HBVdb

Dataset for protein HBe of genotype H

[Download (right click)] [Edit] [Sequences] [Repertoires]

58 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


KY762277_HBe_P-H      -KLCLGWLWGMDIDPYQEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762278_HBe_P-H      -KLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762282_HBe_P-H      ---CLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
AB059659_HBe_P-H      SKLCLGWLWDMDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALHRD
KY762280_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762270_HBe_P-H      SKLCLGWLWGMDIDPYKELGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762267_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762276_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSARDLLDTATALYRD
KY762279_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSARDLLDTATALYRD
KY762268_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762269_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762271_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762272_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762274_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762281_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762284_HBe_P-H      SKLCLGWLWNMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762285_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPVDFFPSVRDLLDTATALYRD
KY762275_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPADFFPSVRDLLDTASALYRD
AB059660_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRD
JX896129_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRD
FJ356716_HBe_C-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALHRD
AB064315_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASAELLSFLPSDFFPSVRDLLDTATALYRD
FJ356715_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPNDFFPSVRDLLDTASALHRE
JX896128_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB059661_HBe_P-H      SKLCLGWLWGMDIDLYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB205010_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM066946_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HQ285946_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY090457_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB179747_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB266536_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB275308_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB353764_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB375159_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB375160_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB375161_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX896125_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX896124_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM117851_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
HM117850_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EU498228_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
EF157291_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY090460_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AY090454_HBe_C-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB818694_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB375164_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
AB375163_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KX264501_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
KC836867_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX915624_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX896134_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX896133_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX896132_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX896126_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX896131_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRD
JX896127_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVEXLSFLPSDFFPSVRDLXDTASALYRD
AB375162_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLXFLPSDFFPSVRDLLDTASALYRD
JX896130_HBe_P-H      SKLCLGWLWGMDIDPYKEFGASVELLXFLPSDFFPSVRDLLDTASALYRD
                         ******.**** *:*:***.* * *** **:** *** ***:**:*:

KY762277_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762278_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762282_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB059659_HBe_P-H      ALESPEHCSPHHTALRQAVSCWREVTDFGDWVGNNLQDQAARDLVVNYVN
KY762280_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762270_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762267_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762276_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762279_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762268_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762269_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762271_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762272_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762274_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762281_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762284_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762285_HBe_P-H      ALESPEHCSPHHTALRQSILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KY762275_HBe_P-H      ALESPEHCTPHHTALRQTILCWGELMTLASWVGNNLDDPAARDLVVNYVN
AB059660_HBe_P-H      ALESPEHCTPHHTAIRQVILCWGELMTLASWVGNNLNDPAARDLVVNYVN
JX896129_HBe_P-H      ALESPEHCSPNHTAIRQAILCWGELMTLASWVGHNLEDPAARDLVVNYVN
FJ356716_HBe_C-H      ALESPDHCTPNHTALRQAISCWGELMNLASWVGNNLEDPAARDLVVNYVN
AB064315_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
FJ356715_HBe_P-H      ALESPDHCTPNHTALRQAISCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX896128_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB059661_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB205010_HBe_P-H      ALESPEHCTPSHTALRQAILCWGELMTLASWVGNNLEDPGARDLVVNYVN
HM066946_HBe_P-H      ALESPEHCTPSHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HQ285946_HBe_P-H      ALESPEHCTPSHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY090457_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB179747_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB266536_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB275308_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB353764_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB375159_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB375160_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB375161_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX896125_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX896124_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM117851_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
HM117850_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
EU498228_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
EF157291_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY090460_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AY090454_HBe_C-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB818694_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB375164_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB375163_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KX264501_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
KC836867_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX915624_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX896134_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX896133_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX896132_HBe_P-H      ALESPEHCTPNXTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX896126_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVS
JX896131_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX896127_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
AB375162_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
JX896130_HBe_P-H      ALESPEHCTPNHTALRQAILCWGELMTLASWVGNNLEDPAARDLVVNYVN
                      *****:**:*  **:** : ** *:  :..***:**:* .*********.

KY762277_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762278_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762282_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
AB059659_HBe_P-H      ANIGLKIRQLLWFHISCLTFGRETVIEYLVSFGVW
KY762280_HBe_P-H      THMGLKIRQLLWFHISCIMFGRETVLEYLVSFGVW
KY762270_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762267_HBe_P-H      THMGLKIRQLLWFHFSCLMFGRETVLEYLVSFGVW
KY762276_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762279_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762268_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762269_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762271_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762272_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762274_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762281_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762284_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762285_HBe_P-H      THMGLKIRQLLWFHLSCIMFGRETVLEYLVSFGVW
KY762275_HBe_P-H      THMGLKVRQLLWFHISCLMFGRETVLEYLVSFGVW
AB059660_HBe_P-H      THMGLKIRQLLWFHISCLTFGREIVLEYLVSFGVW
JX896129_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ356716_HBe_C-H      ANMGLKIRQFLWFHISCLTFGRETVLEYLVSFGVW
AB064315_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
FJ356715_HBe_P-H      ANMGLKIRQFLWFHISCLTFGRETVLEYLVSFGVW
JX896128_HBe_P-H      NNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
AB059661_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
AB205010_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM066946_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HQ285946_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY090457_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRDTVLEYLVSFGVW
AB179747_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB266536_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB275308_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB353764_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB375159_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB375160_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB375161_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JX896125_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JX896124_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM117851_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
HM117850_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
EU498228_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
EF157291_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY090460_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AY090454_HBe_C-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB818694_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB375164_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB375163_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KX264501_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
KC836867_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JX915624_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JX896134_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JX896133_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGGW
JX896132_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JX896126_HBe_P-H      TNMGLKIRQLLWFHISXLTFGRETVLEYLVXFGVW
JX896131_HBe_P-H      TNMGLKIRQLLWXHISCLTFGRETVLEYLVSFGVW
JX896127_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
AB375162_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
JX896130_HBe_P-H      TNMGLKIRQLLWFHISCLTFGRETVLEYLVSFGVW
                       ::***:**:** *:* : ***: *:**** ** *

© 1998-2022Legal notice