HBVdb

Dataset for protein HBSP of genotype RF

[Download (right click)] [Edit] [Sequences] [Repertoires]

1300 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KC774323_HBSP_P-RF-CB      MPLSYHHFGKLLWTH--D--E--AGPIGALLPRLADEKTNCRVPEDLNLG
MG826151_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPPLAEEGFNRRVAEDLNLG
JF440021_HBSP_P-RF-AG      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AF297619_HBSP_P-RF-DA      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AB194949_HBSP_P-RF-AE      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
GQ331048_HBSP_P-RF-AE      MPLSYQHFRKLLLLD--EGTE--VGPLEEELPRLADEDLNRRVAEDLNLG
JF439776_HBSP_P-RF-AG      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADEDLNRRVAEDLHLQ
JF440019_HBSP_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADADLNRRVAEDLNLG
JF440022_HBSP_P-RF-AG      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AB222708_HBSP_P-RF-AD      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AB453985_HBSP_P-RF-AC      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AB933282_HBSP_P-RF-AG      MPLSYQHFRKLLLLD--DGTE--AGPLEEELPRLADADLNRRVAEDLNLG
AB933283_HBSP_P-RF-AG      MPLSYQHFRKLLLLD--DXTX--AGPLEEELPRLADADLNRRVAZDLNLG
MF925386_HBSP_P-RF-AC      MPLSYQHFRKLLLLD--DGTE--SGPLEEELPRLADADLNRRVAEDLNLG
MT645045_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--G--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826145_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEKELPRLADEDLNRRVAEDLNLG
MH746813_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEKELPRLADEDLNRRVAEDLNLG
MH746811_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH746812_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161788_HBSP_P-RF-AE      MPLSYQHFRSVLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161767_HBSP_P-RF-AE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161837_HBSP_P-RF-AE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161838_HBSP_P-RF-AE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HF571060_HBSP_P-RF-AE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MK052970_HBSP_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADKGLNRRVTKDLNLG
KP148450_HBSP_P-RF-GC      MPLSYQQFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF053188_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--D--AGPLEEELPRLADEGLNRRVADDLNLG
KJ803782_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--D--AGPLEEELPRLADEGLNRRVADDLNLG
EU939631_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HM146131_HBSP_P-RF-AD      MPLSYQHFRKLLLLD--DEAE--VGPLEGELPRLADEDLNRRVAEDLNLG
AY161147_HBSP_P-RF-DA      MPLSYQHFRKLLLLD--DETE--AGPLEEELPRLADEDLNRRVAEDLNLG
MF488705_HBSP_P-RF-AD      MPLSYQHFRKLLLLD--DETE--VGPLEEELPRLADEDLNRRVAEDLNLG
MT426089_HBSP_P-RF-AB      MPLSYQHFRKLLLLD--DETE--VGPLEEELPRLADEDLNRRVAEDLNLG
KJ586810_HBSP_P-RF-AF      MPLSYQHFRKLLLLD--DETE--AGPLEEELPRLADEDLNRRVAEDLNLQ
AY161140_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--VETE--AGSLEEELPRLADEDLNRRFAEDLNLG
AY161141_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--VETE--AGSLEEELPRLADEDLNRRFAEDLNLG
AY233277_HBSP_P-RF-AC      MPLSYQHFRKLLLLD--DETE--AGPLEEELPRLADEDLNRRVAEDLNLG
AY236161_HBSP_P-RF-DA      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY161145_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY161146_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF214656_HBSP_P-RF-AC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EF103283_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EF103282_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925404_HBSP_P-RF-AC      MPLSYQHFRKLLLLD--DETE--AGPLEEELPRLADEDLNRRVAEDLNLG
EU660227_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KJ717815_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ717816_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803803_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534613_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534717_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534724_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534735_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ410497_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534734_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEELNLG
EU882006_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB241109_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774178_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774364_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH094410_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534559_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534587_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534635_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377595_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534630_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534637_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534641_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534653_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534681_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534686_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534695_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534701_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534716_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534722_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534665_HBSP_P-RF-CB      MPLSYPHFRRLVLLD--N--G--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534632_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534706_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534713_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377635_HBSP_P-RF-BC      MPLSYQRFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC315400_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534615_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534725_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534728_HBSP_P-RF-BC      MPLSYQHFRKLLLLE--E--G--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534648_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVADDLNLG
MK534607_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534609_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534616_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534684_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534700_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534726_HBSP_P-RF-BC      MPLSYQHFRKLPLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534594_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPHLADEGLNRRVAEDLNLG
MK534590_HBSP_P-RF-BC      MPLSYQCFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534555_HBSP_P-RF-BC      MPLSYQHFRKLLLLE--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826150_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774414_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--K--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939627_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377630_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148337_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK052968_HBSP_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRPADEGLNRRVAEDLNLG
MK534556_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534558_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534561_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534562_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534563_HBSP_P-RF-BC      MPLSYQHFRKLPLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534564_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534566_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MK534567_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534568_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534569_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534577_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534579_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534580_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534582_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MK534583_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEELNLG
MK534584_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534589_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
MK534598_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534610_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534617_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534618_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534623_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534625_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534633_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534639_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534646_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534651_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534654_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534655_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534662_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534664_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534670_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534672_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534675_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534685_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534687_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534688_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534689_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534690_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534723_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534729_HBSP_P-RF-BC      MPLSYQHFRKLPLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534731_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534736_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK052967_HBSP_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534718_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534715_HBSP_P-RF-BC      MPLSYQHFRKLLLLE--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534712_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534660_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ801477_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534606_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU833889_HBSP_P-RF-GA      MHLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
EU185780_HBSP_P-RF-AD      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC012653_HBSP_P-RF-AD      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU833890_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
AB933279_HBSP_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
AB933280_HBSP_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
AB933281_HBSP_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707474_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707426_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707421_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707430_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707432_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707441_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707445_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707448_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707450_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707456_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707457_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707458_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707460_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707461_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707462_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707463_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707464_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707465_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707466_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707467_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707468_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLGEELPRLADEDLNRRVAEDLHLQ
JQ707469_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707470_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707471_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707472_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707473_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707475_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707424_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
JQ707459_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
MK534663_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MK534669_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EF464099_HBSP_P-RF-AG      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
HE981180_HBSP_P-RF-GF      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
FJ361772_HBSP_P-RF-GC      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ272886_HBSP_P-RF-GF      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLQ
JQ272887_HBSP_P-RF-GF      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLQ
KF219922_HBSP_P-RF-GH      MPLSYQHFRRLLLLD--X--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
KP274926_HBSP_P-RF-GA      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLHLQ
KY470998_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471001_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470996_HBSP_P-RF-GC      MPLSYQQFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KP148441_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148449_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KP148586_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882610_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882613_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882614_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX765835_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023662_HBSP_P-RF-GC      MPLSYQQFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EU835240_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF214680_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH368022_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--V--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EU833891_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023659_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023664_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023666_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023667_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023668_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023670_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ023673_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882611_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--A--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882612_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882617_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ882618_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FR714490_HBSP_P-RF-GB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC172106_HBSP_P-RF-GB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470997_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470999_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471000_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471002_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471003_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471004_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471005_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471006_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY471007_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MZ439768_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ023665_HBSP_P-RF-GC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB330368_HBSP_P-RF-DA      MPLSYQHFRKLLLLDDGT--E--AGPLEEELPRLADADLNRRVAEDLNLG
GU177079_HBSP_P-RF-DE      MPLSYQHFRRLLLLDEGT--E--AGPLEEELPRLADADLNRRVAEDLNLG
EU787444_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLLHEGLLRRDEKDLNLG
AB493840_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
KJ410520_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ475335_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU881995_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AF233236_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195940_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195941_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195956_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195957_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB033557_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB195939_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195955_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY167095_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY206374_HBSP_P-RF-CB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB014375_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ032337_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN400086_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774193_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774198_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774201_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774291_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774307_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MT426499_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377560_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MT426523_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426531_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426534_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426473_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426480_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426489_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426464_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426545_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963930_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963931_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963932_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963933_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963934_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963935_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963936_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963938_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963939_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963940_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963941_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963942_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963943_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KU963944_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
MT426562_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426540_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426539_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426533_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426526_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426501_HBSP_P-RF-CB      MPLSYQHFRKPLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426471_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426463_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--A--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426553_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426546_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLANEGLNRRVAEDLNLG
JX661487_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426576_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426575_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426574_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426573_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426572_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426571_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426570_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426569_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426568_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426567_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426566_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426565_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426564_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426563_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426561_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426560_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426559_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426558_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426556_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426555_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426554_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426551_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426550_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426549_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426547_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426544_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426543_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426542_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426538_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426537_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426536_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426535_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426532_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426530_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426529_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426528_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426525_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426522_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426521_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426520_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426519_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426518_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426517_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426515_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426514_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426513_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426512_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426511_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426510_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426508_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426507_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426506_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426505_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426504_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEALNRRVAEDLNLG
MT426503_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426502_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426500_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426498_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426497_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426496_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426495_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426494_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426493_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426492_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426491_HBSP_P-RF-CB      MPLSYQHFRKLLLSD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426490_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426488_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426487_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426486_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426484_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426483_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426482_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426479_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426478_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426477_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426476_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426475_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426472_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEALNRRVAEDLNLG
MT426470_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426469_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426468_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426466_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426465_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426461_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426460_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426459_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426457_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040174_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ707714_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ717814_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRFAEDLNLG
KJ803802_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRFAEDLNLG
FJ386643_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ386586_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EF494378_HBSP_P-RF-CA      MPLSYQYFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLSLG
AB493842_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
KJ803822_HBSP_P-RF-CB      MPLSYQCFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF053166_HBSP_P-RF-BC      MPLSYPHFLRLLLLE--H--G--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803827_HBSP_P-RF-BC      MPLSYPHFLRLLLLE--H--G--AGPLEEELPRLADEGLNRRVAEDLNLG
JX504540_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939621_HBSP_P-RF-CB      MPLSYQRFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EF494376_HBSP_P-RF-CA      MPLSYQHFWKLLLLDDGT--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AP011102_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AB105172_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AB493837_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
AB493838_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDDLNRRVAEDLNLG
AB493847_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDDLNRRVAEDLNLG
AP011103_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
GQ358155_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
GQ358156_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADDGLNRRVAEDLNLG
GQ377592_HBSP_P-RF-CB      MPLSYQHFRKLLLLE--E--G--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562223_HBSP_P-RF-CD      MPLSYHHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU589337_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--T--G--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ377556_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--G--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562277_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377604_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--K--D--AGTLEEELPRLADEGLNRRVAEDLNLG
MG826146_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNHRVAEDLNLG
MG826148_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
MK534719_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--H--E--AGPLEEELPRLADEGLNHRVAEDLNLG
MG826144_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MG826141_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
M38454_HBSP_P-RF-CB        MPLSYQHFRKLLLLDXXX--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964313_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP148352_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
KJ717794_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRFAEDVNLG
KJ803788_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRFAEDVNLG
KJ598675_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--N--D--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173350_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF917451_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ732168_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNLRVAEDLNLG
HQ700519_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ684848_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HM750133_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377564_HBSP_P-RF-CB      MPLSYQHFRKLQLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377565_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377581_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377590_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377596_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377607_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377614_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377627_HBSP_P-RF-CD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FR714496_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ562302_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386674_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916228_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU589339_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU522070_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367400_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367393_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLKLG
AB049609_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873535_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679939_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ684849_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700523_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534560_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534574_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF053179_HBSP_P-RF-BC      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803772_HBSP_P-RF-BC      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939668_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB642096_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774212_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700527_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700528_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX096713_HBSP_P-RF-CA      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AP011104_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AP011105_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939620_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377548_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC416040_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AF411409_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357624_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826147_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562317_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774183_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774186_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774230_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
Y18856_HBSP_P-RF-CB        MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNPRVAEDLNLG
MT426481_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683675_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683662_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG893561_HBSP_P-RF-CB      MPLSYQHFGKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925384_HBSP_P-RF-DB      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KR013816_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM213033_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803785_HBSP_P-RF-CB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRFAEDLNLG
KJ717832_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
KJ173330_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KJ173329_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
JQ801476_HBSP_P-RF-CG      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
JF436922_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700526_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700520_HBSP_P-RF-CB      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEGLNRRVAADLNLG
GU357843_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377602_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADDGLNRRVAEDLNLG
EU939623_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939581_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939547_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AP011108_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
MK534730_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU717211_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ717800_HBSP_P-RF-CB      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRLAEDLNLG
KJ803791_HBSP_P-RF-CB      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRLAEDLNLG
KF873534_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873533_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873532_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873531_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEXLNRRVAEDLNLG
KF873530_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AY123424_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY247030_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939602_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386646_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377549_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377626_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ377633_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ924618_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF436923_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVVEDLNLG
Y18857_HBSP_P-RF-CB        MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ439673_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MW887645_HBSP_P-RF-CD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MW887644_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645015_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534682_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534679_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925382_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925381_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925370_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964351_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803804_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803798_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803753_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ410506_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF053160_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774324_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ027310_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--X--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661498_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873538_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873540_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873542_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873543_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645056_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645039_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF873537_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--X--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534721_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534714_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534668_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534620_HBSP_P-RF-BC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925389_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679952_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--N--E--AGPLXEELPRLABEGLNRRVAXDLNLG
KU679940_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU679945_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377539_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB198084_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916232_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939630_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700530_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700531_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700532_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774234_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774305_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964005_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964006_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964007_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964008_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964009_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964010_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964303_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964304_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964305_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964306_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964307_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964308_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964309_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964310_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964311_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964312_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964314_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964315_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964316_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964317_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY363262_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY363263_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562247_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195950_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB195951_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367419_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB367800_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386649_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562226_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ562294_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ787446_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ787480_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828933_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828934_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828936_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828938_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF828935_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916239_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916240_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU916241_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377522_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774222_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774246_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774258_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KR013843_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963856_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963857_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963858_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963859_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963860_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963861_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963862_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963863_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963864_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963865_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963866_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963867_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963868_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963869_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963870_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU919166_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU919167_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645048_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386593_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871999_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774344_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040146_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040148_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645071_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645035_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645029_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426557_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426541_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426527_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426524_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426485_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426467_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426462_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426456_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK720628_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK720627_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK534585_HBSP_P-RF-CB      MPLSYQHFRKLPLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK321265_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG893559_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG893555_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG893554_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826149_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MG826142_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC458432_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279267_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279266_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279265_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279264_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
LC279263_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY881840_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470893_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964003_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964001_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963999_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963998_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963995_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963994_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963993_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963991_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963990_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU963883_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU695742_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELHRLADEGLNRRVAEDLNLG
KM875422_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173358_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173349_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173326_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173325_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173322_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KJ173320_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KJ173300_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173299_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173280_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ173279_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774349_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774341_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774332_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774328_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774322_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774317_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774294_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774263_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774188_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661494_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661486_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX661485_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX429896_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX026887_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ040142_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
JQ040130_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
HQ700547_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GU385774_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377634_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377613_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377611_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEELNLG
GQ377594_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377544_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377534_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377520_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ377516_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715414_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715413_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715412_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715411_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715387_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715385_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715384_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715347_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715346_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ715345_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562336_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562314_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562305_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562287_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562271_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562267_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562229_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562227_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--V--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386635_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ386633_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386585_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386581_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ386578_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ032343_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939606_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EU939589_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU939551_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU872015_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU872014_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871997_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871996_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871995_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871994_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871993_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871992_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871991_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871990_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871989_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871988_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871987_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871986_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871985_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871984_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871983_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU871981_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY040627_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AF461361_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AF330110_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB670303_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB205152_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB300369_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--VGPLEEELPRLADEGLNRRVAEELNLG
KX660685_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADKGLNRRVAKDLDLG
MN683641_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADKGLNRRVAKDLDLG
KY470845_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--K--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470848_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--K--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470851_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--K--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470852_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--K--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683712_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--N--D--AGPLEDELPRLADEGLNRRVAEDLNLG
J02202_HBSP_P-RF-DE        MPLSYQRFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ349207_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KJ647356_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700503_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700536_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLAXEDLNRRVAEDLNLG
HQ700494_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB033559_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB048702_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AB048703_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ692536_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLR
HQ700492_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEELNLG
HQ700493_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700497_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700500_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700501_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700524_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700525_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700534_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--SGPLEEELPRLADEDLNRRVAEDLNLG
HQ700535_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700537_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700538_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700539_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700540_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700541_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700579_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700581_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700582_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700583_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700584_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
HQ700585_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KF779353_HBSP_P-RF-DA      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH481858_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH481860_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEGLPRLADEDLNRRVAEDLNLG
MH481861_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH481862_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH481859_HBSP_P-RF-DE      TPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KX357641_HBSP_P-RF-DE      MPLSYQHFRRLLFLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491455_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774450_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426114_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683699_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683703_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683688_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650087_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683687_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KX660689_HBSP_P-RF-DC      MPLSYQDFRKLLLLD--D--E--AGPLEDELPRLADEDLNRRVAEDLNLG
MN683711_HBSP_P-RF-DC      MPLSYQDFRKLLLLD--D--E--AGPLEDELPRLADEDLNRRVAEDLNLG
KX660684_HBSP_P-RF-DC      MPLSYQHFRKLLLVD--D--E--AGPLEDELPRLADEGLNRRVAKDLNLG
MN683706_HBSP_P-RF-DC      MPLSYQHFRKLLLVD--D--E--AGPLEDELPRLADEGLNRRVAKDLNLG
KU964367_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KP288875_HBSP_P-RF-DE      MPLSYQYFRRLLLLD--E--E--AGPLEEELPHLADEGLNRRVAEDLNLG
HM750147_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750148_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KC774482_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEDLNRRVAEDLNLG
MN683694_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
FJ562263_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--N--AGPLEDELPRLADEGLNRRVAEDLNLG
KT991424_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--N--AGPLEDELPRLADEGLNRRVAEDLNLG
KT991427_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--N--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683618_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADQGLNRRVAEDLNLG
KU711666_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257154_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
GQ161806_HBSP_P-RF-EA      MPLSYQHFRXLLLLD--X--E--AGPLEEELPRLADEDLNRRVAEDLNLQ
FN594771_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FN594767_HBSP_P-RF-DE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLQ
FJ904430_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--E--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MW601241_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097724_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645062_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683725_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683721_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683626_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683612_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683609_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN657317_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPR--DEGLNRRVAEDLNLG
MH724239_HBSP_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MW601284_HBSP_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF618346_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU964366_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KU964370_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KU964372_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KU964374_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KU964379_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KU964380_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KM577667_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
KX827302_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
MW601260_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--N--D--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097740_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--N--D--AGPLEEELPRLADEGLNRRVAEDLNLG
KF679991_HBSP_P-RF-DE      MPLSYQHFRSVLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192833_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192835_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192836_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192837_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192838_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192839_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF192841_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF618347_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774458_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491448_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ161754_HBSP_P-RF-DE      MPLSYQHFRRILLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904442_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLKEELPRLADKGLNLRVAEDLNLG
FJ904437_HBSP_P-RF-DE      MPLSYQQFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU594406_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ904397_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904408_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEDLNRRVAEDLNLG
FJ904409_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478889_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRHVAEDLNLG
DQ464167_HBSP_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLPDEDLNRRVPEDLNLG
DQ464166_HBSP_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AY817512_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY817513_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478898_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU787435_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774428_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774430_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774468_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774492_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774494_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683616_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX429898_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774434_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774463_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774472_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774489_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774497_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774499_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP276254_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP276255_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683590_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683592_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MN683594_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MN683597_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683624_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683625_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683627_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683630_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683632_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683634_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683635_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683643_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683644_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683645_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683647_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683649_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683651_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683652_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683653_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683654_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683655_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683656_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683659_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683660_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683661_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683663_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683683_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645065_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY057948_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
AY817511_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
DQ478890_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
FJ349241_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750142_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750143_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750145_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750146_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750149_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
HM750150_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KC774456_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KC774485_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KP276253_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KP276256_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KX354997_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
KX660686_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650068_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650072_HBSP_P-RF-DC      MPLSYLHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650073_HBSP_P-RF-DC      MPLSYLHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650074_HBSP_P-RF-DC      MPLSYLHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650075_HBSP_P-RF-DC      MPLSYLHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650076_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650077_HBSP_P-RF-DC      MPLSYLHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650078_HBSP_P-RF-DC      MPLSYLHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650079_HBSP_P-RF-DC      MPLSYQHFRRLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650080_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650081_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650082_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650083_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650084_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650085_HBSP_P-RF-DC      MPLSYLHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN650086_HBSP_P-RF-DC      MPLSYLHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683580_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683587_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683628_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683676_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683677_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683678_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683680_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683686_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683689_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683690_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683691_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683692_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683693_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683695_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683696_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683697_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683700_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683707_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683715_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683716_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683718_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDVLPRLADEGLNRRVAEDLNLG
MN683719_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683720_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683723_HBSP_P-RF-DC      MPLSYLHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
MN683724_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEDELPRLADEGLNRRVAEDLNLG
DQ991753_HBSP_P-RF-DE      MPLSYHHFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904407_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674432_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674433_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904444_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF754616_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257164_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257174_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY629632_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
EU594436_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MW601296_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097767_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904405_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGVNRRVAEELNLG
AB674436_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
AM494716_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904394_HBSP_P-RF-DE      MPLSYQHFRXLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904403_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904404_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904406_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904425_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904428_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904436_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904440_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904398_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGXNRRVAEDLNLG
FJ904416_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGXNRRVAEDLNLG
FJ904417_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGXNRRVAEDLNLG
GU563560_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY233293_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB188245_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB583679_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AJ627217_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY233295_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ111987_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ464164_HBSP_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVEEDLNLG
DQ464165_HBSP_P-RF-DE      MPLSYPHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
EF103285_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
EU594435_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
GQ183486_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB188243_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY470854_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660680_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEEXPRXADEGLNRRVAEDLNLG
AB270535_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674504_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY800249_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY817509_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLDEELSRLADEGLNRRVAEDLNLG
AY817510_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY817515_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY862864_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY862865_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY862866_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLR
DQ478886_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
DQ478887_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478892_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
DQ478897_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
EU787434_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ562278_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491449_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JF491451_HBSP_P-RF-DC      MPLSYPHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774420_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774422_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774423_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774424_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774425_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774426_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774432_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774433_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774435_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774439_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774443_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774447_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774448_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774452_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774453_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774454_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774455_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774457_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774461_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774466_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774470_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774471_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774474_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774475_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774476_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774478_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774479_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774480_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774481_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774483_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774484_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774486_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774488_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774490_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774493_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774495_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KC774498_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470884_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470886_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645067_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645066_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645063_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645060_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT645049_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683730_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683722_HBSP_P-RF-DC      MPLSYRHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683717_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683714_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683713_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683685_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683684_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683679_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683674_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683673_HBSP_P-RF-DC      MPLSYRHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683672_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683671_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683670_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683669_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683668_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683666_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683665_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683664_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683658_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683657_HBSP_P-RF-DC      MPLSYQHFRKLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683650_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683642_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683640_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683639_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683638_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683637_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683636_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683623_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683622_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683621_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683619_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683617_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683615_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683614_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683613_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683611_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683610_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683607_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683605_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683603_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683596_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683586_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683584_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683582_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683579_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683574_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683572_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN683571_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MN657316_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN657315_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470856_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470855_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470850_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470849_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470847_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470846_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470843_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660682_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660677_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660675_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX660674_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736917_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736915_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736914_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU519423_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU519422_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991423_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991421_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991420_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991419_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT991417_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168421_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168420_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470897_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470892_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470891_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470890_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470887_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470888_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904400_HBSP_P-RF-DE      MPLSYQSFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLHLG
KC774449_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FN594769_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM606741_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK618440_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674412_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MZ097652_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KY670781_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904447_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904396_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904441_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN507835_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
JF754613_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN040803_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357628_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLHLG
X65259_HBSP_P-RF-DA        MPLSYQHFRRLLLLH--D--E--AGPLEEELPRLPDQGLNRRVAEDLNLG
EF103284_HBSP_P-RF-AD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN688715_HBSP_P-RF-DE      MPLSYQSFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
MK052957_HBSP_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK052969_HBSP_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM577666_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN688689_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--N--K--AGPLEEELPRLADQGLNRRVAEDLNLG
X68292_HBSP_P-RF-DA        MPLSYQHFRKLLLLD--D--G--TGPLEEELPRLADEGLNRRVAEDLNLG
MN683588_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH724243_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEEVPRLADEGLNLRVAEDLNLG
KC774431_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
FJ904414_HBSP_P-RF-DE      MPLSYQHFRRLLFLD--E--D--AGPLEEELPRLADEGLNRRVAEDLNLG
JN688717_HBSP_P-RF-DE      MPLSYQLFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
DQ315777_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AY373430_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
MZ097745_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
MW601317_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MW601264_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
MT645070_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT426455_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK052976_HBSP_P-RF-BD      MPLSYQHFRKLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF488702_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLKEELPHLADEGLNRRVAEDLNLG
KT366492_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KT003704_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KR013806_HBSP_P-RF-CB      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM524359_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
KM524337_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM524336_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ803771_HBSP_P-RF-DB      MPLSYQRFRRLLLLD--A--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ647351_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADQGLNRRVAEDLNLG
KJ647349_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
AB270538_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097826_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--V--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MN683581_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH685719_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925397_HBSP_P-RF-DC      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925396_HBSP_P-RF-DC      MPLSYQYFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KY470844_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357636_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357629_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357626_HBSP_P-RF-DE      MPLSYQHFRRLLLLE--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357625_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT366503_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KJ470898_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
KC774442_HBSP_P-RF-DC      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664929_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNHRVAEDLNLG
JN642160_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPHLADEGLNRRVAEDLNLG
JN642127_HBSP_P-RF-DE      MPLSYQHFRRLLLLE--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257210_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
AB674434_HBSP_P-RF-DE      MPLSYQHFRSLLLLD--D--D--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097822_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097758_HBSP_P-RF-DE      MPLSYQHFRRLLLLX--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664946_HBSP_P-RF-DA      MPLSYQHFRKLLLLD--V--EGEAGPLEEELPRLADEGLNRRVAEDLNLG
JN257216_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH464835_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MH464846_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MH464850_HBSP_P-RF-DA      MPLSYQHFRKLLLLD--D--EXXAGPLEEELPRLADEDLNRRVAEDLNLG
MH464851_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MH464852_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--EXXAGPLEEELPRLADEGLNRRVAEDLNLG
MT210033_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--EAXXGPLEEELPRLADEGLNRRVAEDLNLG
X80925_HBSP_P-RF-DE        MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MZ097806_HBSP_P-RF-DE      MPLSYQHFRRLVLLD--N--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MZ097777_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097766_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEXLNRRVAEDLNLG
MZ097716_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MW601310_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MW601227_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MN507850_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK618445_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK618444_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK618439_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK618438_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK598656_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MK598654_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK598653_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK598652_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MH724240_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MH724222_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357630_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--D--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736922_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--X--AGPLEEELPRLADEGLNRRVAXDLNLG
KM577664_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM577663_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM386676_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM359442_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898696_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898695_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JX898693_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN664943_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097850_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MZ097838_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MZ097814_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLX
MZ097721_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097719_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MZ097703_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097687_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MZ097680_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MW601235_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MW601230_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
MT591280_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT591275_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--K--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MT591274_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--K--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MK618442_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925402_HBSP_P-RF-BD      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925401_HBSP_P-RF-DB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925392_HBSP_P-RF-DB      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925388_HBSP_P-RF-DC      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925371_HBSP_P-RF-DC      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
MF925360_HBSP_P-RF-DB      MPLSYQHFRRLLLLD--H--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX827299_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357635_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357634_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357633_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357632_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357631_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357627_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KX357623_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736923_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KU736921_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KT366504_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KR905422_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP995112_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168418_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168417_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KP168416_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM606751_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLANEGLNRHVAENLNLG
KM606750_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM577665_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KM524357_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF471643_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
KF170740_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--E--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JQ687532_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEDLNRRVAEDLNLG
JN642152_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN642141_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN642139_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--SGPLEEELPRLADEGLNRRVAEDLNLG
JN642137_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEELNLG
JN257207_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257206_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257204_HBSP_P-RF-DE      MPLSYQHFRKLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257189_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
JN257191_HBSP_P-RF-DE      MPLSYQHFRRLLLLD--D--E--AGPLEEELPRLADEGLNRRVAEDLNLG
                             ***  *                *.:              .   :: * 

KC774323_HBSP_P-RF-CB      DLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG826151_HBSP_P-RF-BC      NLNDHQQPAPDHAKPARLLLKGTLCFPHVAVQNLRTETAPVFPSHHLGLS
JF440021_HBSP_P-RF-AG      NLNDPRPPVRDPAKPARLLLKATLCITHVAVQNLRTEIAPVFPSHHLGLS
AF297619_HBSP_P-RF-DA      NLNDPQQPARDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLS
AB194949_HBSP_P-RF-AE      NLNDPQPPVRDHAEPARLLLKATLCFPHVAVQNLRTEIALVFPSHHPGLS
GQ331048_HBSP_P-RF-AE      NPNEPQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
JF439776_HBSP_P-RF-AG      LPNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLS
JF440019_HBSP_P-RF-AG      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLS
JF440022_HBSP_P-RF-AG      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRLGLS
AB222708_HBSP_P-RF-AD      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVPNLRTEIAPVFPSHRPGLS
AB453985_HBSP_P-RF-AC      NLNDQQQPVQDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
AB933282_HBSP_P-RF-AG      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
AB933283_HBSP_P-RF-AG      NLNDQQQPVRDHAKPARLLLKATLCXPHVAVQNLRMEIAPVFPSHRPGLS
MF925386_HBSP_P-RF-AC      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
MT645045_HBSP_P-RF-BC      NLNDHQRPAPDHAKPARLLLTETLRFPHVAVQNLRTETAPVFPSHHLGLS
MG826145_HBSP_P-RF-BC      NPNDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRTETAPVFPSHHLGLS
MH746813_HBSP_P-RF-BC      NPNDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRTETAPVFPSHHLGLS
MH746811_HBSP_P-RF-BC      NPSDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRTETAPVFPSHHLGLS
MH746812_HBSP_P-RF-BC      NPNDHQPQAPGHAEPARLLLKEPLYFPHVAVQNLRTETAPVFPSHHLGLS
GQ161788_HBSP_P-RF-AE      NLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHHGLS
GQ161767_HBSP_P-RF-AE      NLNDQQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHHGLS
GQ161837_HBSP_P-RF-AE      NLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRTETAPVFPSHHHGLS
GQ161838_HBSP_P-RF-AE      NLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRTETAPVFPSHHHGLS
HF571060_HBSP_P-RF-AE      NLNDPQQPVRDPAEPARLLLKATLCFPHVVVQNLRTEIAPVFPSHHHGLS
MK052970_HBSP_P-RF-BD      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KP148450_HBSP_P-RF-GC      NPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KF053188_HBSP_P-RF-CB      NLNEHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ803782_HBSP_P-RF-CB      NLNEHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
EU939631_HBSP_P-RF-BC      NLNDPQQPAPDHAKPARLLLTEPLCFPHVAVQNLRTETAPVFPSHHLGLS
HM146131_HBSP_P-RF-AD      NLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY161147_HBSP_P-RF-DA      NLNDLQLPARDHAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
MF488705_HBSP_P-RF-AD      NPNDPQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
MT426089_HBSP_P-RF-AB      NLNDPQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
KJ586810_HBSP_P-RF-AF      LPNDPQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY161140_HBSP_P-RF-AD      NLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY161141_HBSP_P-RF-AD      NLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY233277_HBSP_P-RF-AC      NLNDQQQPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY236161_HBSP_P-RF-DA      NLNDPQQPARDHAKPARLLLKATLCFPPVAVQNLRMEIAHVFPSHRPGLS
AY161145_HBSP_P-RF-AD      NLNDPQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
AY161146_HBSP_P-RF-AD      NLNDPQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
KF214656_HBSP_P-RF-AC      NLNDPQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
EF103283_HBSP_P-RF-AD      NLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
EF103282_HBSP_P-RF-AD      NLNDQQQPARDPAEPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
MF925404_HBSP_P-RF-AC      NLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHHLGLS
EU660227_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ717815_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ717816_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ803803_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534613_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534717_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534724_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534735_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KJ410497_HBSP_P-RF-BC      NLNDHQRPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534734_HBSP_P-RF-BC      NLNDHRRPAPDHAKPARLLLKEPLCFPLVAVQNLRTETAPVFPSHHLGLS
EU882006_HBSP_P-RF-CB      NLNDHQQPVPDHARPARLLLKEPLCFPHVAVQNLRMETAPVFPSHHLGLS
AB241109_HBSP_P-RF-CB      NLNEHPQQARDHARPARLLLKEPLCFPPVAVQNLRTETAPVFPSHHLGLS
KC774178_HBSP_P-RF-BC      NLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KC774364_HBSP_P-RF-BC      NLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MH094410_HBSP_P-RF-BC      NLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534559_HBSP_P-RF-BC      NLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534587_HBSP_P-RF-BC      DLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534635_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
GQ377595_HBSP_P-RF-BC      NLNDHQPQAPGHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534630_HBSP_P-RF-BC      NLNDHQPPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534637_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534641_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534653_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534681_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534686_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534695_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534701_HBSP_P-RF-BC      NPNDHQPPARDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534716_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534722_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534665_HBSP_P-RF-CB      NLNERQLPARDHARPAQFLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534632_HBSP_P-RF-CB      NLNERQLPARDHARPAQFLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534706_HBSP_P-RF-CB      NLNERQLPARDHARPAQFLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534713_HBSP_P-RF-CB      NLNERQLPARDHARPAQFLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
GQ377635_HBSP_P-RF-BC      NLNEHQLPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KC315400_HBSP_P-RF-CB      NLNEHQLPAPDHAKPAQLLLKGPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534615_HBSP_P-RF-BC      NLNEHQLPARDHARPAQLLLKEPLCFPLVAVQNLRTETAPVFPSHHLGLS
MK534725_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETAPVFPSHHLGLS
MK534728_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534648_HBSP_P-RF-BC      NLNDHRRPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534607_HBSP_P-RF-BC      NLNDHRRPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534609_HBSP_P-RF-BC      NLNDHRRPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534616_HBSP_P-RF-BC      NLNDHRRPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534684_HBSP_P-RF-BC      NLNDHRRPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534700_HBSP_P-RF-BC      NLNDHRRPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534726_HBSP_P-RF-BC      NLNDHRRPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534594_HBSP_P-RF-BC      NLNDHQPPARDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534590_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534555_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MG826150_HBSP_P-RF-BC      NLNDHRPPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHRLGLS
KC774414_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
EU939627_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
GQ377630_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
KP148337_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK052968_HBSP_P-RF-BD      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534556_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534558_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534561_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534562_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534563_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534564_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534566_HBSP_P-RF-BC      NPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534567_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534568_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534569_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534577_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534579_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534580_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534582_HBSP_P-RF-BC      NPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534583_HBSP_P-RF-BC      NPNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534584_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534589_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534598_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534610_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534617_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534618_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534623_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534625_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534633_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534639_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534646_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534651_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534654_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534655_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534662_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534664_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534670_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534672_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534675_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534685_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534687_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534688_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534689_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534690_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534723_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534729_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534731_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534736_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK052967_HBSP_P-RF-BD      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSRHLGLS
MK534718_HBSP_P-RF-BC      NLNDHQRPAPDHAKPAQLLFKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534715_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534712_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534660_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
JQ801477_HBSP_P-RF-BC      BLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534606_HBSP_P-RF-BC      NLNDHQQPAPDHAKPAQLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
EU833889_HBSP_P-RF-GA      LPSDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRTEIAPVFPSHHLGLS
EU185780_HBSP_P-RF-AD      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
KC012653_HBSP_P-RF-AD      NLNDQQQPVRDHAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
EU833890_HBSP_P-RF-GA      LPDDPRPPARDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHRPGLS
AB933279_HBSP_P-RF-AG      LPNDQQQPVRDHAKPARLLLKATLCIPHVAVQNLRMEIAPVFPSHRPGLS
AB933280_HBSP_P-RF-AG      LPNDQQQPVRDHAKPARLLLKATLCIPHVAVQNLRMEIAPVFPSHRPGLS
AB933281_HBSP_P-RF-AG      LPNDQQQPVRDHAKPARLLLKATLCIPHVAVQNLRMEIAPVFPSHRPGLS
JQ707474_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKAPLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707426_HBSP_P-RF-GA      LPDDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707421_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707430_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707432_HBSP_P-RF-GA      LPNDPRPPVRDLAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707441_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707445_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707448_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707450_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707456_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707457_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707458_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707460_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707461_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707462_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707463_HBSP_P-RF-GA      LPNDPRPPVWDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707464_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707465_HBSP_P-RF-GA      LPNDPRPPVWDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707466_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707467_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707468_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707469_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707470_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707471_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707472_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707473_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707475_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707424_HBSP_P-RF-GA      LPDDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
JQ707459_HBSP_P-RF-GA      LPDDPRPPVRDPAKPARLLLKATLCFPHVAVQNLRMEIAPVFPSHRPGLS
MK534663_HBSP_P-RF-CB      NPNDPRPPVRDHAKPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
MK534669_HBSP_P-RF-CB      NPNDPRPPVRDHAKPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
EF464099_HBSP_P-RF-AG      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
HE981180_HBSP_P-RF-GF      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ361772_HBSP_P-RF-GC      NLNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
JQ272886_HBSP_P-RF-GF      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
JQ272887_HBSP_P-RF-GF      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KF219922_HBSP_P-RF-GH      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KP274926_HBSP_P-RF-GA      LPNDPRPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KY470998_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSQHLGLS
KY471001_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSQHLGLS
KY470996_HBSP_P-RF-GC      NPNDPRPPVREHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KP148441_HBSP_P-RF-GC      NPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KP148449_HBSP_P-RF-GC      NPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KP148586_HBSP_P-RF-GC      NPNDPRPPARDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
FJ882610_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882613_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882614_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KX765835_HBSP_P-RF-GC      NLNDPQPPVRDPAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023662_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
EU835240_HBSP_P-RF-GC      NLNDPRPPVREHAEPARLLLKATLCIPYVAVQNLRTEIAPVFPSHHLGLS
KF214680_HBSP_P-RF-GC      NPNDPRPPVRELAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
MH368022_HBSP_P-RF-GC      NPNDPRPRVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
EU833891_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023659_HBSP_P-RF-BC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
FJ023664_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023666_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023667_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023668_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023670_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ023673_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882611_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882612_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882617_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FJ882618_HBSP_P-RF-GC      NPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
FR714490_HBSP_P-RF-GB      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KC172106_HBSP_P-RF-GB      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY470997_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KY470999_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471000_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471002_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471003_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471004_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
KY471005_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471006_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
KY471007_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
MZ439768_HBSP_P-RF-GC      NPNDPRPPVRDHAKPARLLLKATLCIPHVAVPNLRTEIAPVFPSHHLGLS
FJ023665_HBSP_P-RF-GC      DPNDPRPPVRDHAEPARLLLKATLCIPHVAVQNLRTEIAPVFPSHHLGLS
AB330368_HBSP_P-RF-DA      NLNDLQLPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLS
GU177079_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPLVAVQNLRMETAPVFPSHHPGLS
EU787444_HBSP_P-RF-CB      NLGEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB493840_HBSP_P-RF-CB      NPNEPQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KJ410520_HBSP_P-RF-CB      NLNEHQPPARGHARPARFLLKEPLCFPRVAVQNLRTQTALVFPSHHPGLS
GQ475335_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU881995_HBSP_P-RF-CB      NLNGRQPPARGHARPARFLLKEPLCFPLVAVQNLRTEAALVFPSHHPGLS
AF233236_HBSP_P-RF-CB      NLNEPQPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195940_HBSP_P-RF-CB      NLNEHQPPARGHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195941_HBSP_P-RF-CB      NLNEHQPPARGHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195956_HBSP_P-RF-CB      NLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195957_HBSP_P-RF-CB      NLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB033557_HBSP_P-RF-CB      NLNEPQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195939_HBSP_P-RF-CB      NLNEHQPPARGHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195955_HBSP_P-RF-CB      NLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AY167095_HBSP_P-RF-CB      NLNEHQPPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AY206374_HBSP_P-RF-CB      NLNEHQPPARGHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB014375_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ032337_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JN400086_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774193_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774198_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774201_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774291_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774307_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MT426499_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
GQ377560_HBSP_P-RF-CB      NLNEHQLPARGHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MT426523_HBSP_P-RF-CB      NLNEHQLPARDHGRPARVLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426531_HBSP_P-RF-CB      NLNEHQLPARDHGRPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426534_HBSP_P-RF-CB      NLNEHQLPARDHGRPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426473_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETTLVFPSHHHGLS
MT426480_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETTLVFPSHHHGLS
MT426489_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETTLVFPSHHHGLS
MT426464_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMGTALVFPSHHHGLS
MT426545_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMGTALVFPSHHHGLS
KU963930_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963931_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963932_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963933_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963934_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963935_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963936_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963938_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963939_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963940_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963941_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963942_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963943_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
KU963944_HBSP_P-RF-CB      NLNEHQLPARAHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHHGLS
MT426562_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLQMETALVFPSHHHGLS
MT426540_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHQGLS
MT426539_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426533_HBSP_P-RF-CB      NLNEHQLPARDHARTARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426526_HBSP_P-RF-CB      NLNEHQLPARDHARSARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426501_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426471_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426463_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426553_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFSSHHHGLS
MT426546_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFTSHHHGLS
JX661487_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSRHPGLS
MT426576_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426575_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426574_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426573_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426572_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426571_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426570_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426569_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426568_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426567_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426566_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426565_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426564_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426563_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426561_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426560_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426559_HBSP_P-RF-CB      NLNEHQLPARDHARPARVLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426558_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426556_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426555_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426554_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426551_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426550_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426549_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426547_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426544_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRVETALVFPSHHHGLS
MT426543_HBSP_P-RF-CB      NLNEHQLPARDHARPARVLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426542_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426538_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426537_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426536_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426535_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426532_HBSP_P-RF-CB      NHNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426530_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426529_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426528_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426525_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426522_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426521_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426520_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426519_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426518_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426517_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426515_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426514_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426513_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426512_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426511_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426510_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426508_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426507_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426506_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426505_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426504_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426503_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426502_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426500_HBSP_P-RF-CB      NLNEHQLPARDHARPARVLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426498_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426497_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426496_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426495_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426494_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426493_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426492_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426491_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426490_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426488_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426487_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426486_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426484_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426483_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHQGLS
MT426482_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426479_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426478_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426477_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426476_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426475_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426472_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426470_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426469_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426468_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426466_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426465_HBSP_P-RF-CB      NHNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426461_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426460_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426459_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MT426457_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
JQ040174_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKXPLCFPLVAVQNLRTETALVFPSHHXGLS
JQ707714_HBSP_P-RF-CB      NLNDHQLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ717814_HBSP_P-RF-CB      NLNEHQLPAPDHAKPARLLLKEPLCFPHVAVQNLWTETAPVFPSHHLGLS
KJ803802_HBSP_P-RF-CB      NLNEHQLPAPDHAKPARLLLKEPLCFPHVAVQNLWTETAPVFPSHHLGLS
FJ386643_HBSP_P-RF-CB      NLNEPQLPARDLARPAQFLLKEPLYFPLVAVQNLRTETALVFPSHHPGLS
FJ386586_HBSP_P-RF-CB      NLNEHQLPARAHARPAQYLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EF494378_HBSP_P-RF-CA      NLNEHQQQARDHARPARLLLKASLCFPLVAVQNLRMETAPVFPSHHPGLS
AB493842_HBSP_P-RF-CB      NLNEHQLPVRGLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KJ803822_HBSP_P-RF-CB      NLNEHQLPARDPARPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KF053166_HBSP_P-RF-BC      NLNDHRPPAPDHAKPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KJ803827_HBSP_P-RF-BC      NLNDHRPPAPDHAKPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
JX504540_HBSP_P-RF-CB      NPNEHQPPARDRARPARFLLKETLCFPLVAVQNLRTETALVFPSHHPGLS
EU939621_HBSP_P-RF-CB      NLSEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EF494376_HBSP_P-RF-CA      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AP011102_HBSP_P-RF-CB      NPNEHQLPPQDLARPAQFLLKEPLCFPPVAVQNLRTETALVFPSHHPGLS
AB105172_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AB493837_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AB493838_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AB493847_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AP011103_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLHKEPLCFPHVAVQNLRTETALVFPSHHPGLS
GQ358155_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
GQ358156_HBSP_P-RF-CB      NPNEHQLPARDLARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
GQ377592_HBSP_P-RF-CB      NLNEHQLPPPDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
FJ562223_HBSP_P-RF-CD      NPNEHQLPARDHARPARILPTEPLCFPLVAVQNLRTETALVFPSHHLGLS
EU589337_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
GQ377556_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562277_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377604_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG826146_HBSP_P-RF-CB      NLNELQLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
MG826148_HBSP_P-RF-CB      NLNELQLPARDHARPARHLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
MK534719_HBSP_P-RF-CB      NLNEHQPPVRDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
MG826144_HBSP_P-RF-CB      NLNELQLPARDHARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
MG826141_HBSP_P-RF-CB      NLNELQLPARDHARPARLLLREPLCFPLVAVQNLRTEIALVFPSHHPGLS
M38454_HBSP_P-RF-CB        NLNEHQLPARDHARPARFLLKEPLCFPLLAVQNLRTETALVFPSHHLGLS
KU964313_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLREPLCFPLVAVQNLRTETALVFPSHHPGLS
KP148352_HBSP_P-RF-CB      NLNEHQLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KJ717794_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPVCFPLVAVQNLRTEIALVFPSHHLGLS
KJ803788_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPVCFPLVAVQNLRTEIALVFPSHHLGLS
KJ598675_HBSP_P-RF-CB      NLNELQLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
KJ173350_HBSP_P-RF-CB      NLNEHQQPARDHAKPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KF917451_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPHVAVQNLRTEIAPVFPSHHLGLS
JQ732168_HBSP_P-RF-CB      NLNEHPLPARDHARHARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
HQ700519_HBSP_P-RF-CB      NPNERQLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
HQ684848_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHRPGLS
HM750133_HBSP_P-RF-CB      NLNEHQPPARDPARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
GQ377564_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377565_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377581_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377590_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377596_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377607_HBSP_P-RF-CB      NLNEHQLPPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377614_HBSP_P-RF-CB      NLNEHQLQPRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377627_HBSP_P-RF-CD      NLNEHQLPPRDHAKPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
FR714496_HBSP_P-RF-CB      NPNEHQLPARDHARPARFLLKATLCFPLVAVQNLRTEIAPVFPSHHLGLS
FJ562302_HBSP_P-RF-CB      NLNEHQLPVRDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386674_HBSP_P-RF-BC      NPNDHQQPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
EU916228_HBSP_P-RF-CB      NLNGHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
EU589339_HBSP_P-RF-CB      TLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EU522070_HBSP_P-RF-CB      NLNEHQLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
AB367400_HBSP_P-RF-CB      NLNEQQLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLS
AB367393_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLAAVQNLRTEIALVFPSHHPGLS
AB049609_HBSP_P-RF-CB      NLNEQQLPVRDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KF873535_HBSP_P-RF-CB      NPNDQRPXARDLAEPARXLLKEPLCXPHVAVQNLRTAIAPVFPSHHLGLS
KU679939_HBSP_P-RF-CB      NPNDQRPPARDLAEPARSLLKEPLCFPPVAVQNLRTAIAPVFPSHHLGLS
HQ684849_HBSP_P-RF-BC      NLNDHQLPAPDHARPAQLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
HQ700523_HBSP_P-RF-CB      NPNEHQLQARDPARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHLGLS
MK534560_HBSP_P-RF-CB      NLNEHQLPARDHARPAQLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
MK534574_HBSP_P-RF-CB      NLNEHQLPARDHARPAQLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KF053179_HBSP_P-RF-BC      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KJ803772_HBSP_P-RF-BC      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
EU939668_HBSP_P-RF-CB      NLNEQQLPARDLARHARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB642096_HBSP_P-RF-CB      NLNEQQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774212_HBSP_P-RF-CB      NLNEQQLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLS
HQ700527_HBSP_P-RF-CB      NPNEHQLPARDHARPARLLLKEPLCFPPVAVQNLRTETALVFPSHHPGLS
HQ700528_HBSP_P-RF-CB      NPNEHQLPAQDHARPARLLLKEPLCFPPVAVQNLRTETALVFPSHHPGLS
KX096713_HBSP_P-RF-CA      NPNDHQLPARDHAKPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHPGLS
AP011104_HBSP_P-RF-CB      NLNEHQLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
AP011105_HBSP_P-RF-CB      NLNEHQLPVRDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
EU939620_HBSP_P-RF-CB      NLNEHQLPVRDHARPARFLLKEPLCFPLVAVQNLRTETAPVFPSHYPGLS
GQ377548_HBSP_P-RF-CB      NLNEHQLPVQDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC416040_HBSP_P-RF-CB      NLNEHQLPVLDHARPARFLLKEPLCFPHVVVQNLRTETALVFPSHHPGLS
AF411409_HBSP_P-RF-CB      NLNELQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KX357624_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MG826147_HBSP_P-RF-CB      NLNELQLPARDHARPARYLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
FJ562317_HBSP_P-RF-CB      NLNEHQQPARDHARPARLLLKTPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774183_HBSP_P-RF-CB      NLNEHQQPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774186_HBSP_P-RF-CB      NLNEHQQPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774230_HBSP_P-RF-CB      NLNEHQQPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
Y18856_HBSP_P-RF-CB        NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MT426481_HBSP_P-RF-CB      NLNEQQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHHGLS
MN683675_HBSP_P-RF-DC      NLNDLQLPARDPAEPARLLLKEPLCIPPVAVQNLRTEIALVFPSHHPGLS
MN683662_HBSP_P-RF-DC      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
MG893561_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MF925384_HBSP_P-RF-DB      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHLGLS
KR013816_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
KM213033_HBSP_P-RF-CB      NLNEHQLPARGHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
KJ803785_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKGPLCFPLVAVQNLRTEIALVFPSHRLGLS
KJ717832_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KJ173330_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173329_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ801476_HBSP_P-RF-CG      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
JF436922_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKAPLCFPLVAVQNLRTETALVFPSHHPGPS
HQ700526_HBSP_P-RF-CB      NLNEPQLPARDHARPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHPGLS
HQ700520_HBSP_P-RF-CB      NPNEHQLPARDHARPARFLLKAPLCFPLVVVQNLRTETALVFPSHHPGLS
GU357843_HBSP_P-RF-CB      NLNEHQLPAREHAGPARFLLKEPLCFPLVAVQNLRPETALVFPSHHPGLS
GQ377602_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU939623_HBSP_P-RF-CB      TLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU939581_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLRFPLVAVQNLRTETALVFPSHHPGLS
EU939547_HBSP_P-RF-CB      NLNEHRLPARDHARPARLLPTEPLCFPLVAVQNLRTETALVFPSHHPGLS
AP011108_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPPVAVQNLRTETALVFPSHHPGLS
MK534730_HBSP_P-RF-BC      NLNDHQPPSPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
EU717211_HBSP_P-RF-CB      DLNEHQLPARDPARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
KJ717800_HBSP_P-RF-CB      NLNEHQQQARDRARPARLLLKGPLCFPHVAVQNLRTETAPVFPSHHLGLS
KJ803791_HBSP_P-RF-CB      NLNEHQQQARDRARPARLLLKGPLCFPHVAVQNLRTETAPVFPSHHLGLS
KF873534_HBSP_P-RF-CB      NLNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KF873533_HBSP_P-RF-CB      NPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KF873532_HBSP_P-RF-CB      NPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KF873531_HBSP_P-RF-CB      NPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KF873530_HBSP_P-RF-CB      NPNDQQPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
AY123424_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
AY247030_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHLGLS
EU939602_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
FJ386646_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377549_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377626_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ377633_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
GQ924618_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
JF436923_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMEIALVFPSHHLGLS
Y18857_HBSP_P-RF-CB        NLNEHQLPARDLARPARFLLKEPLCFPLVAVQNLRTETAPVFPSHHLGLS
MZ439673_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
MW887645_HBSP_P-RF-CD      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
MW887644_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
MT645015_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
MK534682_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
MK534679_HBSP_P-RF-CB      NLNEHQLPAQDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
MF925382_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKGPLCFPLVAVQNLRMEIALVFPSHRLGLS
MF925381_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
MF925370_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KU964351_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
KJ803804_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KJ803798_HBSP_P-RF-CB      NLNEHQLPAPDHAKPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KJ803753_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KJ410506_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KF053160_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KC774324_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
JQ027310_HBSP_P-RF-CB      NLNEXQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
JX661498_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHLGLS
KF873538_HBSP_P-RF-CB      NPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KF873540_HBSP_P-RF-CB      NPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KF873542_HBSP_P-RF-CB      NPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
KF873543_HBSP_P-RF-CB      NPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
MT645056_HBSP_P-RF-BC      NLNDHQQPAPDHAKPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MT645039_HBSP_P-RF-CB      DLNEHPPPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KF873537_HBSP_P-RF-CB      DPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
MK534721_HBSP_P-RF-BC      NLNDPQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534714_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534668_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MK534620_HBSP_P-RF-BC      NLNDHQPPAPDHAEPARLLLKEPLCFPHVAVQNLRTETAPVFPSHHLGLS
MF925389_HBSP_P-RF-DC      NLNDHQPPARDHAKPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHLGLS
KU679952_HBSP_P-RF-CB      NPNDQRPPARDLAEPARLLLKEPLCFPHVAVQNLRTEIAPVFPSHHLGLS
KU679940_HBSP_P-RF-CB      BPNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTXIAPVFPSHHLGLS
KU679945_HBSP_P-RF-CB      NLNDQRPPARDLAEPARSLLKEPLCFPHVAVQNLRTEIALVFPSHHLGLS
GQ377539_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB198084_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU916232_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU939630_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
HQ700530_HBSP_P-RF-CB      NPNEHQLQARDHARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
HQ700531_HBSP_P-RF-CB      NPNEHQLQARDPARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
HQ700532_HBSP_P-RF-CB      NPNEHQLQARDPARPAQFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KC774234_HBSP_P-RF-CB      NLNEHQLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774305_HBSP_P-RF-CB      NLNEHPLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964005_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964006_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964007_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964008_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964009_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964010_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964303_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964304_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964305_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964306_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964307_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964308_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964309_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964310_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964311_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964312_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964314_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964315_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964316_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964317_HBSP_P-RF-CB      NLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KY363262_HBSP_P-RF-CB      NLNEHQLPARDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KY363263_HBSP_P-RF-CB      NLNEHQLPAWDHARPAQLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562247_HBSP_P-RF-CB      DLNEHQLPARDHARPAQFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195950_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB195951_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB367419_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB367800_HBSP_P-RF-CB      NPNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386649_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562226_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562294_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ787446_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ787480_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JF828933_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JF828934_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JF828936_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JF828938_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JF828935_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU916239_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EU916240_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EU916241_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
GQ377522_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTEIALVFPSHHPGLS
KC774222_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTEIALVFPSHHPGLS
KC774246_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KC774258_HBSP_P-RF-CB      NLNEHQLPARDHAKPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KR013843_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963856_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963857_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963858_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963859_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963860_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963861_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963862_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVKNLRTETALVFPSHHPGLS
KU963863_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963864_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963865_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963866_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963867_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963868_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963869_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
KU963870_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EU919166_HBSP_P-RF-CB      DLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
EU919167_HBSP_P-RF-CB      DLNEHQLPARDHARPARFLLKEPLCFPLAAVQNLRTETALVFPSHHPGLS
MT645048_HBSP_P-RF-CB      NLNEHQLPARDPARPALFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386593_HBSP_P-RF-CB      DLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871999_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774344_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ040146_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ040148_HBSP_P-RF-CB      NLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MT645071_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MT645035_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MT645029_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MT426557_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MT426541_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MT426527_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MT426524_HBSP_P-RF-CB      NLNEHQLPARDRARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MT426485_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MT426467_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MT426462_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MT426456_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MK720628_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MK720627_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MK534585_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MK321265_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MG893559_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG893555_HBSP_P-RF-CB      NLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG893554_HBSP_P-RF-CB      NLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG826149_HBSP_P-RF-CB      NPNDHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
MG826142_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
LC458432_HBSP_P-RF-CB      NLNEHQLPARDHAGPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC279267_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC279266_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC279265_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC279264_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
LC279263_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KY881840_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KY470893_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964003_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU964001_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963999_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963998_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963995_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963994_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963993_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963991_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963990_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU963883_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KU695742_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KM875422_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTQTALVFPSHHPGLS
KJ173358_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKDPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173349_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173326_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173325_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPICFPLVAVQNLRTETALVFPSHHPGLS
KJ173322_HBSP_P-RF-CB      NLNEHQLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173320_HBSP_P-RF-CB      NLNEHQLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173300_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLHKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173299_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLHKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173280_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KJ173279_HBSP_P-RF-CB      NLNEHQLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774349_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTEIALVFPSHHPGLS
KC774341_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774332_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774328_HBSP_P-RF-CB      NLNEHQLPARDHAKPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774322_HBSP_P-RF-CB      NLNEHPLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774317_HBSP_P-RF-CB      NLNEHPLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774294_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774263_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KC774188_HBSP_P-RF-CB      NLNEHQLPARDHARPARVLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JX661494_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JX661486_HBSP_P-RF-CB      NLNEHQLPALDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JX661485_HBSP_P-RF-CB      NLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JX429896_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JX026887_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ040142_HBSP_P-RF-CB      NLNEHQLPALDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
JQ040130_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
HQ700547_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GU385774_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377634_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377613_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377611_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377594_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377544_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377534_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377520_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
GQ377516_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715414_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715413_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715412_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715411_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715387_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715385_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715384_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715347_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715346_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ715345_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562336_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562314_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562305_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562287_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHRPGLS
FJ562271_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCIPLVAVQNLRTETALVFPSHHPGLS
FJ562267_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562229_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ562227_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
FJ386635_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386633_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386585_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386581_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ386578_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
FJ032343_HBSP_P-RF-CB      NPNEHQLPARDHARPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
EU939606_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTEIALVFPSHHPGLS
EU939589_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU939551_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU872015_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU872014_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNHRTETALVFPSHHPGLS
EU871997_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871996_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871995_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVRNLRTETALVFPSHHPGLS
EU871994_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871993_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871992_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871991_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871990_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871989_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871988_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871987_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871986_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871985_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871984_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871983_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
EU871981_HBSP_P-RF-CB      NLNEHQLPARDHARPARLLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AY040627_HBSP_P-RF-CB      NLNEHQLPARDPARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AF461361_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AF330110_HBSP_P-RF-CB      NLNEHQLPARDHARPARXLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB670303_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
AB205152_HBSP_P-RF-CB      NLNEHQLPARDHAKPARFLLKEPLCFPLVAVQNLRTZTALVFPSHXPGLS
AB300369_HBSP_P-RF-CB      NLNEHQLPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KX660685_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCFPPVAVQNLRTEIAPVFPSHHPGLS
MN683641_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCFPPVAVQNLRTEIAPVFPSHHPGLS
KY470845_HBSP_P-RF-DC      NPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRTEIAPVFPSHHPGLS
KY470848_HBSP_P-RF-DC      NPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRTEIAPVFPSHHPGLS
KY470851_HBSP_P-RF-DC      NPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRTEIAPVFPSHHPGLS
KY470852_HBSP_P-RF-DC      NPNEIRPPARDPAEPARLLLKEPLRIPPVAVQNLRTEIAPVFPSHHPGLS
MN683712_HBSP_P-RF-DC      NPNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
J02202_HBSP_P-RF-DE        NLNDHQPPARDPAEPARLLLKESLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ349207_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPAAVQNLRMETAPVFPSHHPGLS
KJ647356_HBSP_P-RF-DE      NLNDHQPPARDHAKPAQLLFKEPLCFPHVAVQNLRTEIAPVFPSHHPGLS
HQ700503_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLEEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700536_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLEEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700494_HBSP_P-RF-DE      ILNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
AB033559_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
AB048702_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
AB048703_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ692536_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHRPGLS
HQ700492_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700493_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRKETAPVFPSHHPGLS
HQ700497_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700500_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700501_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700524_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700525_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700534_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700535_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700537_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700538_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700539_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700540_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700541_HBSP_P-RF-DE      NLNDHQPPARDPAGPARLLLKEPLCIPPVVVQNLRTETAPVFPSHHPGLS
HQ700579_HBSP_P-RF-DE      NLNDHRPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700581_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700582_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700583_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700584_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
HQ700585_HBSP_P-RF-DE      NLNDHRPPARDPAEPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLS
KF779353_HBSP_P-RF-DA      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHRPGLS
MH481858_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MH481860_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MH481861_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MH481862_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MH481859_HBSP_P-RF-DE      NLNDHQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357641_HBSP_P-RF-DE      NLNDPQPPARDHARPARLLLKAXLCFPHVAVPNLRTETAPVFPSHHPGLS
JF491455_HBSP_P-RF-DC      NLNDPQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774450_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MT426114_HBSP_P-RF-DE      NLNDPQPPARDHADPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MN683699_HBSP_P-RF-DC      NLNDPQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683703_HBSP_P-RF-DC      NLNDPQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683688_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFSSHHPGLS
MN650087_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLS
MN683687_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLS
KX660689_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683711_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX660684_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683706_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KU964367_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHFGLS
KP288875_HBSP_P-RF-DE      NLNDLQPPARDRAKPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
HM750147_HBSP_P-RF-DC      NLNDRQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750148_HBSP_P-RF-DC      NLNDRQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774482_HBSP_P-RF-DC      NLNDRQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683694_HBSP_P-RF-DC      NLNDRQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
FJ562263_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991424_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991427_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683618_HBSP_P-RF-DC      DPNDLQQPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KU711666_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHHGLS
JN257154_HBSP_P-RF-DE      NPNDLQLPARDHAEPARLLLKETLRFPPVVVPNLRTEIAPVFPSHHPGLS
GQ161806_HBSP_P-RF-EA      LPDDHQPPVRDPAEPARLLLKEPLCFPHVVVQNLRTEIALVFPSHHHGLS
FN594771_HBSP_P-RF-DE      NLNSLQPPARDHAEPARLLLKEPLCIPPVAVQNLWMETAPVFPSHHHGLS
FN594767_HBSP_P-RF-DE      LPNDRQLPARDPAEPARLLLKEPLCFPHVAVQNLRTEIALVFPSHHHGLS
FJ904430_HBSP_P-RF-DE      DLNDLQPPARDHAGLARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MW601241_HBSP_P-RF-DE      NLNDPQPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLS
MZ097724_HBSP_P-RF-DE      NLNDPQPPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLS
MT645062_HBSP_P-RF-DC      NLNDLQPTARDPAGPAQLLLKEPLCIPHVAVQNLRTEIAPVFPSHHPGLS
MN683725_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683721_HBSP_P-RF-DC      NLNDLQPPARDPAEHARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683626_HBSP_P-RF-DC      NLNDLQPPARDPAGPAQLLLKTTLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683612_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGVS
MN683609_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTAIAPVFPSHHPGLS
MN657317_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MH724239_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MW601284_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MF618346_HBSP_P-RF-DE      NLNDLQPPAREHAGPARLLLEEPLCIPLVAVQNLRMETALVFPSHHPGLS
KU964366_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KU964370_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KU964372_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KU964374_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KU964379_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KU964380_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKAPVCIPPVAVQNLRTEIAPVFPSHHLGLS
KM577667_HBSP_P-RF-DE      NLNDPQPPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KX827302_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MW601260_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKGPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MZ097740_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKGPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KF679991_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KF192833_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192835_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192836_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192837_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192838_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192839_HBSP_P-RF-DE      NLNDLQPPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KF192841_HBSP_P-RF-DE      NLNDLQPPAREHAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MF618347_HBSP_P-RF-DE      NLNDLQPPAREHAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KC774458_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLEEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
JF491448_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLTEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
GQ161754_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHHGLS
FJ904442_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904437_HBSP_P-RF-DE      NLNDLRPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
EU594406_HBSP_P-RF-DE      NLNDRQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
FJ904397_HBSP_P-RF-DE      NLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRMEXAPVFPSHHPGLS
FJ904408_HBSP_P-RF-DE      NLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904409_HBSP_P-RF-DE      NLNDRQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
DQ478889_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHLGLS
DQ464167_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
DQ464166_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AY817512_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
AY817513_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAHVFPSHHPGLS
DQ478898_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
EU787435_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
KC774428_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
KC774430_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
KC774468_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
KC774492_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
KC774494_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
MN683616_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLWTEIAPVFPSHHPGLS
JX429898_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774434_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774463_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCFPPVAVQNLRTEIAPVFPSHHPGLS
KC774472_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774489_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774497_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774499_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KP276254_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPHVAVQNLRTEIAPVFPSHHPGLS
KP276255_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPHVAVQNLRTEIAPVFPSHHPGLS
MN683590_HBSP_P-RF-DC      NLNDLRPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683592_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683594_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683597_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683624_HBSP_P-RF-DC      NLNDLQPPARDPAGPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683625_HBSP_P-RF-DC      NLNDLQPPARDPAGPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683627_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683630_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683632_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683634_HBSP_P-RF-DC      NLNDLRPQARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHRPGLS
MN683635_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683643_HBSP_P-RF-DC      NLNDLQPPARDPAGPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683644_HBSP_P-RF-DC      NLNDLQPPARDPAGPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683645_HBSP_P-RF-DC      NLNDLQPPARDPAGPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683647_HBSP_P-RF-DC      NLNDLQPPARDPAGPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683649_HBSP_P-RF-DC      NLNDLQPPARDPAGPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683651_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683652_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683653_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683654_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683655_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683656_HBSP_P-RF-DC      NLNDLQPPAQDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683659_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683660_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683661_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683663_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683683_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MT645065_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY057948_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY817511_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ478890_HBSP_P-RF-DC      NLNDLQPPARDPAEPARRLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
FJ349241_HBSP_P-RF-DC      NLNDLQPPARDPAKPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750142_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750143_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750145_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750146_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750149_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
HM750150_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774456_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774485_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KP276253_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAHVFPSHHPGLS
KP276256_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX354997_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX660686_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRKEIAPVFPSHHPGLS
MN650068_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650072_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650073_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650074_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650075_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650076_HBSP_P-RF-DC      NLNDLPPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650077_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650078_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650079_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650080_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650081_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650082_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650083_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHRPGLS
MN650084_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650085_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN650086_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683580_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683587_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683628_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683676_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683677_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683678_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683680_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMEIAPVFPSHHPGLS
MN683686_HBSP_P-RF-DC      NLNDLQPPARDPAKPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683689_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683690_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683691_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683692_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683693_HBSP_P-RF-DC      NLNDLQPPARDPAKPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683695_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683696_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683697_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMEIAPVFPSHHPGLS
MN683700_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683707_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRKEIAPVFPSHHPGLS
MN683715_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683716_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683718_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683719_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683720_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683723_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683724_HBSP_P-RF-DC      NLNDLQPPARDPAKPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ991753_HBSP_P-RF-DE      NLTDLQPPARDHAEPARLLLKEPLCIPLVAVQNLRMETAPVFPSHHPGLS
FJ904407_HBSP_P-RF-DE      NLTDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
AB674432_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AB674433_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
FJ904444_HBSP_P-RF-DE      NPNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
JF754616_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN257164_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JN257174_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KY629632_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
EU594436_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLS
MW601296_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLS
MZ097767_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLS
FJ904405_HBSP_P-RF-DE      NLNDLQPPARDHAEPARHLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
AB674436_HBSP_P-RF-DE      NLNDLRPPARDHAEPARLLHKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AM494716_HBSP_P-RF-DE      NLNDLQPPAGDHAEPARLLLKEPLCIPLVAVQNFRMETAPVFPSHHPGLS
FJ904394_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904403_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCFPPVAVQNLRMETAPVFPSHHPGLS
FJ904404_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904406_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904425_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904428_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904436_HBSP_P-RF-DE      NLNDLQPPARDHAEPARHLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904440_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904398_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904416_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPHVAVQNLRMETAPVFPSHHPGLS
FJ904417_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPHVAVQNLRMETAPVFPSHHPGLS
GU563560_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AY233293_HBSP_P-RF-DE      DLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AB188245_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AB583679_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AJ627217_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AY233295_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
DQ111987_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
DQ464164_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
DQ464165_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
EF103285_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
EU594435_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
GQ183486_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AB188243_HBSP_P-RF-DE      NLNDPQPPARDHAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KY470854_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTSLCIPPVAVQNLRPEIAPVFPSHHPGLS
KX660680_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AB270535_HBSP_P-RF-DC      NLNELQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AB674504_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY800249_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY817509_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIALVFPSHHPGLS
AY817510_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKDPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY817515_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY862864_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY862865_HBSP_P-RF-DC      NLNDLQPTAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
AY862866_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ478886_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ478887_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ478892_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
DQ478897_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
EU787434_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
FJ562278_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
JF491449_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
JF491451_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774420_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774422_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774423_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774424_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774425_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774426_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774432_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774433_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774435_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774439_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774443_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774447_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774448_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRPEIAPVFPSHHPGLS
KC774452_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774453_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774454_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMEIAPVFPSHHPGLS
KC774455_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774457_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774461_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774466_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774470_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774471_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774474_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774475_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774476_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774478_HBSP_P-RF-DC      NLNDLQPPARDLAEPARLLLKEPLCIPPVAVQNLRMEIAPVFPSHRPGLS
KC774479_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774480_HBSP_P-RF-DC      NLNDLQPPARDLAEPARLLLKEPLCIPPVAVQNLRMEIAPVFPSHRPGLS
KC774481_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPLVAVQNLRTEIAPVFPSHHPGLS
KC774483_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774484_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774486_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPHVAVQNLRTEIAPVFPSHHPGLS
KC774488_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774490_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774493_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774495_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KC774498_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KJ470884_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KJ470886_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
MT645067_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCFPPVAVQNLRTEIAPVFPSHHPGLS
MT645066_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MT645063_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MT645060_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MT645049_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683730_HBSP_P-RF-DC      NPNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683722_HBSP_P-RF-DC      NPNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683717_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683714_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683713_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683685_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683684_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683679_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683674_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683673_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683672_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683671_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683670_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683669_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683668_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683666_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683665_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683664_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683658_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683657_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683650_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683642_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683640_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683639_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683638_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683637_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683636_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683623_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683622_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPLVAVQNLRMEIAPVFPSHHPGLS
MN683621_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683619_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683617_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683615_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683614_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683613_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683611_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683610_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683607_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683605_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683603_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683596_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683586_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683584_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683582_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCFPPVAVQNLRTEIAHVFPSHHPGLS
MN683579_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683574_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683572_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN683571_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN657316_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MN657315_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KY470856_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRPEIAPVFPSHHPGLS
KY470855_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KY470850_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KY470849_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KY470847_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KY470846_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KY470843_HBSP_P-RF-DC      NLNDLRPPARDPAEPARLLLKTPLCIPPVAVQNLRSEIAPVFPSHHPGLS
KX660682_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX660677_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX660675_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KX660674_HBSP_P-RF-DC      NLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KU736917_HBSP_P-RF-DE      NLNDLQPPARDHADPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KU736915_HBSP_P-RF-DE      NLNDLQPPARDHAXPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KU736914_HBSP_P-RF-DE      NLNDLQPPARDHADPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KU519423_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KU519422_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991423_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991421_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991420_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991419_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KT991417_HBSP_P-RF-DC      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
KP168421_HBSP_P-RF-DE      NLNDLQPPARDLAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KP168420_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KJ470897_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KJ470892_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCFPPVAVQNLRMETAPVFPSHHPGLS
KJ470891_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KJ470890_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KJ470887_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLXIPPVAVQNLRMEIAPVFPSHHPGLS
KJ470888_HBSP_P-RF-DE      NLNDLQPPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904400_HBSP_P-RF-DE      DLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KC774449_HBSP_P-RF-DC      DPNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
FN594769_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPHVAVQNLRMETAPVFPSHHHGLS
KM606741_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAHVFPSHHHGLS
MK618440_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLS
AB674412_HBSP_P-RF-DE      NLNDLQRPARDHAEPARPLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLS
MZ097652_HBSP_P-RF-DE      DLNDLQLPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHHGLS
KY670781_HBSP_P-RF-DC      DLNDLQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLS
FJ904447_HBSP_P-RF-DE      DLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHHGLS
FJ904396_HBSP_P-RF-DE      DLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
FJ904441_HBSP_P-RF-DE      DLNDLQPPARDHAEPARLLLKEPLCFPPVAVQNLRMETAHVFPSHHPGLS
MN507835_HBSP_P-RF-DE      DPNDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
JF754613_HBSP_P-RF-DE      DLNDLQRPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLS
JN040803_HBSP_P-RF-DE      DLNDLQRPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KX357628_HBSP_P-RF-DE      DLNDLQLPARDHAEPARLLLKAPLCIPPVAVQNLRMETAPVFPSHHPGLS
X65259_HBSP_P-RF-DA        NLNDLQQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLS
EF103284_HBSP_P-RF-AD      NLNDQQQPARDPAKPARLLLKATLCFPHVAVQNLWMEIAPVFPSHHPGLS
JN688715_HBSP_P-RF-DE      NLNDPQPPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MK052957_HBSP_P-RF-DE      NLNDPQQPARDHAEPARLLHKEPLCIPPVAVQNLRTEIAPVFPSRHHGLS
MK052969_HBSP_P-RF-DE      NLNDPQQPARDHAEPARLLLKEPLCIPPVAVPNLQTEIAPVFPSHHPGLS
KM577666_HBSP_P-RF-DE      NLNETQPPARDHAEPARLLLKEPLCISPVAVPNLRTEIAPVFPSHHHGLS
JN688689_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
X68292_HBSP_P-RF-DA        NLNVLQQPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLS
MN683588_HBSP_P-RF-DC      NLNDLQPPARDPAEPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MH724243_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KC774431_HBSP_P-RF-DC      NLNDLQLPARDPAKPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
FJ904414_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
JN688717_HBSP_P-RF-DE      NLSDLQPPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIALVFPSHHPGLS
DQ315777_HBSP_P-RF-DE      NLNDPQPPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
AY373430_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MZ097745_HBSP_P-RF-DE      NLNDPRPPARDHAEPARLLLKEPLCIPHVAVQNLRTEIAPVFPSHHPGLS
MW601317_HBSP_P-RF-DE      NLNDPQPPARDHAEPARPLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MW601264_HBSP_P-RF-DE      NLNDPRPPARDHAEPARLLLKEPLCIPHVAVQNLRTEIAPVFPSHHPGLS
MT645070_HBSP_P-RF-DC      NLNDRQPPAQDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MT426455_HBSP_P-RF-CB      NLNEHQLPARNHARPARFLLKEPLCFPLVAVQNLRMETALVFPSHHPGLS
MK052976_HBSP_P-RF-BD      NLNDHQQPAPDHAKPAQLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MF488702_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KT366492_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KT003704_HBSP_P-RF-CB      NLNERQRPVRDHAGPARFLLKEPLCFPHVAVQNLRTETALVFPSHHPGLS
KR013806_HBSP_P-RF-CB      NLNEHQRPARDHARPARFLLKEPLCFPLVAVQNLRTETALVFPSHHPGLS
KM524359_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KM524337_HBSP_P-RF-DE      NLNDPQPPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KM524336_HBSP_P-RF-DE      NLNDPQPPAREHAEPARLLLKEPLCIPPVAVPNLRTKIAPVFPSHHPGLS
KJ803771_HBSP_P-RF-DB      NLNDLQPPAWDHAEHARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KJ647351_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KJ647349_HBSP_P-RF-DE      NLNDPQPPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLS
AB270538_HBSP_P-RF-DE      NLNDHQPPARAHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
MZ097826_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHPGLS
MN683581_HBSP_P-RF-DC      NLNDLQPPAQEPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLS
MH685719_HBSP_P-RF-DE      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLWMETAPVFPSHHPGLS
MF925397_HBSP_P-RF-DC      NLNDLQPPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHLGLS
MF925396_HBSP_P-RF-DC      NLNDLQQPAWDHAEPARPLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLS
KY470844_HBSP_P-RF-DC      NLNDLRPPARDHAEPARLLLKTPLCIPPVAVQNLRPEIAPVFPSHHPGLS
KX357636_HBSP_P-RF-DE      NLNDLQQPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357629_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHLGLS
KX357626_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLS
KX357625_HBSP_P-RF-DE      NLNDLQLPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHHGLS
KT366503_HBSP_P-RF-DE      NLNDLQPPAWDHAEP