HBVdb

Dataset for protein HBc of genotype RF

[Download (right click)] [Edit] [Sequences] [Repertoires]

1349 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


MF925382_HBc_P-RF-CB      MDIDPYKEFGATSELLSFLPSDFFPSIRDLLDTANALFREALESQEHCSP
KC774323_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534679_HBc_P-RF-CB      MDIDPYKEFGASTELLSFLPYDFFPSMRDLLDTASALYREALESVEHVTP
HQ700554_HBc_P-RF-CB      MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSP
DQ089798_HBc_P-RF-CB      MDIDPYKELGASGELLSFWPSDFFPSIRDLLDTASALYREALESPEHCTP
GQ377604_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPNDFFPSARDLLDTASALYREALESPEHCSP
MK534715_HBc_P-RF-BC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHGTP
KJ803791_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MG826150_HBc_P-RF-BC      MDIDPYKEFGASAELISFLPSDFFPTIRDLLDTASALYREALESPEHCTP
FJ032343_HBc_P-RF-CB      MDIDPYKEFGASAELISFLPSDFFPNIRDLLDTASALYREALESPEHCSP
FJ386674_HBc_P-RF-BC      MDIDPYKEFGASAELISFLPSDFFPNIXDLLDTASALYREALESPEHCSP
KU576384_HBc_P-RF-CB      MDIDVYKEFGASVELLSFLPSDFFPSIRDPLDTASALYREALESPEHCSP
FJ386635_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AF461361_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562317_HBc_P-RF-CB      MDIDPYKEFGASAQLLSFLPTDFFPSIRDLLDTAQALYREALESPEHCSA
KY363262_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KY363263_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU939630_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSP
FJ386593_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562305_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645039_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
FJ386586_HBc_P-RF-CB      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASAMFREALESPEHCSA
EU882006_HBc_P-RF-CB      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU939621_HBc_P-RF-CB      MDIDPYKEFGASGELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSA
GU385774_HBc_P-RF-CB      MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU939589_HBc_P-RF-CB      MDIDVYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU939577_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU717211_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562302_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB367393_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB198084_HBc_P-RF-CB      MDIDPYKEFGASVELLSFMPSDFFPSIRDLLDTASALYREALESPEHCSP
AB049609_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB270535_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
DQ478898_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774305_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU939547_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX660686_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683707_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ684848_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KC774447_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ803803_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MT645056_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
EU939551_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU916228_HBc_P-RF-CB      MDIDTYKEFGASVELLSFFASDLFPSVRDLLDTATALYREALESPEHCSP
GQ377556_HBc_P-RF-CB      MDIDTYKEFGGSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ803822_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU576837_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRELLDTASALYRDALESPEHCSP
KU577083_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRELLDTASALYRDALESPEHCSP
FJ562287_HBc_P-RF-CB      MGLDPYKEFGAFGELLFFLPFDFFPSIRDLLDTASALYREALESPEHCSP
Y18856_HBc_P-RF-CB        MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774486_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSGRDLLDTASALYREALESPEHCSP
AY057948_HBc_P-RF-DC      MDIDPYKEFGASVEVLSFLPSDFFPSNRDLLDTASALDREALESPEHCSP
KT991427_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562263_HBc_P-RF-DC      MDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KT991424_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534734_HBc_P-RF-BC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK534714_HBc_P-RF-BC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534700_HBc_P-RF-BC      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSP
KR013843_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ803788_HBc_P-RF-CB      MDIDPYKEFGASVEIPFFLPSDFFPSIRDLLYTTSVLYREALESPEHCSP
DQ478886_HBc_P-RF-DC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY817513_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ386633_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSP
MK534725_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534594_HBc_P-RF-BC      MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KT991419_HBc_P-RF-DC      MDIDHYEEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
KR013806_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
KM213033_HBc_P-RF-CB      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSA
KC774449_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774430_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774431_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774349_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774488_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774493_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JX504540_HBc_P-RF-CB      MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JF828933_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
JF828934_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
JF828935_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
JF828936_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
JF828938_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
FJ715345_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ715346_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ715347_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562278_HBc_P-RF-DC      MDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
KT991417_HBc_P-RF-DC      MDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
KT991420_HBc_P-RF-DC      MDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
KT991423_HBc_P-RF-DC      MDIDHYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
FJ386581_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
JQ707714_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774425_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774479_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU919166_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ386578_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ386585_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU916240_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871997_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871995_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU787435_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU660227_HBc_P-RF-BC      MDIDPYKEFGASAPLLSFLPSDFFPSIRDLLDTATALYREALESPEHCSP
AY862866_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY862864_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU939606_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY206374_HBc_P-RF-CB      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB642096_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSX
AB367400_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
HM750148_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
AB205152_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSA
EU871981_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871983_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871984_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871985_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALCREALESPEHCSP
EU871986_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871987_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871988_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871989_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871990_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871991_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871992_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871993_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871996_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU871999_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU872014_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU872015_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GU357843_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JN664935_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774178_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774364_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774428_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774442_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU589339_HBc_P-RF-CB      MDINTYKEFGASVELLSFLPSDFFPSIRDLLDTATALHREALESPEHCSP
JX026887_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALHREALESPEHCSP
KJ803772_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774481_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774414_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JX429896_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JQ040142_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JF436923_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JF436922_HBc_P-RF-CB      MDIDPYKEFGASVELISFLPLDFFPSIRDLLDTASALYREALESPEHCSP
GQ377594_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ715387_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562226_HBc_P-RF-CB      MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU939629_HBc_P-RF-BC      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX660685_HBc_P-RF-DC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683641_HBc_P-RF-DC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562271_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774454_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173320_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173322_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KT991421_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426501_HBc_P-RF-CB      MDLDPYKELGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KR013948_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALHREALESPDHCSP
KM875422_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ803753_HBc_P-RF-CB      MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ410497_HBc_P-RF-BC      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173280_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALKSPEHCSP
KF917451_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774453_HBc_P-RF-DC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683668_HBc_P-RF-DC      MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683603_HBc_P-RF-DC      MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534716_HBc_P-RF-BC      MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MF925389_HBc_P-RF-DC      MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX660677_HBc_P-RF-DC      MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650084_HBc_P-RF-DC      MDIDPYKEFGASEELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534729_HBc_P-RF-BC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JQ040148_HBc_P-RF-CB      MDIDPYKEFGASXELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534660_HBc_P-RF-BC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377590_HBc_P-RF-CB      MDIDPYKEFGASMELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB031265_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB033557_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB195939_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB195940_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB195941_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB195950_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB195951_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB195955_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB195956_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB195957_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB241109_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB674504_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AF330110_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AP011104_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AP011105_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AP011108_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY040627_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY123424_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY167095_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY247030_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY800249_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY817510_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY817511_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY817512_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY817515_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AY862865_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
DQ144601_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
DQ478887_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
DQ478889_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
DQ478890_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
DQ478892_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
DQ478897_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU787434_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU835240_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU916232_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU916239_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU916241_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KF873531_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JQ040130_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774291_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KF873532_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KF873527_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KF873524_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KF873523_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KF873522_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774499_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774498_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774497_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774495_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774494_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774492_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774490_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774489_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774487_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774484_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774483_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774482_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774480_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774478_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774476_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774475_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774474_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774472_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774471_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774470_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774468_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774466_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774463_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774461_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774458_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774457_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774456_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774455_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774452_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774448_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774443_HBc_P-RF-DC      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774439_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774435_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774434_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774433_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774432_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774426_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774424_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774423_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774422_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774420_HBc_P-RF-DC      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774344_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774341_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774332_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774328_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774324_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774322_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774317_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774307_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774294_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774258_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774246_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774234_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774230_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774222_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774212_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774201_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774198_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774193_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774186_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774183_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JX661498_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JX661494_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JX661487_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JX661485_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JX429898_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JQ801477_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JQ801476_HBc_P-RF-CG      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JQ732168_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JQ040175_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JQ040174_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JN400086_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIQDLLDTASALYREALESPEHCSP
JN104442_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JN104438_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JF491456_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JF491455_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JF491451_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JF491449_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JF491448_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700547_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700526_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSP
HQ700521_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700508_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700507_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700505_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HM750150_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HM750149_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HM750147_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HM750146_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HM750145_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HM750144_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HM750143_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HM750133_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ924618_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377635_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377634_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377633_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377630_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377626_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377614_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377613_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377611_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377607_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377602_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377596_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377595_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377581_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377573_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377565_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377564_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377560_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377549_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377548_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377544_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377539_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377534_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377522_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377520_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ377516_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ787480_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ787446_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ715414_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ715413_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ715412_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ715411_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ715385_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ715384_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562314_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562294_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562247_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562229_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSP
FJ386649_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ349241_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSP
FJ032337_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534675_HBc_P-RF-BC      MDIDVYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534585_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
LC416040_HBc_P-RF-CB      MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU679942_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU679941_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU519423_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU519422_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KT003704_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KR013816_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KP276256_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KP276255_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KP276254_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KP276253_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KP148352_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KP148337_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ803804_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSH
KJ803802_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ410520_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173358_HBc_P-RF-CB      MDIDPYKEFGAFVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173350_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173349_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173330_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173329_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173326_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173325_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173300_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173299_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ173279_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KF873543_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
KF873542_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
KF873538_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
KF873534_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU939627_HBc_P-RF-BC      MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSP
KF873533_HBc_P-RF-CB      MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALEXPEHCSP
KF873540_HBc_P-RF-CB      MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
KJ803827_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSP
GQ377592_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
EU939623_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSP
EU939620_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPTDFYPSVRDLLDTAAALYREALESPEHCTP
EF494378_HBc_P-RF-CA      MDIDPYKEFGASVQLLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK534665_HBc_P-RF-CB      MDIDPYKEFGASVELISFLPADFFPSIRDLLDTATALYREALESPEHCTP
HQ700580_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHVSP
EU833891_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFSPSVRDLLDTASALYREALESPEHCSP
FJ882617_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ882613_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ882612_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ882618_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK534555_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ475335_HBc_P-RF-CB      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTASAMYREALESPEHCTP
MT645070_HBc_P-RF-DC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534590_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATAMYREALESPVHGSP
MN683730_HBc_P-RF-DC      MDIDPYKEFGASAELLSFLPNDFFPNMRDLLDTASALYREALESPEHCSP
MN683669_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPTDFFPTVRDLIDTASALYREALESPEHCTP
MK534719_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700520_HBc_P-RF-CB      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSH
FR714496_HBc_P-RF-CB      MDIDPYKEFGASVELLSILPSDFFPSTRDLLDTASALYREALESPEHCSP
FJ023665_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB367419_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCTP
MK534668_HBc_P-RF-BC      MDIDHYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHISS
MK052970_HBc_P-RF-BD      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ803782_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ598675_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562328_HBc_P-RF-CB      MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTVSALHREALESPEHCTP
MN683618_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTAAALFREALESPEHCSP
MG826141_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESSEHCSP
KY363272_HBc_P-RF-CB      MDIDPYKEFGASAELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSP
KY363273_HBc_P-RF-CB      MDIDPYKEFGASAELLSFLPTDFFPSIRDLLDTASALYREALESPEHRSP
MT645045_HBc_P-RF-BC      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSP
KJ410506_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSTRDLLDTASALYREALESPEHCSP
EU939668_HBc_P-RF-CB      MDIDLYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645063_HBc_P-RF-DC      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963930_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963931_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963932_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963933_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963934_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963935_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963936_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963938_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963939_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963940_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963941_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963942_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963943_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963944_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ684849_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSP
EU919167_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KF873537_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYRDALESPEHCTP
MK534613_HBc_P-RF-CB      MDIDHYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSP
KY470849_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KY470847_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KY470846_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KY470844_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KY470843_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KF873519_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSP
KF873511_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KU679945_HBc_P-RF-CB      MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTALALYRDALESPEXCSA
KU679940_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
MN650069_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTATALYREALESPEHCSP
KY629632_HBc_P-RF-DC      MDIDLYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX660682_HBc_P-RF-DC      MDIDTYKEFGASVELLSFLPSDFFPSIRDLXDTASALYREALEXPEHCSP
KU679939_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KF873521_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KF873518_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KF873517_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KF873515_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
MT645069_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KY670781_HBc_P-RF-DC      MDIDXYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
KU679953_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KU679946_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KU679944_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KU679948_HBc_P-RF-CB      MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KF873513_HBc_P-RF-CB      MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KU679943_HBc_P-RF-BC      MDIDXYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYREALESPEHCSP
KY470850_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KY470853_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KY470854_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KY470855_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KY470856_HBc_P-RF-DC      MDIDPYKEFGASLELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
MN683627_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
KU695745_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ361772_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
AB300369_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MZ439673_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPNIRDLLDTASALYREALESPEHCSP
MN683712_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF873530_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESAEHCSP
FJ562267_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU939565_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB014375_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK534583_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREPLESPEHCSP
FJ562336_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLVDTATALYREALESPEHCSP
MK534635_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645062_HBc_P-RF-DC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534728_HBc_P-RF-BC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSA
JX661486_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ386643_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU589337_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774263_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700542_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700532_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
HQ700531_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
HQ700530_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
HQ700528_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700523_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
HQ700527_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB105172_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB493837_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB493838_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB493840_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB493842_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB493847_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AP011102_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AP011103_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ358155_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ358156_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700498_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700499_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700518_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700519_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EU881995_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KJ803785_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALCRDALESPEHVSA
MT645029_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEQCSP
MN683717_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPPDFFPSIRDLLDTASALYREALESPEHCSP
MF925401_HBc_P-RF-DB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX765835_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSP
KU679958_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSXFFPSIRDLLDTASALYREALESPEHCTX
KC774485_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
KC315400_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JF436919_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
HQ700462_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ562227_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AF411409_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645071_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645060_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645048_HBc_P-RF-CB      MDIDPYKEFGTSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534721_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534713_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534686_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHVSA
MK534615_HBc_P-RF-BC      MDIDPYKEFGASAELISFLPADFFPSVRDLLDTASALYREALESPEHCSP
MK534582_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG893561_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
M38454_HBc_P-RF-CB        MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU679955_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTAAALYREALESPEHCSA
EU522070_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645067_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MF925381_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC774188_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ040146_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HM750142_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSP
EU939581_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALHREALESPEHCSP
AB367800_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSA
MN657317_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700560_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700557_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700515_HBc_P-RF-CB      MDIYPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
HQ700485_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYREALESPEHCSP
HQ700509_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426563_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426561_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALNREALESTEHCSP
MT426553_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
MT426550_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426547_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426546_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426533_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEQCSP
MT426499_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426491_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426472_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683721_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683716_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPQHCSP
MN683711_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683706_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683703_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSP
MN683678_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683677_HBc_P-RF-DC      MDIDPYKEFVASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683673_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683657_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPTDFFPSIRDLLDTASALYREALESPEHCSP
MN683651_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSP
MN683638_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSP
MN683637_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSP
MN683636_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSP
MN683634_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683617_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLIDTASALYREALESPEHCSP
MN683611_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683581_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683580_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650077_HBc_P-RF-DC      MDIDPYKECGASVELLSFLPSDFFPSIRDILDTASALYREALESPEHCSP
MK534712_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534706_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK534701_HBc_P-RF-BC      MDIDPYKEFGASTELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534688_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534681_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534653_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534646_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534630_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534616_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534609_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534584_HBc_P-RF-BC      MDIDPHKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534561_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK052968_HBc_P-RF-BD      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG826142_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KY881840_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KY470893_HBc_P-RF-CB      MDIDPYKEFGTSVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX774505_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX660689_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX660684_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
JQ027310_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCXP
X75656_HBc_P-RF-CB        MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426531_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
MT426506_HBc_P-RF-CB      LDIEPYKEFGASVELLSFFPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683620_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534632_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964351_HBc_P-RF-CB      MDIDTYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
AB670303_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426564_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426542_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426490_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
MT426482_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
MN683660_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650068_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534730_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDSFPSIHDLLDTASALYREALESPEHCSP
MK534726_HBc_P-RF-BC      MDIDPYKEFGASVELLSFSPSDFFPSIRDLLDTASALYREALESPEHCSP
MG826151_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX096713_HBc_P-RF-CA      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALXSPEHCSA
MT645066_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645065_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645049_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645035_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT645015_HBc_P-RF-CB      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426576_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426575_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426574_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426573_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426572_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426571_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426570_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426569_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426568_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPDHCSP
MT426567_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426566_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426565_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426562_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426560_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426559_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426558_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426557_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426556_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426555_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426554_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426551_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
MT426549_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426545_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
MT426543_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426541_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426540_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426539_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426538_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426537_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426536_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426534_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426532_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426530_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426529_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426528_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426527_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
MT426526_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426525_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426524_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426523_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
MT426522_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426521_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426520_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426519_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426518_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426517_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426515_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
MT426514_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPAIRDLLDTASALYREALESPEHCSP
MT426513_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426512_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426511_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426509_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426508_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426505_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426502_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426500_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426498_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426497_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426496_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426495_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426494_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426493_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426488_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426485_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426484_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426480_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426471_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426468_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426467_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426466_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426465_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426463_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MT426456_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683725_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683724_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683723_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683722_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683720_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683719_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683718_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683715_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683714_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683713_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683700_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683699_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683697_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683696_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683695_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683694_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683693_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683692_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683691_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683690_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683689_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683688_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683687_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683686_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683685_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683684_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683683_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683680_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683679_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683676_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683675_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683674_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683672_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683671_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683670_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683666_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683665_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683664_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683663_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683662_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683661_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683659_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683658_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683656_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683655_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683654_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683653_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683652_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683650_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683649_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683647_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683645_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683644_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683643_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683642_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683640_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683639_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683635_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683632_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683630_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683628_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683626_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683625_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683624_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683623_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683622_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683621_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683619_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683616_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683615_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683614_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683613_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683612_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683610_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683609_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683607_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683605_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683597_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683596_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683594_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683592_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683590_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683588_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683587_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683586_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683584_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683582_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683579_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683574_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683572_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN683571_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN657316_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN657315_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650087_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650086_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650085_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650083_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650082_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650081_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650080_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650079_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650078_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650076_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650075_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650074_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650073_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MN650072_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK720628_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK720627_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534736_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534735_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534731_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534724_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534723_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534722_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534718_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534717_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534695_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534690_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534689_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534687_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534685_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534684_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534682_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534672_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534670_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534664_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534662_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534655_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534654_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534651_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534648_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534641_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534639_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534637_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534633_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534625_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534623_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534620_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534618_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534617_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534610_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534607_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534606_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534598_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534589_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534587_HBc_P-RF-BC      MDIDPYKEFGASVELISFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534580_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534579_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534577_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534574_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534569_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534568_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534567_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534564_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534563_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534562_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534560_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534559_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534558_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534556_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK321265_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK052967_HBc_P-RF-BD      MDIDPYKEFGASVELLSSLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH094410_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG893559_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG893555_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG893554_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG826149_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG826148_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG826147_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG826146_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG826144_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MF925370_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
LC458432_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
LC279267_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
LC279266_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
LC279265_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
LC279264_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
LC279263_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX660680_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX660675_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX660674_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KX354997_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964317_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964316_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964314_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964313_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964312_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964311_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964310_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964309_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964308_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964307_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964306_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964305_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964304_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964303_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964010_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHGSP
KU964009_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964008_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964007_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964006_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964005_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964003_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU964001_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963999_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963998_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963995_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963994_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963993_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963991_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963990_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963870_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963869_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963868_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963867_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963866_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963865_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963864_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963863_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963862_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963861_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963860_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963859_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963858_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963857_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU963856_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU695746_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU695744_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU695743_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU695742_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU695741_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
Y18857_HBc_P-RF-CB        MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
KU964315_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
KU963883_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPADFFPSIRDLLDTASALYREALESPEHCSP
KU679954_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KU679956_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPXDFFPSIRDLLDTASALYREALESPEHCSP
MF488699_HBc_P-RF-DE      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSS
FJ349221_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSISDLLATATALFRDALESPEHCSP
KY470858_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPTDFFPSIQDLIDTATALYREALESPEHCSP
KY470871_HBc_P-RF-GC      MDIDPFKEFGASVELLSFLPTDFFPSIQDLIDTATALYREALESPEHCSP
KY470865_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPNDFFPSIQDLFDTATALYREALESPGHCSP
KJ647349_HBc_P-RF-DE      MDLDPYKEFGASVELLSFLPNDFFPSARDLLDTASALYRDALESPEHCSP
KJ803771_HBc_P-RF-DB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTALALYREALDSPEHCSP
AY230115_HBc_P-RF-DA      MDIDTYKEFGATVELLSFLPGDFFPSVRDLLDTASALFREALESPEHCSP
AB674412_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESNEHCSP
AB453985_HBc_P-RF-AC      MDIDPYKEFGASVELISFLPPDFFPSIRDLLDTASALYREALESSEHCSA
MW601317_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KX357628_HBc_P-RF-DE      MDIDPYKEFGASVQLLSFLPADFFPSVRDLLDTASALYRDALESPEHCTP
JN664933_HBc_P-RF-DA      MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYREALESPEHCTP
KJ647351_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPTDFYPSVRDLLDTASALYRDALESPEHCSP
KJ470897_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCSP
MW601310_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPVDFFPTVRDLLDTAAALFRDALESPEHCTP
KU679950_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESSEHCSP
JN664946_HBc_P-RF-DA      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSP
JF440019_HBc_P-RF-AG      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
AB933282_HBc_P-RF-AG      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JF440022_HBc_P-RF-AG      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
AB933283_HBc_P-RF-AG      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JF440021_HBc_P-RF-AG      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
AB933279_HBc_P-RF-AG      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
AB933280_HBc_P-RF-AG      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
AB933281_HBc_P-RF-AG      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
EF464099_HBc_P-RF-AG      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
EU833889_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
EU833890_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
FJ349212_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JF440017_HBc_P-RF-DA      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESPEHCSP
MH368022_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAXALYREALESPEHCSA
KP168421_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF679991_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTP
AB674436_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTATALYRDALESPEHCTP
HQ700494_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTP
HM146131_HBc_P-RF-AD      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ161767_HBc_P-RF-AE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AB194949_HBc_P-RF-AE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF214680_HBc_P-RF-GC      MDIDPYKEFGASLELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
FJ904437_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ023666_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTAAALYREALESPEHCSP
MK052976_HBc_P-RF-BD      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
KJ803798_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HE981180_HBc_P-RF-GF      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ882611_HBc_P-RF-GC      MDIDPYKEFGASAELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ882610_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ882614_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB222708_HBc_P-RF-AD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ331048_HBc_P-RF-AE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439776_HBc_P-RF-AG      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161147_HBc_P-RF-DA      MDIDPYKEFGATVELLSFLPSDFFPSDRDLLDTASALYREALESPEHCSP
AF297620_HBc_P-RF-DA      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF488705_HBc_P-RF-AD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
FJ023659_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
AB330368_HBc_P-RF-DA      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF297619_HBc_P-RF-DA      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233277_HBc_P-RF-AC      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925397_HBc_P-RF-DC      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
KM386676_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
FJ023664_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ023667_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ023670_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FJ023673_HBc_P-RF-GC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
FR714490_HBc_P-RF-GB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KC172106_HBc_P-RF-GB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
KP148442_HBc_P-RF-BC      MDIDPYKEFGASVALLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MG826145_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH746811_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH746812_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MH746813_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534566_HBc_P-RF-BC      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
MK534669_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
EF494376_HBc_P-RF-CA      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHRSP
MK534663_HBc_P-RF-CB      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCSP
GQ161806_HBc_P-RF-EA      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MT426089_HBc_P-RF-AB      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYREALESPEHCSP
KJ586803_HBc_P-RF-AF      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EU185780_HBc_P-RF-AD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
X68292_HBc_P-RF-DA        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KJ586811_HBc_P-RF-DF      MDIDPYKEFGATVELLSFLPSDFFPSVRDFLDTASALYRDALEFPEHCSP
KF170740_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KC012653_HBc_P-RF-AD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HE981179_HBc_P-RF-FG      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MF925386_HBc_P-RF-AC      MDIDPYKEFGATVELLSFLPSDFFPSVGDLLDTASALYREALESPEHCSP
KF214656_HBc_P-RF-AC      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925404_HBc_P-RF-AC      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707473_HBc_P-RF-GA      LDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
KJ586810_HBc_P-RF-AF      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF779353_HBc_P-RF-DA      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ707463_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
KP274926_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSEHCSP
JQ707475_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707474_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSEHCSP
JQ707472_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707471_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707470_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707469_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707468_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707467_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707466_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707465_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707464_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707462_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707461_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707460_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707459_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707458_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707457_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLEASDHCSP
JQ707456_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707450_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707448_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSEHCSP
JQ707445_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707441_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707432_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707430_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707426_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707424_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ707421_HBc_P-RF-GA      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRESLESSDHCSP
JQ272886_HBc_P-RF-GF      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAXYREXLESXXHCXP
JQ272887_HBc_P-RF-GF      LDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
JF754613_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
FJ349207_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
FJ904416_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
FJ904417_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
DQ464167_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
DQ464164_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYREALESPEHCTP
DQ464165_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRESLESPEHCTP
DQ464166_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRESLESPEHCTP
FJ904409_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTATALFRDALESPEHCSP
FJ904408_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTARALFRDALESPEHCTP
AY161140_HBc_P-RF-AD      MDIDPHKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSP
AY161141_HBc_P-RF-AD      MDIDPHKEIGATVELLSFLPSDFFPSARDLLDTASALYREGLESPEHCSP
MF925360_HBc_P-RF-DB      MDIDPYKEFGATVELLSFLPADFFPSVRALLDTASALYREALESPEHCSS
KX827302_HBc_P-RF-DE      MDIDPYKEFGATLELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCSP
KJ470898_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYRDALESPEHCSP
AB210819_HBc_P-RF-DE      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904436_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPNDFYPPVRDLLDTAXALFRDALESSEHCSP
HQ700579_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPGDFFPSIRDLLDTAAALYRDALESPEHCSH
HQ700585_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPGDFFPSIRDLLDTAAALYRDALESPEHCSH
MF925384_HBc_P-RF-DB      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSS
KU668440_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN642137_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHVSP
HQ700493_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700534_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
FJ562223_HBc_P-RF-CD      MDIDPYKEFGATVELLSFLPSNFFPSVRDLLDTASALYREALESPEHCSP
AB674432_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCTP
MH481862_HBc_P-RF-DE      MDSDPYKEFGATMELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KJ470891_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSH
FJ904447_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
AB033558_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MH481860_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700492_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPHDFYPSVRDLLDTAAALYRDALESPEHCSP
KX357632_HBc_P-RF-DE      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTAAALFRDALESPEHCSP
HQ700536_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
GQ205379_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KF192837_HBc_P-RF-DE      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KF192839_HBc_P-RF-DE      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KF192840_HBc_P-RF-DE      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KF192841_HBc_P-RF-DE      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MF618347_HBc_P-RF-DE      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MK541689_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MH481859_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
JN664929_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
DQ315780_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESSEHCSP
AB048702_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
AB048703_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700500_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KJ470892_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESSEHCSP
AB033559_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
DQ315779_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
GQ205377_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDFLDTAAALYRDALESPEHCSP
GQ205378_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
GQ205387_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
GU563560_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
HQ700497_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700501_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700503_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700524_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700525_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700533_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MK516280_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MK516279_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MH481861_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MH481858_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
MF618346_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KT366505_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KJ470890_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KJ470888_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KJ470887_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KJ470886_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KJ470884_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KF192838_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KF192836_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KF192833_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
KC774450_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
JN664940_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
J02202_HBc_P-RF-DE        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700584_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700583_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700582_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700581_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700541_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700540_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700539_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700535_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700537_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
HQ700538_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
FJ904400_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
MF925396_HBc_P-RF-DC      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCTP
FN594769_HBc_P-RF-DE      MDIDPYKEFGAXVXLLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
FJ904407_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ904403_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
EF103284_HBc_P-RF-AD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
KX357631_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KM606741_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCTP
GQ161788_HBc_P-RF-AE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
KX357629_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
JN257206_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257207_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ904396_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
KX357625_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
MT426112_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
FJ904414_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPTDFYPSVRDLLDTASALYRDALESPEHCTP
FJ904405_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPQDFYPSVRDLLDTASALYRDALESPEHCSP
JN040803_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSP
JN664934_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAXALYRDALESPEHCSP
JN688689_HBc_P-RF-DE      MDIDPYKELGASVELLSFLPSDFYPSVRDLLDTASALYRDALDSPEHCSP
FJ904404_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTASALYRDALESPEHCTP
FN594767_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPHDFFPSVKDLLDTASALYRDALESPEHCSP
AJ627221_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH724243_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRQALESPEHCSP
MG877711_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPXDFYPSVRDLLDTASALYRDALESPEHCSP
KM577666_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESPEHCSP
KF471643_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYRDALESPEHCSP
JN257154_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESHEHCSP
FJ904444_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MF488702_HBc_P-RF-DE      MDIDTYKEFGATVEILSFLSPDFFPSLRDLLDTASALYRDALESPEHCSP
FJ904428_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYRDALESPEHCSP
AJ627217_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KM359442_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPQDFFPSVRDLLDTASALYRDALESPEHCSP
JN642127_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSY
MW601296_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYSEALQSPEHCSP
KX357627_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESFEHCSP
KX357626_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPQDFFPAVRDLLDTASALYRDALESPEHCSP
AB674434_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSA
MW601260_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT591274_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
MT591275_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
MH724239_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPDHCTP
JF754616_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYREALESPEHCSP
FJ904442_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
FJ904398_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPNVRDLLDTASALFRDALESPEHCTP
FJ904394_HBc_P-RF-DE      MDIDPYKEFGATVQLLSFLPVDFFPSVRDLLDTASALFRDALESPEHCSP
EF103283_HBc_P-RF-AD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MW601264_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
KM577667_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPADFFPSVKDLLDTASALYRDALESPEHCSP
JN688717_HBc_P-RF-DE      MDIDPYKEFGASVELLSFFPSDFFPSVRDLLDTASALYREALKSPDHVSP
JN642139_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440012_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALEPPEHWSP
JF440013_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYREALESPEHCSP
JF440004_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440005_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439999_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FN594771_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AY341335_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
KM577665_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
FJ904430_HBc_P-RF-DE      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
DQ991753_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
AB270538_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESXEHCSP
AB188243_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRALLDTASALYRDALESPEHCSA
AB188245_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRALLDTASALYRDALESPEHCSA
KX357634_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALYRDALESPEHCSP
FJ904406_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
JN664943_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTAAALYRDALESPEHCSP
KP288875_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSH
X65259_HBc_P-RF-DA        MDIDPYKQFGATVELLPYLPSDFFLYVRDLLDTASALYREALESPEHCSP
KX357641_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP168420_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KM606751_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KJ647356_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYREALESPEHCSP
JF439995_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439996_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF439998_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440000_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440001_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440002_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440003_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440006_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440007_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440008_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440009_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440010_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440011_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440014_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JF440015_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FN594770_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
FJ904441_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCSP
FJ904440_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU594406_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EF103282_HBc_P-RF-AD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233295_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
FJ692536_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB583679_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB674433_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AJ344117_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AM494716_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AY161145_HBc_P-RF-AD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY161146_HBc_P-RF-AD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY233293_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY236161_HBc_P-RF-DA      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AY373430_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ111987_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ315777_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EF103285_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU594435_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU594436_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161753_HBc_P-RF-AE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ161754_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN507835_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KX357630_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ904397_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRHLLDTASALFRDALESPEHCSP
MT426110_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYREALESPEHCSP
MW601284_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
MW601227_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT591280_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH464835_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
MW601241_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MW601235_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MK598653_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MK598652_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KX827299_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRDALESPEHCSP
KX357636_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KX357624_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRHLLDTASALYRDALESPEHCSP
KU736916_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN642152_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPFDFFPSVRDLLDTASALFREALESPEHCSA
JN257210_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257164_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN040798_HBc_P-RF-DE      MDLDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFREALESPEHCSA
GU177079_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ904401_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH464851_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464846_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH464852_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MT210033_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
U95551_HBc_P-RF-DE        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MT426111_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK618444_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK618440_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK618438_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MH724240_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSP
MH685719_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MF967563_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925402_HBc_P-RF-BD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925371_HBc_P-RF-DC      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KU736915_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KM524336_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASAVYRDALESPEHCSP
JN257216_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCTP
JN257204_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN257191_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
HF571060_HBc_P-RF-AE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MF925388_HBc_P-RF-DC      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF192835_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257174_HBc_P-RF-DE      MDIDXYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ161837_HBc_P-RF-AE      MDIDPYKEFGATVELLSVLPFGFFPSVRDXLDTASXLYRDALESXEHCSP
X80925_HBc_P-RF-DE        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MW601230_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSH
MT426114_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT426113_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MN507850_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MK618445_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK618442_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MK618439_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MK598656_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MK598654_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH724222_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
MF925392_HBc_P-RF-DB      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
LK995391_HBc_P-RF-ED      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KX357635_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KX357633_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KX357623_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736923_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736922_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736917_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736914_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU711666_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KT366504_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366503_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KT366492_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KR905422_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KP995112_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP168418_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP168417_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP168416_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KM606750_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KM577664_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KM577663_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KM524359_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KM524357_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KM524337_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KC875339_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KC875338_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JX898699_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898698_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898696_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898695_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898693_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898690_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898688_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898687_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JX898686_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JQ687532_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN664925_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN664915_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JN642160_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN257189_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRQALESPEHCSP
GQ377627_HBc_P-RF-CD      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
GQ183486_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161838_HBc_P-RF-AE      MDIDPYKEFGATVELLSFLPSDFFPSVRDXLDTASXLYRDXLESXXHXSP
KU736921_HBc_P-RF-DE      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALXSPEHCSP
MH464850_HBc_P-RF-DA      ---DPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
JN688715_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSLRDLLDTASALFRDALEFPEHCSP
FJ904425_HBc_P-RF-DE      MDIDPYKEFGATVQLLSFLPSDFYPSVRDLLDTASALYRDALESPEHCTP
MK052957_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
MK052969_HBc_P-RF-DE      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYREALESPEHCTP
                               .::      :    .            *.     : *        

MF925382_HBc_P-RF-CB      HHTALRQLVLCWGELMNLATWVGSNLEDQPSRDLVVGYVNVNMGLKLRQL
KC774323_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVGIYVNVNMGLKITQL
MK534679_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLDDPASREAVVSYVNVNMGIKLRQL
HQ700554_HBc_P-RF-CB      HHTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNINMGIKIRQL
DQ089798_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPGSRQAVVSYVNVXMGLKIRQL
GQ377604_HBc_P-RF-CB      HHTAIRQAILCWGELMSLATWVGSNLEDPASRELVVDYVNVNMGLKFRQL
MK534715_HBc_P-RF-BC      HHTALRQAIVCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQL
KJ803791_HBc_P-RF-CB      HHTAIRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG826150_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGGNLQDQASRDLVVNYVNVNMGLKLRQL
FJ032343_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGGNLQDQASRDLVVNYVNVNMGLKLRQI
FJ386674_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGGNLQDQASRDLVVNYVNVNMGLKLRQI
KU576384_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
FJ386635_HBc_P-RF-CB      HHTALRHAVLCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQL
AF461361_HBc_P-RF-CB      HHTALRHAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQL
FJ562317_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
KY363262_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQL
KY363263_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQL
EU939630_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQL
FJ386593_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQL
FJ562305_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQL
MT645039_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDQASRDLVVGYVNVNMGLKLRQL
FJ386586_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
EU882006_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
EU939621_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
GU385774_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQL
EU939589_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
EU939577_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
EU717211_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
FJ562302_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
AB367393_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKLRQL
AB198084_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
AB049609_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQI
AB270535_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
DQ478898_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
KC774305_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
EU939547_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
KX660686_HBc_P-RF-DC      HHTALRQAILCWGELMNPATWVGSNFEDPASRELVVSYVNGNMGLKLRQI
MN683707_HBc_P-RF-DC      HHTALRQAILCWGELMNPATWVGSNFEDPASRELVVSYVNGNMGLKLRQI
HQ684848_HBc_P-RF-CB      HHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774447_HBc_P-RF-DC      HHTALRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ803803_HBc_P-RF-CB      HHTAIRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT645056_HBc_P-RF-BC      HHTAIRQAILCWVELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU939551_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDQASRELIVSYVNVNMGLKIRQL
EU916228_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377556_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ803822_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU576837_HBc_P-RF-BC      HHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU577083_HBc_P-RF-BC      HHTALRQAILCWVELMSLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ562287_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
Y18856_HBc_P-RF-CB        HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774486_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSDLEDPASRELVVSYVNVNMGLKIRQL
AY057948_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KT991427_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ562263_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KT991424_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534734_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534714_HBc_P-RF-BC      HHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534700_HBc_P-RF-BC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KR013843_HBc_P-RF-CB      HHTALRQAILCCGELMNLATWVGSNLEDPASRELVVSYVNVNMSLKIRQL
KJ803788_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
DQ478886_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY817513_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQL
FJ386633_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNTGLKIRQL
MK534725_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534594_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KT991419_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQL
KR013806_HBc_P-RF-CB      RHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KM213033_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
KC774449_HBc_P-RF-DC      HHTALRNAIVCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
KC774430_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774431_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774349_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774488_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774493_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JX504540_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
JF828933_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JF828934_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JF828935_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JF828936_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JF828938_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ715345_HBc_P-RF-CB      HHTAVRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
FJ715346_HBc_P-RF-CB      HHTAVRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
FJ715347_HBc_P-RF-CB      HHTAVRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
FJ562278_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQL
KT991417_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQL
KT991420_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQL
KT991423_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVGYVNVNMGLKIRQL
FJ386581_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
JQ707714_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQI
KC774425_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
KC774479_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
EU919166_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
FJ386578_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
FJ386585_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
EU916240_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU871997_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVASNLEGPASRELVVSYVNVNMGLKIRQL
EU871995_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQL
EU787435_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU660227_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY862866_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY862864_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU939606_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY206374_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
AB642096_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQL
AB367400_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HM750148_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB205152_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871981_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871983_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871984_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871985_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871986_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871987_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871988_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871989_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871990_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871991_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU871992_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQL
EU871993_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQL
EU871996_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQL
EU871999_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU872014_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQL
EU872015_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQL
GU357843_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGNNLEDPASRELVVSYVNVNMGLKLRQL
JN664935_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
KC774178_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQL
KC774364_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQL
KC774428_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQL
KC774442_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
EU589339_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASGELVVSYVNVNMGLKIRQL
JX026887_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ803772_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774481_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
KC774414_HBc_P-RF-BC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JX429896_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JQ040142_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQL
JF436923_HBc_P-RF-CB      HHTALRQAILCWGELVNLATWVGSNLEDPASRELVVSYVNVNMGLKTRQL
JF436922_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377594_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ715387_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ562226_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
EU939629_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGTNLEDPASRELVVSYVNVNMGLKLRQL
KX660685_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MN683641_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
FJ562271_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPGSRELVVSYVNVNMGLKIRQL
KC774454_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173320_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173322_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KT991421_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426501_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KR013948_HBc_P-RF-CB      HHTALRQAVVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KM875422_HBc_P-RF-CB      HHTALRQAILSWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ803753_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
KJ410497_HBc_P-RF-BC      QHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173280_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF917451_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774453_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MN683668_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683603_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534716_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MF925389_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KX660677_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650084_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534729_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JQ040148_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534660_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377590_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB031265_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB033557_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB195939_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB195940_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB195941_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB195950_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB195951_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB195955_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB195956_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB195957_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB241109_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB674504_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AF330110_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AP011104_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AP011105_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AP011108_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY040627_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY123424_HBc_P-RF-CB      HHTALRQAILCWGELMNPATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY167095_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY247030_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY800249_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY817510_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY817511_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY817512_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY817515_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AY862865_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
DQ144601_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
DQ478887_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
DQ478889_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
DQ478890_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
DQ478892_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
DQ478897_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU787434_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU835240_HBc_P-RF-GC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU916232_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU916239_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVDVNMGLKIRQL
EU916241_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVDVNMGLKIRQL
KF873531_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JQ040130_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNXNMGLKIRQL
KC774291_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873532_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873527_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873524_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873523_HBc_P-RF-CB      HHTALRQXILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873522_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774499_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774498_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774497_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774495_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774494_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774492_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774490_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774489_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774487_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774484_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774483_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774482_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774480_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774478_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774476_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774475_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774474_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774472_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774471_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774470_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774468_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774466_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774463_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774461_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774458_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774457_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774456_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774455_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774452_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774448_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774443_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774439_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774435_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774434_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774433_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774432_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774426_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774424_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774423_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774422_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774420_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774344_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774341_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774332_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774328_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774324_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774322_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774317_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774307_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774294_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774258_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774246_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774234_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774230_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774222_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774212_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774201_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774198_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774193_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774186_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774183_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JX661498_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JX661494_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JX661487_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JX661485_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JX429898_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JQ801477_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JQ801476_HBc_P-RF-CG      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JQ732168_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JQ040175_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JQ040174_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JN400086_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JN104442_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JN104438_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JF491456_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JF491455_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JF491451_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JF491449_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JF491448_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700547_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700526_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700521_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700508_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700507_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700505_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HM750150_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HM750149_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HM750147_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HM750146_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HM750145_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HM750144_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HM750143_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HM750133_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ924618_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377635_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377634_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377633_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377630_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377626_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377614_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377613_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377611_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377607_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377602_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377596_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377595_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377581_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377573_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377565_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377564_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377560_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377549_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377548_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377544_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377539_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377534_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377522_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377520_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ377516_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ787480_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ787446_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ715414_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ715413_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ715412_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ715411_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ715385_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ715384_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ562314_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ562294_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ562247_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ562229_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ386649_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ349241_HBc_P-RF-DC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ032337_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534675_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534585_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
LC416040_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU679942_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU679941_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU519423_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU519422_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KT003704_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KR013816_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KP276256_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KP276255_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KP276254_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KP276253_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KP148352_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KP148337_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ803804_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKIRQL
KJ803802_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ410520_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173358_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173350_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173349_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173330_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173329_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173326_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173325_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173300_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173299_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ173279_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873543_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873542_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873538_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873534_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU939627_HBc_P-RF-BC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIXQL
KF873533_HBc_P-RF-CB      HHTALRQAILXWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873540_HBc_P-RF-CB      HHTALRQAXLCWGELMNLATWVGSNLEDPASRELVXSYVNVNMGLKIRQL
KJ803827_HBc_P-RF-BC      HHTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKFRQL
GQ377592_HBc_P-RF-CB      HHTAIRQAILCWGELMNLATWVGSNLEDQASRELVVGYVNVNMGLKFRQL
EU939623_HBc_P-RF-CB      HHTAIRQAIVCWGELMNLATWVGGNLDDPASRELIVNYVNVNMGLKVRQL
EU939620_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGIKIRQL
EF494378_HBc_P-RF-CA      HHTALRQTILCWGELVNLATWVGSNLDDPASRELVVGYVNGNMGLKIRHL
MK534665_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLDDQGSRDLVVTYVNVNMGLKFRQL
HQ700580_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGGNLDDPTSREAVVSYVNINMGLKFRQL
EU833891_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLDDPGSRDLVVTYVNVNMGLKFRQL
FJ882617_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPGSRDLVVTYVNVNMGLKIRQL
FJ882613_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPSSRDLVVTYVNVNMGLKFRQL
FJ882612_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLXDPGSRDLVVTYVNVNMGLKFRQL
FJ882618_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPGSRDLVVTYVNVNMGLKFRQL
MK534555_HBc_P-RF-BC      HHTAIRQAILCWGELMNLATWVGSNLDDPTSREAIVGYVNVNMGIKIRQL
GQ475335_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGIKLRQL
MT645070_HBc_P-RF-DC      HHTALRQAIVCWGELMNLATWVGSNLEDQAARELVVSYVNGTTGLKVRQL
MK534590_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
MN683730_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGGNLEDPASRELVVGYVNVNMGLKLRQL
MN683669_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGGNLQDPASREAVVSYVNVNMGLKFRQL
MK534719_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLDDPASREAVVSYVNVNMGLKLRQI
HQ700520_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
FR714496_HBc_P-RF-CB      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVRYVNVNMGLKIRQL
FJ023665_HBc_P-RF-GC      HHTAIRQAVLCWGELMTLATWVGSNLEDPSSRELVVGYVNVNMGLKFRQL
AB367419_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
MK534668_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRDLVVNYVNVNMGLKIRQL
MK052970_HBc_P-RF-BD      HHTALRQAILCWGELMNLATWVGSNLEDPASRKLVVSYVNVNMGLKIRQL
KJ803782_HBc_P-RF-CB      HHTALRQAIVCWGEVMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ598675_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLDDPASRELVVRYVNVNMGLKIRQI
FJ562328_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
MN683618_HBc_P-RF-DC      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG826141_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDAASRELVVSYVNVNMGLKLRQL
KY363272_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGGNLDDPASREAVVSYVNVNMGLKLRQI
KY363273_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGGNLDDPASREAVVSYVNVNMGLKLRQI
MT645045_HBc_P-RF-BC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ410506_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKIRQL
EU939668_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
MT645063_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNSEDPASRELVVSYVNVNMGLKIRQL
KU963930_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963931_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963932_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963933_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963934_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963935_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963936_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963938_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963939_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963940_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963941_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963942_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963943_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963944_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ684849_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU919167_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
KF873537_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534613_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY470849_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY470847_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY470846_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY470844_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY470843_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873519_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873511_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU679945_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDQASRELVVSYVNVNMGLKIRQL
KU679940_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQX
MN650069_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY629632_HBc_P-RF-DC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
KX660682_HBc_P-RF-DC      HHTALRQAIXCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU679939_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873521_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873518_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873517_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KF873515_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT645069_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY670781_HBc_P-RF-DC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKITQL
KU679953_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU679946_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU679944_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNXNMGLKIRQL
KU679948_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
KF873513_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKIRQL
KU679943_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKIRQL
KY470850_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY470853_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY470854_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY470855_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY470856_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683627_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLQDPASRDLVVSYVNVNMGLKIRQL
KU695745_HBc_P-RF-CB      HHTAIRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKLRQI
FJ361772_HBc_P-RF-GC      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB300369_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLQDQASREAVVNHVNVNMGIKIRQL
MZ439673_HBc_P-RF-CB      HHTAIRQAILCWGELMNLATWVGSNLDDPASREAVVGYVNVNMGLKFRQL
MN683712_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQL
KF873530_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKXRQL
FJ562267_HBc_P-RF-CB      HHTAIRQVVLCWGDLMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
EU939565_HBc_P-RF-CB      HHTALRQAIXCWGEXMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB014375_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQI
MK534583_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASREAVVNYVNVNMGLKIRQL
FJ562336_HBc_P-RF-CB      HHTALRQAIVCWGELTNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534635_HBc_P-RF-BC      HHTALRQAVLCWVELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQL
MT645062_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQI
MK534728_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASREAVVRYVNVNMGLKLRQI
JX661486_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
FJ386643_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU589337_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KC774263_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700542_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700532_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700531_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700530_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700528_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700523_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELXVSYVNVNMGLKIRQL
HQ700527_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB105172_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB493837_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB493838_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB493840_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB493842_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AB493847_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AP011102_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
AP011103_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ358155_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
GQ358156_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700498_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700499_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700518_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700519_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU881995_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KJ803785_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT645029_HBc_P-RF-CB      HHTALRQAIVCWGEVMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683717_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEHPASRELVVSYVNVNMGLKIRQL
MF925401_HBc_P-RF-DB      HHTALRQAILCWAELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX765835_HBc_P-RF-GC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU679958_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
KC774485_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
KC315400_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JF436919_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HQ700462_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKLRQL
FJ562227_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
AF411409_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT645071_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT645060_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNGNMGLKIRQL
MT645048_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVRYVNVNMGLKISQL
MK534721_HBc_P-RF-BC      HHTALRQAILCWDELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534713_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534686_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQL
MK534615_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534582_HBc_P-RF-BC      HHTAIRQAILCWGELMNLATWVGSNLDDPASRELVVGYVNVNMGLKFRQL
MG893561_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASGKLVVSYVNVNMGLKIRQL
M38454_HBc_P-RF-CB        HHTALRQAILCWRELMNLATWVGSNLEDPASRELVVSYVNVNIGLKIRQL
KU679955_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDXASRELVVSYVNVNMGLKLRQL
EU522070_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
MT645067_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
MF925381_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
KC774188_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JQ040146_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
HM750142_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
EU939581_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRQL
AB367800_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQL
MN657317_HBc_P-RF-DC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
HQ700560_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQL
HQ700557_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQL
HQ700515_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQL
HQ700485_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQL
HQ700509_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQL
MT426563_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426561_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426553_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426550_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426547_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426546_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426533_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426499_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426491_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426472_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683721_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPPSRELVVSYVNVNMGLKLRQL
MN683716_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGGNLEDPQSREAVVSYVNVNMGLKLRQI
MN683711_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683706_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683703_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683678_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPPSRELVVSYVNVNMGLKLRQL
MN683677_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683673_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683657_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683651_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683638_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683637_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683636_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683634_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MN683617_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683611_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLDDPASRELVVSYVNVNMGLKIRQL
MN683581_HBc_P-RF-DC      HHTALRQDILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683580_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPPSRELVVSYVNVNMGLKLRQL
MN650077_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534712_HBc_P-RF-BC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534706_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
MK534701_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MK534688_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534681_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534653_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534646_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534630_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
MK534616_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534609_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534584_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534561_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK052968_HBc_P-RF-BD      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG826142_HBc_P-RF-CB      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVNYVNVNMGLKLRQL
KY881840_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KY470893_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KX774505_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGGNLEDQASRELVVSYVNVNMGLKLRQL
KX660689_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KX660684_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
JQ027310_HBc_P-RF-CB      HHTALRQXILCWGELMNLATWVGGNLEDPASREXVVSYVNVNMGLKXRQL
X75656_HBc_P-RF-CB        HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNINMGLKIRQL
MT426531_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQV
MT426506_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683620_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MK534632_HBc_P-RF-CB      HHTALRQAILCWVELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
KU964351_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
AB670303_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVXYXNVNMGLKXRQL
MT426564_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
MT426542_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
MT426490_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
MT426482_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
MN683660_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELIVSYVNVNMGLKIRQL
MN650068_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRTL
MK534730_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534726_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG826151_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
KX096713_HBc_P-RF-CA      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MT645066_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT645065_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT645049_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT645035_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT645015_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426576_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426575_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426574_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426573_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426572_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426571_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426570_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426569_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426568_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426567_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426566_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426565_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426562_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426560_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426559_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426558_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426557_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426556_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426555_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426554_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426551_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426549_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426545_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426543_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426541_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426540_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426539_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426538_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426537_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426536_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426534_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426532_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKMRQL
MT426530_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426529_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426528_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426527_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426526_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426525_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426524_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426523_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426522_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426521_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426520_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426519_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426518_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426517_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426515_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426514_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426513_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426512_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426511_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426509_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426508_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426505_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426502_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426500_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426498_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426497_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426496_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426495_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426494_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426493_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426488_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426485_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426484_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426480_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426471_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426468_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426467_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426466_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426465_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426463_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MT426456_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683725_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPPSRELVVGYVNVNMGLKLRQL
MN683724_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683723_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683722_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MN683720_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MN683719_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683718_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683715_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683714_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683713_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683700_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683699_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683697_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683696_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683695_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683694_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683693_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683692_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683691_HBc_P-RF-DC      HHTALKQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683690_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683689_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683688_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683687_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683686_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683685_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683684_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683683_HBc_P-RF-DC      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683680_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
MN683679_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683676_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683675_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGGNLEDPASRELVVSYVNVNMGLKIRQL
MN683674_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683672_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683671_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683670_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVFSYVNVNMGLEIRQL
MN683666_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683665_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683664_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683663_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683662_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683661_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683659_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683658_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683656_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683655_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MN683654_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683653_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683652_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683650_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683649_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683647_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683645_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683644_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683643_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683642_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683640_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683639_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683635_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683632_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683630_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683628_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683626_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683625_HBc_P-RF-DC      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683624_HBc_P-RF-DC      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683623_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683622_HBc_P-RF-DC      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683621_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683619_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683616_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683615_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683614_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683613_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683612_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683610_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683609_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683607_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683605_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683597_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683596_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683594_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683592_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683590_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683588_HBc_P-RF-DC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRESVVSYVNVNMGLKIRQL
MN683587_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683586_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683584_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683582_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683579_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683574_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683572_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN683571_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN657316_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN657315_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650087_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650086_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650085_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650083_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MN650082_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650081_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650080_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650079_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650078_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650076_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MN650075_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650074_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650073_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MN650072_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK720628_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK720627_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534736_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534735_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534731_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534724_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534723_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534722_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534718_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534717_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534695_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534690_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534689_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534687_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534685_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534684_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534682_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534672_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534670_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534664_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534662_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534655_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534654_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534651_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534648_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534641_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534639_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534637_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534633_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534625_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534623_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534620_HBc_P-RF-BC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534618_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534617_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534610_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534607_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534606_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534598_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534589_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534587_HBc_P-RF-BC      HHTALRQAIVCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534580_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534579_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534577_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKLRQI
MK534574_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534569_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534568_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534567_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534564_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534563_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534562_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534560_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534559_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534558_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK534556_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK321265_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MK052967_HBc_P-RF-BD      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MH094410_HBc_P-RF-BC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG893559_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG893555_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG893554_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG826149_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASREAVVSYVNVNMGLKLRQI
MG826148_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG826147_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG826146_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MG826144_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
MF925370_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVGYVNVNMGLKLRQL
LC458432_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
LC279267_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
LC279266_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
LC279265_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
LC279264_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
LC279263_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KX660680_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KX660675_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KX660674_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KX354997_HBc_P-RF-DC      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964317_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964316_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964314_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964313_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964312_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964311_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964310_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964309_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964308_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964307_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964306_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964305_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964304_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964303_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964010_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964009_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964008_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964007_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964006_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964005_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964003_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964001_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963999_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963998_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963995_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963994_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963993_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963991_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963990_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963870_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963869_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963868_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963867_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963866_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963865_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963864_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963863_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963862_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963861_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963860_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963859_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963858_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963857_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963856_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU695746_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU695744_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU695743_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU695742_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU695741_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
Y18857_HBc_P-RF-CB        HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU964315_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKIRQL
KU963883_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVSYVNVNMGLKFRQL
KU679954_HBc_P-RF-CB      HHTALRQAILCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKXRQL
KU679956_HBc_P-RF-CB      HHTALRQAXLCWGELMNLATWVGSNLEDPASRELVVXYVNVNMGLKXRQL
MF488699_HBc_P-RF-DE      HHTALRQSVLCWRELMTLATWVGTNLEDPASRDLVVSYVDTNMGLKFRQL
FJ349221_HBc_P-RF-DE      HHTAIRQAILCWGELMSLATWVGVNLDDPASREQVVGYVNSHMGLKFRQL
KY470858_HBc_P-RF-GC      HHTALRQAILCCGELNTLATWVGSNLDDPASKDLVVSYVNVNMGLKIRQL
KY470871_HBc_P-RF-GC      HHTALRQAILCCGELNTLATWVGSNLDDPASKDLVVSYVNVNMGLKIRQL
KY470865_HBc_P-RF-GC      HHTALRQAILCCGGLSTLATWVGSNLDDPASKDLVVNYVNVNMGLKIRQL
KJ647349_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEEQASRDLVVSYVNTHMGLKFRQL
KJ803771_HBc_P-RF-DB      HHTAIRQAIVCWGEVMNLATWVGSNLEDPGSRELVVNYVNVNMGLKMRQL
AY230115_HBc_P-RF-DA      HHTALRQAIVCWGELMNLATWVGNNLQDPASRDLVVNYVNTNMGIKIRQL
AB674412_HBc_P-RF-DE      HHTALRQAILCWGDLINLSTWVGGNLQDPTSRDAVVSYVNTNMGLKFRQL
AB453985_HBc_P-RF-AC      HHTALRQAILCWGELMTLANWVGNNLQDPASRDLVVNYVNTNMGLKLRQI
MW601317_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVGYVNSNMGLKFRQL
KX357628_HBc_P-RF-DE      HHTALRQAILCWGDVLSLATWVGVNLEDPASRDLVVGYVNNNMGLKFRQL
JN664933_HBc_P-RF-DA      HHTALRQAVLCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
KJ647351_HBc_P-RF-DE      HHTALRQAVLCWGDLMNLATWVGANLEDPASRDLVVSYVNTNIALKFRQL
KJ470897_HBc_P-RF-DE      HHTALRQAFLCWGELMHLATWVGTNLEDQASRDQVVSYVNTNMGLKFRQL
MW601310_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGANLQDPASRDQVVSYVNTNMGLKFRQL
KU679950_HBc_P-RF-CB      HHTALRQAVLCWGELMNLATWVGSNLEDPSSRDLVVSYVNVNMGLKLRQL
JN664946_HBc_P-RF-DA      HHTALRQAILCWVELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JF440019_HBc_P-RF-AG      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
AB933282_HBc_P-RF-AG      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JF440022_HBc_P-RF-AG      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
AB933283_HBc_P-RF-AG      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JF440021_HBc_P-RF-AG      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
AB933279_HBc_P-RF-AG      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
AB933280_HBc_P-RF-AG      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
AB933281_HBc_P-RF-AG      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIMQL
EF464099_HBc_P-RF-AG      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
EU833889_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
EU833890_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
FJ349212_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVGYVNTNMGLKFRQL
JF440017_HBc_P-RF-DA      HHTALRQDILCWGELMTLATWVGTNLEDPASRDLVVNYVNTNMGLKIRRL
MH368022_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRELVVGYVNVNMGLKIRQL
KP168421_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGANLEDPASRELVVGYVNNTVGLKFRQL
KF679991_HBc_P-RF-DE      HHTALRQAFLCWGELMTLATWVGANLEDQGSRDLVVSYVNVNMGLKFRQL
AB674436_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVTYVNTHMGLKFRQL
HQ700494_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLZDQASRDLVVXYVNTHMGLKFRQL
HM146131_HBc_P-RF-AD      HHTALRQAILCWGELTTLGTWVGNNLQDPASRDQVVNYVNTNMGLKIRQL
GQ161767_HBc_P-RF-AE      HHTALRQAILCWGDVMNLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQL
AB194949_HBc_P-RF-AE      HHTALRQATLCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQL
KF214680_HBc_P-RF-GC      HHTALRQAVICWGELMTLATWVGSNLEDPASRDLVVSYVNGHMGLKFRQL
FJ904437_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTHMGLKFRQL
FJ023666_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
MK052976_HBc_P-RF-BD      HHTAIRQAILCWGELMTLATWVGTNLEDPASRDLIVSYVNTNMGLKFRQL
KJ803798_HBc_P-RF-CB      HHTALRQAIVCWGEVMNLATWVGSNLEDPASRELVVSYVNGNMGLKIRQL
HE981180_HBc_P-RF-GF      SHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
FJ882611_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
FJ882610_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
FJ882614_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
AB222708_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQL
GQ331048_HBc_P-RF-AE      HHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQL
JF439776_HBc_P-RF-AG      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
AY161147_HBc_P-RF-DA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
AF297620_HBc_P-RF-DA      HHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQL
MF488705_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQL
FJ023659_HBc_P-RF-BC      HHTALRQAFLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
AB330368_HBc_P-RF-DA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
AF297619_HBc_P-RF-DA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
AY233277_HBc_P-RF-AC      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
MF925397_HBc_P-RF-DC      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KM386676_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVTYVNTNMGLKFRQL
FJ023664_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
FJ023667_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
FJ023670_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
FJ023673_HBc_P-RF-GC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
FR714490_HBc_P-RF-GB      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
KC172106_HBc_P-RF-GB      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
KP148442_HBc_P-RF-BC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
MG826145_HBc_P-RF-BC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
MH746811_HBc_P-RF-BC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
MH746812_HBc_P-RF-BC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
MH746813_HBc_P-RF-BC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
MK534566_HBc_P-RF-BC      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
MK534669_HBc_P-RF-CB      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
EF494376_HBc_P-RF-CA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
MK534663_HBc_P-RF-CB      HHTALRQAVLCWGELMTLATWVGSNLEDPASRDLVVSYVNVNMGLKIRQL
GQ161806_HBc_P-RF-EA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
MT426089_HBc_P-RF-AB      HHTAIRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
KJ586803_HBc_P-RF-AF      NHTAFRQAILCWGELMTLASWGGNNLEDPAARDLVVNYVNTNMGLKIRQL
EU185780_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVGYVNTNMGLKFRQL
X68292_HBc_P-RF-DA        HHTALRQAILCWGELMTLASWVGDNLEDPASRDLVVSYVNTNMGLKIRQL
KJ586811_HBc_P-RF-DF      PHTALRQAIFCWGELMTLATWGGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF170740_HBc_P-RF-DE      HHTALRQAVLCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC012653_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVGYVNTNMGLKFRQL
HE981179_HBc_P-RF-FG      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
MF925386_HBc_P-RF-AC      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
KF214656_HBc_P-RF-AC      HHTALRQAILCWGELMTLATWVGNNLQDPASRDLVVNYVNTNMGLKIRQL
MF925404_HBc_P-RF-AC      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707473_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
KJ586810_HBc_P-RF-AF      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
KF779353_HBc_P-RF-DA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707463_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
KP274926_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707475_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707474_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707472_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707471_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707470_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707469_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707468_HBc_P-RF-GA      HHTALMQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707467_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707466_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707465_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707464_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707462_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707461_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707460_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707459_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707458_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707457_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707456_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707450_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707448_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707445_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707441_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707432_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707430_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707426_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707424_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ707421_HBc_P-RF-GA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ272886_HBc_P-RF-GF      XHTALRQAXLCWGELMTLAXWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JQ272887_HBc_P-RF-GF      NHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVNTNMGLKIRQL
JF754613_HBc_P-RF-DE      HHTALRQAILCWGELMDLATWVGGNLEDPTSRDLVVSYVNTSMGLKFRQL
FJ349207_HBc_P-RF-DE      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ904416_HBc_P-RF-DE      HHTALRQAILCWGELMSLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
FJ904417_HBc_P-RF-DE      HHTALRQAILCWGELMSLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
DQ464167_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDQASRDLIVSYVNTNMGLKFRQL
DQ464164_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDQASRDLIVSYVNTNMGLKFRQL
DQ464165_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDQASRDLIVSFVTAHMGLKFRQL
DQ464166_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDQASRDLIVSFVTAHMGLKFRQL
FJ904409_HBc_P-RF-DE      HHTALRQAILCWGDVMNIATWVGVNLQDQASRDQVVNYVNSNMGLKFRQL
FJ904408_HBc_P-RF-DE      HHTALRQAIICWGELMALATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY161140_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY161141_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MF925360_HBc_P-RF-DB      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX827302_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
KJ470898_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGIKFRQL
AB210819_HBc_P-RF-DE      HHTAIRQAILCWGELMTLATWVGVNLEDQTSRDLVVSYVNTNMGLKFRQL
FJ904436_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGVNLQDQASRDLVVNYVNXNAGLKFRQL
HQ700579_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLQDPASRDLVVNYVNTNAGLKFRQL
HQ700585_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLQDPASRDLVVNYVNTNAGLKFRQL
MF925384_HBc_P-RF-DB      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
KU668440_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLDDPASRDLVVSYVNTNMGLKFRQL
JN642137_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
HQ700493_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLDDPASRDLVVSYVNTHMGLKFRQL
HQ700534_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDQASRDLVVSYVNTNMGLKFRQL
FJ562223_HBc_P-RF-CD      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTHMGLKFRQL
AB674432_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
MH481862_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KJ470891_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLDDPASRDLVVSYVNTNMGLKFRQL
FJ904447_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB033558_HBc_P-RF-DE      HHTALRQAILCWGDLITLSTWVGTNLEDPASRDLVVSYVNSNMGLKFRQL
MH481860_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700492_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVNYVNTNAGLKFRQL
KX357632_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTHMGLKFRQL
HQ700536_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
GQ205379_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KF192837_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KF192839_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KF192840_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
KF192841_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
MF618347_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
MK541689_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
MH481859_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
JN664929_HBc_P-RF-DE      HHTALRQAILCWGDLITLSTWVGANLEDPASRDLVVSYVNTNMGLKFRQL
DQ315780_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
AB048702_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
AB048703_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
HQ700500_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KJ470892_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTTAGLKFRQL
AB033559_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
DQ315779_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
GQ205377_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
GQ205378_HBc_P-RF-DE      HHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
GQ205387_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
GU563560_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700497_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700501_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700503_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700524_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700525_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700533_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
MK516280_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
MK516279_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
MH481861_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
MH481858_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
MF618346_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KT366505_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KJ470890_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KJ470888_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KJ470887_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KJ470886_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KJ470884_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KF192838_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KF192836_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KF192833_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
KC774450_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
JN664940_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
J02202_HBc_P-RF-DE        HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
HQ700584_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700583_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700582_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700581_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700541_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700540_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
HQ700539_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTNVGLKFRQL
HQ700535_HBc_P-RF-DE      HHTALRQAILCWGXLMTLATWVGTNLEDPASRDLVVSYVNTNXGLKFRQL
HQ700537_HBc_P-RF-DE      HHTALRQAILCWGXLMTLATWVGTNLEDPASRDLVVSYVNTNXGLKFRQL
HQ700538_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNTXVGLKFRQL
FJ904400_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDQASRELVVSYVNTNMGLKFRQL
MF925396_HBc_P-RF-DC      HHTALRQAILCWGELMTLATWVGVNLEDPASRDQVVSYVNTNMGLKFRQL
FN594769_HBc_P-RF-DE      HHTALRQAILCWGDLMALATWVGVNLEDPASRDLVVSYVNSHMGLKFRQL
FJ904407_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDQASRDSVVSYVNTNMGLKFRQI
FJ904403_HBc_P-RF-DE      HHTALRQAILCWAELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EF103284_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KX357631_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM606741_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDQASRDLVVSYVNTNMGLKFRQL
GQ161788_HBc_P-RF-AE      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
KX357629_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN257206_HBc_P-RF-DE      HHTALRQAILCWGDLMXLATWVGGNLEDPXSRDLVVSYVNTNMGLKFRQL
JN257207_HBc_P-RF-DE      HHTALRQAILCWGDLMXLATWVGGNLEDPXSRDLVVSYVNTNMGLKFRQL
FJ904396_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
KX357625_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT426112_HBc_P-RF-DE      HHTALRQAILCWGELMQLATWVGANLQDPTSRDLVVSYVNTNMGLKFRQL
FJ904414_HBc_P-RF-DE      HHTALRQAIICWGELMTLATWVGVNLQDPASRDQVVSYVNTNMGLKFRQL
FJ904405_HBc_P-RF-DE      HHTALRQAILCWGDLMNLATWVGANLDDPGSRDQVVSYVNNNIALKFRQL
JN040803_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTTAGLKFRQL
JN664934_HBc_P-RF-DE      HHTALRQATLCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
JN688689_HBc_P-RF-DE      HHTALRQAIFCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ904404_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDQVVSYVNTNMGLKFRQL
FN594767_HBc_P-RF-DE      HHTALRQAIVCWGNIMTLATWVGVNLEDQASRDLLVSYVNTXMGLKFRQL
AJ627221_HBc_P-RF-DE      HHTALRQAILCWGELMXLATWVGVNLEDQASRDQVVSYVNTNMGLKFRQL
MH724243_HBc_P-RF-DE      HHTAIRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MG877711_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGGNLEDXXSRDLVVGYVNTNVGLKFRQL
KM577666_HBc_P-RF-DE      HHTALRQATLCWVELMNLATWVGANLEDQASRDLVVSYVNTNMGLKFRQL
KF471643_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDQTSRDLVVSYVNTHMGLKFRQL
JN257154_HBc_P-RF-DE      HHTALRQAFLCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKFRQL
FJ904444_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDPASRDSVVSYVNTNMGLKFRQL
MF488702_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ904428_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGANLEDPPSRDLVVSYVNTNVGLKFRQL
AJ627217_HBc_P-RF-DE      HHTAIRQAILCWGELMTLATWVGVNLEDPASRDQIVSYVNTNMGLKFRQL
KM359442_HBc_P-RF-DE      HHTALRQAILCWGDLINLSTWVGANLEDQASRDLVVSYVNTNMGLKFRQL
JN642127_HBc_P-RF-DE      HHTALRQAILCWGELMSLATWVGSNLDDPTSRDLVVSYVNTNMGLKFRQI
MW601296_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLQDQTSRDLVVSYVNTNMGLKFRQL
KX357627_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
KX357626_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLDDPASRDLVVSYVNTHMGLKFRQL
AB674434_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTHMGLKLRQL
MW601260_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
MT591274_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDQSSRDLVVSYVNTNMGLKFRQL
MT591275_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDQSSRDLVVSYVNTNMGLKFRQL
MH724239_HBc_P-RF-DE      HHTALRQAIICWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
JF754616_HBc_P-RF-DE      HHTALRQGVLCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
FJ904442_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
FJ904398_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDQASRDLVVSYVNTNMGLKFRQL
FJ904394_HBc_P-RF-DE      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EF103283_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MW601264_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNVGLKFRQL
KM577667_HBc_P-RF-DE      HHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
JN688717_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDQASRDQVVSYVNTNMGLKFRQL
JN642139_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGGNLEDPVSRDLVVSYVNTNMGLKFRQL
JF440012_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440013_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440004_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440005_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF439999_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKSRQL
FN594771_HBc_P-RF-DE      HHTALRQAILCWGEFTSHSTWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY341335_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRESLVSYVNTNMGLKFRQL
KM577665_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
FJ904430_HBc_P-RF-DE      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ991753_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNNNMGLKFRQL
AB270538_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDQASRDQVVSYVNTTAGLKFRQL
AB188243_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB188245_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX357634_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ904406_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664943_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP288875_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
X65259_HBc_P-RF-DA        HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX357641_HBc_P-RF-DE      HHTAIRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTHMGLKFRQL
KP168420_HBc_P-RF-DE      HHTALRQAILCWGELMNLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
KM606751_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KJ647356_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDQVVSYVNTNMGLKFRQL
JF439995_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF439996_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF439998_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440000_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440001_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440002_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440003_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440006_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440007_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPVSRDLVVSYVNTNMGLKFRQL
JF440008_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440009_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440010_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440011_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440014_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JF440015_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FN594770_HBc_P-RF-DE      HHTAFRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ904441_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ904440_HBc_P-RF-DE      HHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594406_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EF103282_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKIRQL
AY233295_HBc_P-RF-DE      HHTALRRAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ692536_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB583679_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB674433_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AJ344117_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494716_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY161145_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY161146_HBc_P-RF-AD      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AY233293_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY236161_HBc_P-RF-DA      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY373430_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ111987_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ315777_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EF103285_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594435_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU594436_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161753_HBc_P-RF-AE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161754_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN507835_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KX357630_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
FJ904397_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT426110_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MW601284_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDPSSRDLVVSYVNTHMGLKFRQL
MW601227_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVGYVNTTVGLKFRQL
MT591280_HBc_P-RF-DE      HHTALRQAILCWGDLMNLGTWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH464835_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDPASRDLGVSYVNTNMGLKFRQL
MW601241_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MW601235_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
MK598653_HBc_P-RF-DE      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK598652_HBc_P-RF-DE      HHTALRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX827299_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX357636_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX357624_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736916_HBc_P-RF-DE      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN642152_HBc_P-RF-DE      HHTALRQAILCWGDLITLSTWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN257210_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGGNLEDPXSRDLVVSYVNTNVGLKFRQL
JN257164_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN040798_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GU177079_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ904401_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
MH464851_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH464846_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH464852_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT210033_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
U95551_HBc_P-RF-DE        HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT426111_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK618444_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK618440_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK618438_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH724240_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
MH685719_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
MF967563_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF925402_HBc_P-RF-BD      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTHMGLKFRQL
MF925371_HBc_P-RF-DC      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNDNMGLKFRQL
KU736915_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGXNLEDPASRDLVVSYVNTNVGLKFRQL
KM524336_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN257216_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
JN257204_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
JN257191_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGGNLEDPXSRDLVVSYVNTNVGLKFRQL
HF571060_HBc_P-RF-AE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF925388_HBc_P-RF-DC      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF192835_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGTNLEDPASRDLVVSYVNANVGLKFRQL
JN257174_HBc_P-RF-DE      HHTALRQAIQCWGXLMTLATWVGGNLEDPISRDLVVSXVNXNMGLKFRQL
GQ161837_HBc_P-RF-AE      HHTALRQAILCWGELMTLATWVGINLEDPASRDLVVSYVNTNMGLKFRQL
X80925_HBc_P-RF-DE        HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MW601230_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MT426114_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT426113_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN507850_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK618445_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK618442_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK618439_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK598656_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK598654_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH724222_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF925392_HBc_P-RF-DB      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
LK995391_HBc_P-RF-ED      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX357635_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX357633_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX357623_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736923_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736922_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736917_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736914_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU711666_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366504_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366503_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT366492_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KR905422_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP995112_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KP168418_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP168417_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP168416_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM606750_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KM577664_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM577663_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524359_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524357_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KM524337_HBc_P-RF-DE      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KC875339_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KC875338_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
JX898699_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898698_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898696_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898695_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898693_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898690_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898688_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898687_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JX898686_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ687532_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JN664925_HBc_P-RF-DE      HHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
JN664915_HBc_P-RF-DE      HHTALRQAILCWGELMTFATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
JN642160_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
JN257189_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
GQ377627_HBc_P-RF-CD      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
GQ183486_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161838_HBc_P-RF-AE      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736921_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGVNLEBPASRDLVVSYVNTNMGLKFRQL
MH464850_HBc_P-RF-DA      HHTALRQAILCWGELMTLATWVGNNLEDPASRDLVVNYVNTNMGLKIRQL
JN688715_HBc_P-RF-DE      HHTAIRQAIICWGELMTLATWVGVNL-DQASRDLVVSYVNNNMGLKFRQL
FJ904425_HBc_P-RF-DE      HHTALRQAILCWGELMTLATWVGSNL-DPVSRDLVVSYVNDNMGLKFRQI
MK052957_HBc_P-RF-DE      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
MK052969_HBc_P-RF-DE      HHTAIRQAILCWGELMTLATWVGANL-DPVSRDLVVSYVNTNMGLKFRQL
                           ***. .           . * . :     : .          .::    

MF925382_HBc_P-RF-CB      LWFHLSCLMFGRDIVHEYLVSFGVWIRTPAAYRPTNAPILSTLPETAVIR
KC774323_HBc_P-RF-CB      LWFLPSCLTFGRQTVLAYLVTFAAWIRTPPAYRPPNAPILSSLRETTVDS
MK534679_HBc_P-RF-CB      LWFHISCLTFGRQTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIR
HQ700554_HBc_P-RF-CB      LWFHLSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
DQ089798_HBc_P-RF-CB      WWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ377604_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
MK534715_HBc_P-RF-BC      LWFHISCLTFGRETVLDYLVSFGVWIRTPPAYRPPNAPILSTLPEVTVVR
KJ803791_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
MG826150_HBc_P-RF-BC      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPTNAPILSTLPETTVVR
FJ032343_HBc_P-RF-CB      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
FJ386674_HBc_P-RF-BC      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KU576384_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPANAPILPTLPETTVIR
FJ386635_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AF461361_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ562317_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVR
KY363262_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KY363263_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU939630_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ386593_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ562305_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MT645039_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ386586_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPSNAPILSTLPETTVVR
EU882006_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPAPYRPPNAPILSTLPETTVVR
EU939621_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPAAYRPPNAPILSTLPETTVVR
GU385774_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU939589_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
EU939577_HBc_P-RF-CB      LWFHISCLTFGKETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU717211_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
FJ562302_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB367393_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB198084_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB049609_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB270535_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
DQ478898_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
KC774305_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU939547_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTIVR
KX660686_HBc_P-RF-DC      KGFHISGHTLGRETVLEYLVSFGVWIRTSTAYRPPNALILSTLPETTVVR
MN683707_HBc_P-RF-DC      KGFHISGHTLGRETVLEYLVSFGVWIRTSTAYRPPNALILSTLPETTVVR
HQ684848_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
KC774447_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
KJ803803_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
MT645056_HBc_P-RF-BC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
EU939551_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU916228_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ377556_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPQNAPILSTLPETTVVR
KJ803822_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPNYRPPNAPILSMLPETAVVR
KU576837_HBc_P-RF-BC      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
KU577083_HBc_P-RF-BC      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
FJ562287_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
Y18856_HBc_P-RF-CB        LWFHISCLAFGRETVLEYLVSFGVWIRTPPAYRPPNAPLLSTLPETTVVR
KC774486_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AY057948_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KT991427_HBc_P-RF-DC      LWFHISCLTFGRGTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
FJ562263_HBc_P-RF-DC      LWFHISCLTFGRGTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
KT991424_HBc_P-RF-DC      LWFHISCLTFGRGTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
MK534734_HBc_P-RF-BC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
MK534714_HBc_P-RF-BC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
MK534700_HBc_P-RF-BC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
KR013843_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
KJ803788_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
DQ478886_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
AY817513_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FJ386633_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MK534725_HBc_P-RF-CB      LWFHISCLTFGREIVLEYLVSFGVWIRTPPPYRPQNAPILSTLPETTVVR
MK534594_HBc_P-RF-BC      LWFHVSCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
KT991419_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KR013806_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
KM213033_HBc_P-RF-CB      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KC774449_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
KC774430_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
KC774431_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETAVVR
KC774349_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
KC774488_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
KC774493_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
JX504540_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
JF828933_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
JF828934_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
JF828935_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
JF828936_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
JF828938_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
FJ715345_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
FJ715346_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
FJ715347_HBc_P-RF-CB      LWFHISCLTFGRETVLEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
FJ562278_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KT991417_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KT991420_HBc_P-RF-DC      LWFHISCLTFGRETVLEYLVSSGVWIRTPPAYRPPNAPILSTLPETTVVR
KT991423_HBc_P-RF-DC      LW