873521_MHBs_P-RF-BC      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873522_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLL
KF873523_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLL
KF873524_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873527_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873530_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873531_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873532_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873534_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873535_MHBs_P-RF-CB      PACLGQNSQSQTSNHSXTSCPPTXPGYRWMCLRRFIIFLFILLLCLIFLL
KF873537_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF873540_MHBs_P-RF-CB      PACLGQNSQSQTSNHSXTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KF917451_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRSIIFLFILLLCLIFLL
KJ173279_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ173280_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ173320_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ173325_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ173326_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ173329_MHBs_P-RF-CB      PMCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ173330_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ173349_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ173350_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ173358_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ410497_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
KJ410520_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ470884_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ470887_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ470891_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ470897_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ470898_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ586803_MHBs_P-RF-AF      PGCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ586810_MHBs_P-RF-AF      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ586811_MHBs_P-RF-DF      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ598675_MHBs_P-RF-CB      PTCPGQNLQSPTSNHLPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ647349_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ647351_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ647356_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ717800_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPTCHGYRWMCLRRFIIFLFILLLCLIFLL
KJ717814_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ717815_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ717832_MHBs_P-RF-CB      PKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ803771_MHBs_P-RF-DB      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KJ803785_MHBs_P-RF-CB      PKCPGQNSQSPTSNHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ803798_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ803804_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KJ803822_MHBs_P-RF-CB      PTCRGQNSQSPTSNHSPTCCPPTCPGYHWRCLRGFIIFLLIPVTCLIFLL
KM359442_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM386676_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM524357_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM524359_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM577663_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM577664_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM577665_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM577666_MHBs_P-RF-DE      TVCLGQNSQSPTSKHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM577667_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM606741_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM606750_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM606751_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KM875422_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KP148337_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
KP148352_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KP148441_MHBs_P-RF-GC      PVCLGQNSQSPTSNHSPISCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KP148442_MHBs_P-RF-BC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KP148449_MHBs_P-RF-GC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KP148450_MHBs_P-RF-GC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KP148586_MHBs_P-RF-GC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KP168421_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP274926_MHBs_P-RF-GA      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP288875_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KP995112_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KR013806_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KR013816_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KR013843_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KT003704_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KT366492_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT366503_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT991417_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
KT991419_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT991420_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
KT991423_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
KT991424_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KT991427_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU668440_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPACPGYRWMCLRRFIIFLFILLLCLIFLL
KU679939_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU679940_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU679942_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU679943_MHBs_P-RF-BC      PACLGQNSQSQTSNHSPTSCPPTCXGYRWMCLRRFIIFLFILLLCLIFLL
KU679944_MHBs_P-RF-BC      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU679945_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU679946_MHBs_P-RF-BC      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU679948_MHBs_P-RF-CB      PACLGQNSQSQTSNHXPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU679950_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU679953_MHBs_P-RF-BC      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU679954_MHBs_P-RF-CB      PACXGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU679956_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRXFIIFLFILLLCLIFLL
KU679958_MHBs_P-RF-CB      PACLGQNSQSQTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU695741_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU695742_MHBs_P-RF-CB      PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU695744_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU695745_MHBs_P-RF-CB      PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU695746_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU711666_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU736914_MHBs_P-RF-DE      TVCLGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU736916_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU736917_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KU963859_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU963862_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU963868_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU963869_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU963883_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU963993_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU964005_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU964306_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCHPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU964316_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KU964351_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KX096713_MHBs_P-RF-CA      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KX357623_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX357624_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX357625_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX357626_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX357627_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX357628_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KX357629_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX357631_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX357634_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX357636_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX357641_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX660677_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX660684_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRRMCLRRFIIFLFILLLCLIFLL
KX660685_MHBs_P-RF-DC      TLCLGQNSQSPTSNHSPTSCPPTCPGYRRMCVRRFIIFLFILLLCLIFLL
KX660686_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX660689_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX765835_MHBs_P-RF-GC      PVCPGLNSQSPTSNHSPISCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX774505_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
KX827299_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KX827302_MHBs_P-RF-DE      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY363263_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KY470843_MHBs_P-RF-DC      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY470844_MHBs_P-RF-DC      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY470854_MHBs_P-RF-DC      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY470856_MHBs_P-RF-DC      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY470893_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KY470997_MHBs_P-RF-GC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KY470998_MHBs_P-RF-GC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KY470999_MHBs_P-RF-GC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KY471004_MHBs_P-RF-GC      PVCLSQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
KY629632_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
KY670781_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPXTCPGYRWMCLRRFIIFLFILLLCLIFLL
LC279263_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
LC416040_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
LC458432_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
M38454_MHBs_P-RF-CB        PTCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF488699_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF488702_MHBs_P-RF-DE      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF488705_MHBs_P-RF-AD      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF618346_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
MF925360_MHBs_P-RF-DB      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF925370_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF925371_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF925382_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF925384_MHBs_P-RF-DB      TVCLGQNSQSPTSNHSPTSCPRTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF925386_MHBs_P-RF-AC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF925389_MHBs_P-RF-DC      HVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF925396_MHBs_P-RF-DC      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF925397_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF925401_MHBs_P-RF-DB      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MF925402_MHBs_P-RF-BD      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF925404_MHBs_P-RF-AC      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MF967563_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG826141_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG826142_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MG826144_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MG826145_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MG826146_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG826147_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
MG826148_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG826149_MHBs_P-RF-CB      PTCPGQNSQSPTSNPSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MG826150_MHBs_P-RF-BC      TVCRGQNSQSQISSHSPTCCPPTCPGYRWMCLRRSIIFLCILLLCLIFLL
MG826151_MHBs_P-RF-BC      PVCLGQNSQSQISNHSPTCCPPTCPGYRWMYLRRSIIFLFILLLCLIFLL
MG877711_MHBs_P-RF-DE      TVCLGQNSQSPXSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG893554_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MG893555_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH094410_MHBs_P-RF-BC      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MH464835_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
MH464846_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH464851_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH481858_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH481859_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH481860_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH481861_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH685719_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH724222_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH724239_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH724240_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
MH724243_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MH746811_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MH746812_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MH746813_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK052957_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MK052967_MHBs_P-RF-BD      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK052968_MHBs_P-RF-BD      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK052969_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK052970_MHBs_P-RF-BD      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK052976_MHBs_P-RF-BD      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK321265_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK516279_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK534555_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534556_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534558_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534559_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLFILLLCLIFLL
MK534560_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534562_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534574_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534579_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534582_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
MK534585_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK534587_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534589_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534594_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534606_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534607_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534609_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534610_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534613_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLL
MK534615_MHBs_P-RF-BC      PMCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLTFLL
MK534616_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534620_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534623_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534630_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534632_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534633_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534635_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534637_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534641_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534646_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534653_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
MK534660_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534663_MHBs_P-RF-CB      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534664_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534665_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534668_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPTCPGYRWMYLRRFIIFLCILLLCLIFLL
MK534669_MHBs_P-RF-CB      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534670_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534679_MHBs_P-RF-CB      PKCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534681_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
MK534686_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
MK534688_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534690_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534695_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534701_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
MK534706_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534712_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLICLL
MK534714_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534715_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534716_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
MK534718_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534719_MHBs_P-RF-CB      PVCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534721_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMYLRRFIIFLCILLLCLIFLL
MK534722_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534723_MHBs_P-RF-BC      PVCLGQNSQSQTSSHSPTCCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534725_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MK534728_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534730_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPTCPGYRWMCLRRFIIFLCILLLCLIFLL
MK534731_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK534734_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MK541689_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK598652_MHBs_P-RF-DE      TVCLGQNSQSPTTNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK598653_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK598654_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK598656_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK618438_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK618439_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MK618445_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRGFIIFLFILLLCLIFLL
MN507850_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN650068_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN650069_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN650076_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN650083_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683571_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683572_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683574_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683581_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683582_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683586_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683588_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683592_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683596_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683603_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683610_MHBs_P-RF-DC      TGCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683611_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683612_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683618_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683619_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683620_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSQTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683622_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683624_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683625_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683626_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683627_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683628_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683634_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683635_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683637_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683638_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683640_MHBs_P-RF-DC      TVCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683641_MHBs_P-RF-DC      TLCLGQNSQSPTSNHSPTSCPPTCPGYRRMCVRRFIIFLFILLLCLIFLL
MN683642_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683655_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683656_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683662_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683668_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683671_MHBs_P-RF-DC      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683673_MHBs_P-RF-DC      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683675_MHBs_P-RF-DC      TACLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683676_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683677_MHBs_P-RF-DC      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683683_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683684_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN683688_MHBs_P-RF-DC      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683692_MHBs_P-RF-DC      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683694_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683700_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683712_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MN683713_MHBs_P-RF-DC      TVCLGQNSQSPISNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683716_MHBs_P-RF-DC      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683717_MHBs_P-RF-DC      TVCLGQNSQSPTSSHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683718_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683720_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683721_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPQTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683722_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683725_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MN683730_MHBs_P-RF-DC      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLSILLLCLIFLL
MT426089_MHBs_P-RF-AB      PVCLGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426110_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMYLRRFIIFLFILLLCLIFLL
MT426112_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MT426113_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MT426114_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MT426455_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426456_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426457_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426461_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426462_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGCRWMCLRRFIIFLFILLLCLIFLL
MT426466_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426469_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426471_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426473_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426478_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426479_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426480_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426481_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426483_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426485_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426486_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426488_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426489_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426492_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426499_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426500_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426503_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426504_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426508_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426509_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426512_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426514_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426517_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426518_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426519_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426523_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426526_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426530_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426531_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426533_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426537_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426538_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFLLLLCLIFLL
MT426539_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFPFILLLCLIFLL
MT426540_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426542_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426544_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILRLCLIFLL
MT426546_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426553_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426555_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426557_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPTICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426558_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426560_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426563_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426564_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT426569_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFIFILLLCLIFLL
MT591274_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MT591280_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MT645015_MHBs_P-RF-CB      PTCPGQNLQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT645029_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT645035_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT645039_MHBs_P-RF-CB      PACPGQNSQSPTSNHSLTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT645045_MHBs_P-RF-BC      PVCRGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MT645056_MHBs_P-RF-BC      PVCLGQNSQSQISSHSPTCCPPICPGYRWMCLRRFIIFLCILLLCLIFLL
MT645062_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MT645063_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MT645065_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MT645067_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MT645069_MHBs_P-RF-CB      PACPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MT645070_MHBs_P-RF-DC      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MT645071_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MW601227_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MW601230_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MW601241_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MW601264_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MW601284_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MW601296_MHBs_P-RF-DE      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MW601310_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MW601317_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MW887645_MHBs_P-RF-CD      PKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
MZ043066_MHBs_P-RF-AC      PVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MZ097652_MHBs_P-RF-DE      TECLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MZ097667_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MZ097680_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MZ097687_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MZ097703_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MZ097716_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MZ097745_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MZ097806_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
MZ097814_MHBs_P-RF-DE      TVCRGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFTLLLCLIFLL
MZ097822_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLTFLL
MZ097826_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLXFLL
MZ439768_MHBs_P-RF-GC      PVCLGQNSQSPTSNHSPTSYPPICPGYRWMCLRRFIIFLFILRLCLIFLL
MZ439798_MHBs_P-RF-GC      PVCLGQNSQSPTSNHSPTSYPPICPGYRWMCLQRFIIFLFILRLCLIFLL
OK143485_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
OK143494_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
ON854595_MHBs_P-RF-EA      PVCLGQNSQSPISNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
X65259_MHBs_P-RF-DA        TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
X68292_MHBs_P-RF-DA        TVCLGQNSQSPTSHHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
X75656_MHBs_P-RF-CB        PRCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
X80925_MHBs_P-RF-DE        TVCLGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
Y18857_MHBs_P-RF-CB        PTCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLL
HQ700524_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCLIFLL
HQ700525_MHBs_P-RF-DE      TVCLGQNSQSPTSNHSPTSCPPTCAGYRWMCLRRFIIFLFILLLCLIFLL
AB195941_MHBs_P-RF-CB      PKCPGQNSQSPTSNHSPTSCPPICPGYRWMCLRRFIIFLFILLLCLIFLW
AB195951_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLL
AB195957_MHBs_P-RF-CB      PTCPGQNSQSPTSNHSPTS</