HBVdb

Dataset for protein HBx of genotype E

[Download (right click)] [Sequences] [Repertoires]

436 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KM606739_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
AB091255_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRSVSGSLGDLSSPSPSAVPADHG
AB091256_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
AB106564_HBx_C-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAAHG
AB194947_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB194948_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AB201287_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
AB201289_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGGLSSPSPSAVPADHG
AB201290_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGGLSSPSPSAVPADHG
AB205129_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205188_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205189_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205190_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB205191_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
AB205192_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB219529_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPADHG
AB219534_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDVSSPSPSAVPADHG
AB274969_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGDLSSPTPSAVPADHG
AB274970_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274973_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274974_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274975_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPPPSAVPADHG
AB274976_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274977_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPAPSAVPADHG
AB274978_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPTPSAVPADHG
AB274979_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274980_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274981_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPPVHG
AB274982_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
AB274984_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPPASAVPADHG
AB274985_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB915175_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
AB915176_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB915177_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPANHG
AB915178_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB915180_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESSGRPVSGSLGDLSSPSPSAVPADHG
AM494689_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494690_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494691_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494692_HBx_P-E      MAARLYCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494693_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494694_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494695_HBx_P-E      MAARLCCQLDPXRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494697_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494698_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
AM494699_HBx_P-E      MAARLCCQLDTTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494701_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGALSSPSPSAVPADHG
AM494702_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494703_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494705_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494706_HBx_P-E      MAARLCCQLDPARDVLCLRPVSVESCGRPVSGSLGDLSSPSPSAVPADHG
AM494707_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494710_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
AM494711_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494712_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AM494832_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AY738144_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AY738147_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AY739674_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AY739675_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
AY935700_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
DQ060822_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
DQ060823_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
DQ060824_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADDG
DQ060825_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
DQ060826_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060827_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060830_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239217_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPADHG
EU239219_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
EU239220_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239222_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAKSCGRPVSGSLGDLSSPSPSAVPADHG
EU239223_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
EU239224_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRSVSGSLGGLSSPSPSAVPADHG
EU239226_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
FJ349226_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDFSSPSPSAVPADHG
FJ349227_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FJ349237_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
FJ349239_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
FJ349240_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
FN545821_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN545822_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
FN545827_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
FN545841_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
FN545842_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPAAVPADHG
FN594748_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPXDHG
FN594749_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAVHG
FN594750_HBx_P-E      MAARLCCKLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
FN594751_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTNHG
FN594752_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
FN594753_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
FN594758_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594759_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSXSPSAVPPDHG
FN594760_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
FN594761_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAXHG
FN594762_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594765_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
FN594766_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161757_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161759_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161760_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161762_HBx_P-E      MAARLCCQLDPARDVLCLRPVRAESCGRPVSGSLGGLSSPSPSAVPADHG
GQ161764_HBx_P-E      MAARLCCQLDPTRDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161765_HBx_P-E      MAARMCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161768_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
GQ161771_HBx_P-E      MAARLCCQLDPTRDVLCLRPVGAESCGRPVSGSLGALSSPSPSAVPADHG
GQ161775_HBx_P-E      MAARLXCQLDXSRDVLCLRPVGAESRGRPLSGXLGTLSSPSPSAVPTDHG
GQ161776_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161778_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
GQ161781_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAIPADHG
GQ161782_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
GQ161783_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161785_HBx_P-E      MAARLYCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161790_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161796_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
GQ161797_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161801_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161803_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161807_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161810_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
GQ161812_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPPDHG
GQ161814_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
GQ161817_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSTVPADHG
GQ161820_HBx_P-E      MAARLCCQLDPARDVLCLRPVXAESCGRXVSGSLGDLSSPSPSAVPADHG
GQ161822_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
GQ161823_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
GQ161825_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSPGDLSSPSPSAVPADHG
GQ161831_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161833_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
GQ161834_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLPSPSPSAVPADHG
GQ161836_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
HM363565_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVPGSLGDLSSPSPSAVPADHG
HM363566_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVTGSLGDLSSPSPSAVPAVYG
HM363568_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVLGSLGDLPSPSPSAVPADHG
HM363570_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363573_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363574_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPTDHG
HM363575_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363576_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363578_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363579_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363582_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
HM363584_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
HM363586_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
HM363587_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363589_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363590_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363591_HBx_P-E      MAARMCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363592_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363593_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDVSSPSPSAVPTDHG
HM363594_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLPSPSPSAVPADHG
HM363596_HBx_P-E      MAARLGCQLDPGRDVLCLRPVSAESCGRPVSGSLGGLSSPSPSGVPADHG
HM363597_HBx_P-E      MGARMCCQLDPGRDVLCLRPVSAESWGRPVSGSLGDLSSPSPSAVPGDHG
HM363598_HBx_P-E      MAARLCCQLDPGRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363599_HBx_P-E      MAARLCCQLDPARDVLRLRPVSGESWGRPVSGSLGDLSSPSPSAVPADHG
HM363600_HBx_P-E      MGARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDISSPSPSAVPAVHG
HM363603_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
HM363605_HBx_P-E      MAARLCCQLDPARDVLCIRPVSAESCGRPISGSLGDLPSPSPSAVPAVHG
HM363606_HBx_P-E      MAARLCCQLAPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363608_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363609_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363611_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HQ700550_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HQ700551_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
JQ000009_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
JQ272902_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KF170741_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPADHG
KF170742_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
KF849714_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849715_HBx_P-E      MAARMCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849716_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849717_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGDLSSPSPSAVPADHG
KF849718_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849719_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPTDYG
KF849720_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPPPSAVPADHG
KF849723_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849724_HBx_P-E      MAARLYCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
KF849725_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849726_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849727_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849728_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF922438_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
KM606738_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KR811564_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAXHG
KR811565_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAXHG
KR811571_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPTDHG
KR811574_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KR811894_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KR811897_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KR811898_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KR811906_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KR811907_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGGLSSPSPSAVPADHG
KU736891_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
KU736892_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
KU736893_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736894_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGGLSSPSPSAVPADHG
KU736897_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736899_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736902_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
KU736903_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736904_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736909_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736910_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736911_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623842_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623843_HBx_P-E      MAARLYCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPAVHG
LT623844_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESSGRPVSGSLGGLSSPSPSAVPADHG
LT623845_HBx_P-E      MAARLCCQLDPXRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623846_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGGLSSPSPSAVPADHG
LT623847_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
LT623849_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPTPSAVPADHG
LT623850_HBx_P-E      MAARLCCQLDTARDVLCLRPVSAESRGRPVSGSLGDLSSPSPSAVPADHG
LT623851_HBx_P-E      MAARLCCQLDPARDVLCLRPVXTESCGRPVPGSLGDLSSPSPSAVPAXHG
MF772354_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
MF772355_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
MF772356_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772358_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772359_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAAHG
MF772360_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
MF772361_HBx_P-E      MAARLCCQLDLARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772362_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
MG776403_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776426_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776427_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776503_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776512_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776534_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MG776550_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCRRPVSGSLGDLSSPSPSAVPADHG
MG776729_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGPLSSPSPSAVSTDHG
MG776734_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776745_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MG776772_HBx_P-E      MAARLCCQLDPGRDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
MG776797_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776800_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSSSPSAVPAVHG
MH464856_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPAVHG
MH580614_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580617_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGDLSSPSPSAVPADHG
MH580622_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580624_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580626_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580630_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580633_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580634_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580640_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRDLSSPSPSAVPADHG
MH580644_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580645_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580648_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580650_HBx_P-E      MAARLCCQLDPARDVLCLRPVNAESCGRPVSGSLGDLSSPSPSAVPADHG
MH918655_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSTVPADHG
MK321264_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEXCGRPVSGSLGDLSSPSPSAVPADHG
MK720631_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MN507840_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507843_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRSVSGSLGDLSSPSPSAVPADHG
MN507844_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MN967526_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN967527_HBx_P-E      MAARLCCQLDPERDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN967528_HBx_P-E      MAARLCCQLDTTRDVLCLRPVSAESCGRPVSGSFGDLSSPSPSAVPADHG
MT570162_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGTLSSPSPSAVPADHG
MT570163_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSFGGLSSPSPSAVPADHG
MT570164_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
MW082636_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW455162_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGGLSSPSPSAVPADHG
MW455165_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
MW926548_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRGLSSPSPSAVPADHG
MW926549_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGDLSSPPPSAVPADHG
MW926550_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSASAVPADHG
MW926551_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGXLSSPSPSAVPADHG
MW926552_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTDHG
MW926554_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLXSSSPSAVPADHG
MW926555_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW926556_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW926557_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGPLGGLSSPSPSAVPADHG
MW926558_HBx_P-E      MAARMCCQLDPERDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
MW926559_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPXDHG
MW926560_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW926562_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSRSLGDLSSPSPSAVPADHG
MW926563_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW926564_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPTVHG
MW926565_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSSSPSAVPADHG
MW926566_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MZ962189_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
MZ962192_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
MZ962198_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
OL362103_HBx_P-E      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
OL362105_HBx_P-E      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
OM256457_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPTDHG
ON402785_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGTLGDLSSPSPSAVPADHG
MN507842_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPAAHG
AB201288_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274971_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AB274972_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
EU239221_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161755_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161756_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161758_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161761_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161763_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161766_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161770_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161772_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161773_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161774_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161777_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161780_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161786_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161787_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161791_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161793_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161794_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161795_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161798_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161800_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161802_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161804_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161819_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161826_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161827_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161829_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161830_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161832_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161835_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363588_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
JQ000008_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736895_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736896_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KX186584_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MH580638_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507845_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962191_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962193_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962194_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962196_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962199_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
ON528578_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
LT623848_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN545823_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161811_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KT749841_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594756_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161816_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FN594763_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
HM363577_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580621_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580625_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580637_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580647_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
KU736905_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736906_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736907_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736908_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736912_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736913_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
X75657_HBx_P-E        MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494704_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494715_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494696_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494700_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
ON093163_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPADHG
AM494709_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363569_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736901_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776737_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494708_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494713_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494717_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN967529_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
AM494714_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
AY738145_HBx_C-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
AY738146_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
DQ060828_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
DQ060829_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MW679682_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
MW926561_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSPSAVPADHG
GQ161815_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
FJ349238_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MH580631_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MH580632_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MH580652_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
HM363571_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363572_HBx_P-E      MAARLCCQLDPTRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW455161_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161808_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161769_HBx_P-E      MAARMCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161779_HBx_P-E      MAARMCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161784_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161789_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161828_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962197_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962195_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPAVHG
GQ161792_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPISGSLGDLSSPSLSAVPSDHG
GQ161824_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MW455163_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161799_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161805_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161818_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
GQ161821_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MZ962190_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507847_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPANHG
MN507846_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MN507848_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363581_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363580_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MT426115_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
HM363583_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPLGDLSSPSPSAVPADHG
HQ700552_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KF849713_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849721_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
MN507841_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
ON402784_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGGLSSPSPSAVPADHG
KF849722_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGGLSSPSPSAVPADHG
MW679683_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPLSGSLGGLSSPSPSAVPADHG
KF922439_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
KT192626_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPLSGSLGDLSSPSPSAVPADHG
KU736900_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776678_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
KU736898_HBx_P-E      MAARLCCQLDPSRDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MF772357_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776799_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776798_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
MG776744_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580615_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580616_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580618_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580619_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580620_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580623_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580651_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGDLSSPSPTAVPADHG
MH580628_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGDLSSPSPSAVPADHG
MH580629_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580646_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580649_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSPGDLSSPSPSAVPAVHG
MH580635_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580636_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLGGLSSPSPSAVPADHG
MH580641_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGSLRDLSSPSPSAVPADHG
MK720632_HBx_P-E      MAARLCCQLDPARDVLCLRPVSAEPCGRPVSGSLGDLSSPSPSAVPADHG
MW455164_HBx_P-E      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGDLSSPSPSAVPADHG
                      *.**: *:*   **** :**:  :   * .      . * . : :.   *

KM606739_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB091255_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB091256_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB106564_HBx_C-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRILPKVLHKRTLGL
AB194947_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB194948_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB201287_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB201289_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB201290_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGL
AB205129_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB205188_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLYKRTLGL
AB205189_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPRVLHKRTLGL
AB205190_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
AB205191_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB205192_HBx_P-E      AHLYLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB219529_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQPLPKVLHKRTLGL
AB219534_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274969_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274970_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLHKRTLGL
AB274973_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274974_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274975_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274976_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKALHKRTLGL
AB274977_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274978_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274979_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274980_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRSLPKVLHKRTLGL
AB274981_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274982_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274984_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
AB274985_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB915175_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB915176_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB915177_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
AB915178_HBx_P-E      AHVSLRRLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB915180_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVSAHQILPKVLYKRTLGL
AM494689_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
AM494690_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494691_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETPVNAHKILPKVLHKRTLGL
AM494692_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
AM494693_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494694_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494695_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
AM494697_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
AM494698_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494699_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494701_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGL
AM494702_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494703_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
AM494705_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHKILPKVLHKRTLGL
AM494706_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
AM494707_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGL
AM494710_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
AM494711_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494712_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
AM494832_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AY738144_HBx_P-E      AHLSVRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AY738147_HBx_P-E      AHLSVRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AY739674_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHQILPKVLHKRTLGL
AY739675_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHQILPKVLHKRTLGL
AY935700_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
DQ060822_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
DQ060823_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
DQ060824_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
DQ060825_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
DQ060826_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
DQ060827_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
DQ060830_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
EU239217_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
EU239219_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHKILPKVLHKRTLGL
EU239220_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHQSLPKVLHKRTLGL
EU239222_HBx_P-E      AHLSLRSLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
EU239223_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
EU239224_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
EU239226_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FJ349226_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
FJ349227_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FJ349237_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FJ349239_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FJ349240_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
FN545821_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FN545822_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVSAHQSLPKVLHKRTLGL
FN545827_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
FN545841_HBx_P-E      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
FN545842_HBx_P-E      AHLSLRGLPXCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
FN594748_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQXLPKVLHKRTLGL
FN594749_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FN594750_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGL
FN594751_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQXLPKVLYKRTIGL
FN594752_HBx_P-E      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
FN594753_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLYKRTLGL
FN594758_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
FN594759_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
FN594760_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
FN594761_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FN594762_HBx_P-E      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FN594765_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQSLPKVLHKRTLGL
FN594766_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
GQ161757_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161759_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGL
GQ161760_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161762_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161764_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161765_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161768_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
GQ161771_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161775_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
GQ161776_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161778_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161781_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161782_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161783_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161785_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161790_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHLILPKVLHKRTLGL
GQ161796_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161797_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLHKRTLGL
GQ161801_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQMLPKVLHKRTLGL
GQ161803_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
GQ161807_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHTILPKVLHKRTLGL
GQ161810_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161812_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161814_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161817_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161820_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161822_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
GQ161823_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQSLPKVLHKRTLGL
GQ161825_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161831_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161833_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
GQ161834_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161836_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363565_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTFARRMETTVNAHQILPKVLHKRTLGL
HM363566_HBx_P-E      SHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363568_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
HM363570_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363573_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363574_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRILPKVLHKRTLGL
HM363575_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETSVNAHQILPKVLHKRTLGL
HM363576_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363578_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETIVNAHQILPKVLYKRTLGL
HM363579_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363582_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363584_HBx_P-E      AHLSLRGLPVWGFSSAGPCALPFTSARRMETTVNAHQILPKVLHKRTLGL
HM363586_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTVGL
HM363587_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARSMETTVNAHQILPKVLHKRTLGL
HM363589_HBx_P-E      AHLSLRGLPVCGFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363590_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHQILPKVLHKRTLGL
HM363591_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
HM363592_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363593_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
HM363594_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363596_HBx_P-E      AHLSLPGLPVWGFSSGGPGGLRFTSGRHMETTVNAQQILPKVLHKRTLGL
HM363597_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETIVNAHQLLAKGLYKRTLGL
HM363598_HBx_P-E      AHLSLRGLPVCAFSSAGPCGLRFTSARRMETIVNAPQILAKGLHKRTLGL
HM363599_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363600_HBx_P-E      AHLSLPGLPVCAFSSAGPCALRFTSARRMETTVNAHQCLPKVLHKRTLGL
HM363603_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSPRRMETTVNAHQSLPKVLHKRTLGL
HM363605_HBx_P-E      AHLSLRGLPVCALSSNGPCALRFTFPRRMETTVNAHQLLPKVLYKRTLGL
HM363606_HBx_P-E      AHLSLRGLPVCALSSAGPCALRFTSPRRMETTVNAHQLSPKVGHKRTLGL
HM363608_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKGLHKRTLGL
HM363609_HBx_P-E      AHLSLRGLPVCAFSSAAPCALRFTSARRMETTVNAHLILPKVLHKRTLGL
HM363611_HBx_P-E      AHLSLRGLPVCGFTSAGPWGLPFTSARLMAPTVNAHQSLAKVLHKRTLGL
HQ700550_HBx_P-E      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HQ700551_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
JQ000009_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
JQ272902_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNARQILPKVLHKRTLGL
KF170741_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF170742_HBx_P-E      AHLSLRGLPVCXFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849714_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849715_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849716_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849717_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849718_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHNRTLGL
KF849719_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849720_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849723_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARCMETTVNAHQILPKVLHKRTLGL
KF849724_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849725_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQSLPKVLHKRTLGL
KF849726_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSTRRMETTVTAHQILPKVLHKRTLGL
KF849727_HBx_P-E      AYLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHHVLPKVLHKRTLGL
KF849728_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
KF922438_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KM606738_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KR811564_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQXLPKVLHKRTLGL
KR811565_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KR811571_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KR811574_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KR811894_HBx_P-E      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
KR811897_HBx_P-E      AHLSLHGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
KR811898_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQCLPKVLYKRTLGL
KR811906_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHHILPKVLYKRTLGL
KR811907_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHHILPKVLYKRTLGL
KU736891_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736892_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLXKRTLGL
KU736893_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736894_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736897_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736899_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHHILPKVLHKRTLGL
KU736902_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736903_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHRILPKVLHKRTLGL
KU736904_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHRXLPKVLHKRTLGL
KU736909_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736910_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736911_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
LT623842_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
LT623843_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLHKRTLGL
LT623844_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLXKRTLGL
LT623845_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQXLPKVLHKRTLGL
LT623846_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
LT623847_HBx_P-E      AHLSLRGLPVCAFSXAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
LT623849_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
LT623850_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNTHQILPKVLHKRTLGL
LT623851_HBx_P-E      AHLSLRGLPVCAFSXAGPCALRFTSVRRMETTVNAHQFLPKVLHKRTLGL
MF772354_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MF772355_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLHKRTLGL
MF772356_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MF772358_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMEATVNAHQILPKVLYKRTLGL
MF772359_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNARQILPKVLHKRTLGL
MF772360_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MF772361_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MF772362_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776403_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776426_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776427_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MG776503_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776512_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776534_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MG776550_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776729_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGL
MG776734_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MG776745_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776772_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MG776797_HBx_P-E      AHLSLRGLPVCACSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776800_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVSAHQLLPKVLYKRTLGL
MH464856_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580614_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580617_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580622_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580624_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580626_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRLLPKVLHKRTLGL
MH580630_HBx_P-E      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580633_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MH580634_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580640_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580644_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580645_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRVTSARRMETTVNAHQILPKVLHKRTLGL
MH580648_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580650_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH918655_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MK321264_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETPVNARQILPKVLHKRTLGL
MK720631_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETPVNARQILPKVLHKRTLGL
MN507840_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MN507843_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MN507844_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MN967526_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGL
MN967527_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MN967528_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MT570162_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MT570163_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MT570164_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRTETTVNAHQILPKVLHKRTLGL
MW082636_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQMLPKVLHKRTLGL
MW455162_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW455165_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW926548_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW926549_HBx_P-E      ANLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW926550_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRLTSARRMETTVNAHQILPKVLHKRTLGL
MW926551_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW926552_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW926554_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTXGL
MW926555_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLYKRTLGL
MW926556_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW926557_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW926558_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW926559_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLHKRTLGL
MW926560_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMEATVNAHQILPKVLYKRTLGL
MW926562_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTIGL
MW926563_HBx_P-E      AHLSLRGLPVCAFSXAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW926564_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGL
MW926565_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MW926566_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MZ962189_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MZ962192_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MZ962198_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
OL362103_HBx_P-E      AHLSLXGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
OL362105_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
OM256457_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
ON402785_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MN507842_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHRILPKVLHKRTLGL
AB201288_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274971_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AB274972_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
EU239221_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161755_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161756_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161758_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161761_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161763_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161766_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161770_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161772_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161773_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161774_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161777_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161780_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161786_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161787_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161791_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161793_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161794_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161795_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161798_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161800_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161802_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161804_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161819_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161826_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161827_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161829_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161830_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161832_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161835_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363588_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
JQ000008_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736895_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736896_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KX186584_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580638_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MN507845_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MZ962191_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MZ962193_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MZ962194_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MZ962196_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MZ962199_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
ON528578_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
LT623848_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQFLPKVLHKRTLGL
FN545823_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161811_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KT749841_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FN594756_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161816_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FN594763_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363577_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580621_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580625_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580637_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580647_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736905_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736906_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736907_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736908_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736912_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736913_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
X75657_HBx_P-E        AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494704_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494715_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494696_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494700_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
ON093163_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494709_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
HM363569_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
KU736901_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MG776737_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
AM494708_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494713_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494717_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MN967529_HBx_P-E      AHLSLRGLPVCSFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AM494714_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
AY738145_HBx_C-E      AHLSVRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
AY738146_HBx_P-E      AHLSVRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
DQ060828_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
DQ060829_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW679682_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW926561_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161815_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
FJ349238_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580631_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580632_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580652_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363571_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
HM363572_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MW455161_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQVLPKVLHKRTLGL
GQ161808_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161769_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161779_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161784_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161789_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161828_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MZ962197_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MZ962195_HBx_P-E      AHLSLRGLPVCAYSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161792_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161824_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW455163_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
GQ161799_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHLILPKVLHKRTLGL
GQ161805_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHLILPKVLHKRTLGL
GQ161818_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHLILPKVLHKRTLGL
GQ161821_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHLILPKVLHKRTLGL
MZ962190_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MN507847_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MN507846_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MN507848_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363581_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363580_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MT426115_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HM363583_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
HQ700552_HBx_P-E      AHLSLRGLPICAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849713_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849721_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MN507841_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
ON402784_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF849722_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MW679683_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KF922439_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KT192626_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736900_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776678_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
KU736898_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MF772357_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MG776799_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776798_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MG776744_HBx_P-E      AHLSLRGLPVCAFSPAGPCALRFTSARRMETTVNAHQILPKVLYKRTLGL
MH580615_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580616_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580618_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580619_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580620_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580623_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580651_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580628_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MH580629_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580646_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580649_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580635_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580636_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
MH580641_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQLLPKVLHKRTLGL
MK720632_HBx_P-E      AHLSLRGLPVCTFSSAGPCALRFTSARRMETPVNARQILPKVLHKRTLGL
MW455164_HBx_P-E      AHLSLRGLPVCAFSSAGPCALRFTSARRMETTVNAHQILPKVLHKRTLGL
                      : : :  **    :  .* .* .*  *   . *.:    .:   :** **

KM606739_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRLKFLCSPAPCNF
AB091255_HBx_P-E      SAMSTTDLEAYFKACLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNF
AB091256_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNF
AB106564_HBx_C-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB194947_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNF
AB194948_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLQVFVLGGCRHKLVCAPSPCNF
AB201287_HBx_P-E      CAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB201289_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB201290_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB205129_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB205188_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLQVFVLGGCRHKLVCAPAPCNF
AB205189_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNF
AB205190_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLQVFVLGGCRHKLVCAPAPCNF
AB205191_HBx_P-E      SAMSTTDLEAYFKDCVFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB205192_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB219529_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLLIFVLGDCRHKLVCAPAPCNF
AB219534_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPSPCNF
AB274969_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNF
AB274970_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB274973_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
AB274974_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNF
AB274975_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPSPCNF
AB274976_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB274977_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB274978_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPSPCNF
AB274979_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNF
AB274980_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLQVFVLGGCRHKLVCAPAPCNF
AB274981_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNF
AB274982_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB274984_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCVPAPCNF
AB274985_HBx_P-E      SAMSTTGLEAYFKDCVFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
AB915175_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB915176_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
AB915177_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB915178_HBx_P-E      SAMSTTDLEAYFKDCVFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
AB915180_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
AM494689_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPCNF
AM494690_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494691_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEELRLMIFVLGGCRHKLVCAPAPCNF
AM494692_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEESRLMIFVLGGCRHKLVCAPAPCNF
AM494693_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494694_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494695_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
AM494697_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494698_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPCNF
AM494699_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494701_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494702_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494703_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494705_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494706_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494707_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494710_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494711_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
AM494712_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494832_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AY738144_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AY738147_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNF
AY739674_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCVPAPCNF
AY739675_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCVPAPCNF
AY935700_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
DQ060822_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
DQ060823_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
DQ060824_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
DQ060825_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
DQ060826_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
DQ060827_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
DQ060830_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
EU239217_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
EU239219_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
EU239220_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCVPAPCNF
EU239222_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPTPCNF
EU239223_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
EU239224_HBx_P-E      AAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
EU239226_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
FJ349226_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
FJ349227_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
FJ349237_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
FJ349239_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
FJ349240_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPPPCNF
FN545821_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
FN545822_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
FN545827_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEESRLMIFVLGGCRHKXVCAPAPCNF
FN545841_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
FN545842_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCBF
FN594748_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLRLFVLGGCRHKLVCAPAPCNF
FN594749_HBx_P-E      SGMSTTVLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNF
FN594750_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
FN594751_HBx_P-E      SAMSTTGLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
FN594752_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
FN594753_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEXRLKXFVLGGCRHKLVCAPAPCNF
FN594758_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPCNF
FN594759_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEISLKVFVLGGCRHKLVCAPAPCNF
FN594760_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEELRLKVFVLGGCRHKLVCAPAPCNF
FN594761_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
FN594762_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
FN594765_HBx_P-E      SXMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCVPAPCNF
FN594766_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161757_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNF
GQ161759_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161760_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161762_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161764_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161765_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161768_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
GQ161771_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161775_HBx_P-E      SAMSTTDLEAYFKDCVFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
GQ161776_HBx_P-E      YAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161778_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161781_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCIF
GQ161782_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161783_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161785_HBx_P-E      SALSTTDLEAYFKDCLFKDWEELGEEIRLMVFVLGGCRHKLVCAPAPCNF
GQ161790_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161796_HBx_P-E      SAMSTTDLEAYFKECLFKDWEELGEEIRLQVFVLGGCRHKLVCAPAPCNF
GQ161797_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPRNF
GQ161801_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161803_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161807_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161810_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVIVLGGCRHKLVCAPAPCNF
GQ161812_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLTVFVLGGCRHKLVCAPAPCNF
GQ161814_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161817_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161820_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161822_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVYVLGGCRHKLVCAPAPCNF
GQ161823_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
GQ161825_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161831_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
GQ161833_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161834_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
GQ161836_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363565_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363566_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363568_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363570_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363573_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363574_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363575_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNF
HM363576_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363578_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNF
HM363579_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363582_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNF
HM363584_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363586_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363587_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363589_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363590_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363591_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363592_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363593_HBx_P-E      LAMSTTDLEAYFKDCLFKDWEELGEESRLKVFVLGGCRHKLVCAPAPCNF
HM363594_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363596_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363597_HBx_P-E      SGMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363598_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNF
HM363599_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363600_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363603_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363605_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363606_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNF
HM363608_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363609_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNF
HM363611_HBx_P-E      SAMSTTDLEGYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HQ700550_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
HQ700551_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNF
JQ000009_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
JQ272902_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNF
KF170741_HBx_P-E      SAMSTTVLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF170742_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849714_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849715_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCYF
KF849716_HBx_P-E      SAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCALAPCNF
KF849717_HBx_P-E      SAMSTTDLEAYFKDCLFKNWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849718_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849719_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849720_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEDLGEETRLMIFVLGGCRHKLVCAPAPCNF
KF849723_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849724_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCPPAPCNF
KF849725_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
KF849726_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849727_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849728_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
KF922438_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
KM606738_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
KR811564_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCXPPPCNF
KR811565_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPPPCNF
KR811571_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPPPCNF
KR811574_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPPPCNF
KR811894_HBx_P-E      YAMSTTDLEAYFKDCLFKDWEELGEVTRLMIYVLGGCRHKLVCAPPPCNF
KR811897_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEENRLMIFVLGGCRHKLVCAPPPCNF
KR811898_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPPPCNF
KR811906_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEVTRLMIFVLGGCRHKLVCAPPPCNF
KR811907_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEVTRLMIFVLGGCRHKLVCAPPPCNF
KU736891_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
KU736892_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
KU736893_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736894_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736897_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736899_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736902_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736903_HBx_P-E      STMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCVPAPCNF
KU736904_HBx_P-E      STMSTTDLEAYFKDCLFKDWEESGEEXRLKVFVLGGCRHKLVCVPAPCNF
KU736909_HBx_P-E      STMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
KU736910_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736911_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
LT623842_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNF
LT623843_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
LT623844_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEEXGEEIRLMIFVLGGCRHKLVCAPAPCNF
LT623845_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
LT623846_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
LT623847_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
LT623849_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVXVLGGCRHKLVCAPSPCNF
LT623850_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
LT623851_HBx_P-E      SAMSTSDLEAYFKDCLFKDWEELGEEXRLMIFVLGGCRHKLVCAPAPCNF
MF772354_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIKLSVIVWGGCRHKLVXXXXXCNF
MF772355_HBx_P-E      SAMSTTDLEAYFRDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
MF772356_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNF
MF772358_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEESRLMIYVLGGCRHKLVCAPAPCNF
MF772359_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHNLVCAPAPCFF
MF772360_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
MF772361_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MF772362_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MG776403_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPSPCNF
MG776426_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
MG776427_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMMFVLGGCRHKLVCAPAPCNF
MG776503_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGRRHKLVCSPAPCNF
MG776512_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MG776534_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMTFVLGGCRHKLVCAPAPCNF
MG776550_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MG776729_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
MG776734_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEELRLKVFVLGGCRHKLVCAPAPCNF
MG776745_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEELRLKVFVLGGCRHKLVCAPSPCNF
MG776772_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCHF
MG776797_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEELRLKVFVLGGCRHKLVCAPAPCNF
MG776800_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEETRLMIFVLGGCRHKLVCAPAPCNF
MH464856_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580614_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580617_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580622_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNF
MH580624_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580626_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
MH580630_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580633_HBx_P-E      SAMSTTDLEAYFKNCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
MH580634_HBx_P-E      SAMSTTDLEAYFKNCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580640_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580644_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580645_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580648_HBx_P-E      SAMSTTDLEAYFKDCLLKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580650_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH918655_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MK321264_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEEFGEEIRLKVFVLGGCRHKLVCAPAPCNF
MK720631_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MN507840_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
MN507843_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKIFVLGGCRHKLVCAPAPCNF
MN507844_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MN967526_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
MN967527_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCAPAPCNF
MN967528_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCVPAPCNF
MT570162_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNF
MT570163_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MT570164_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW082636_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEESRLMIFVLGGCRHKLVCAPAPCNF
MW455162_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW455165_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW926548_HBx_P-E      SAMSTTVLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPVPCNF
MW926549_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPSPCNF
MW926550_HBx_P-E      SAMSTTDLEAYFKDCLFKEWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW926551_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
MW926552_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPSPCNF
MW926554_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMIFVLGGCRHKLVCVPAPCNF
MW926555_HBx_P-E      SAMSTTDLEAYFKDCLFKNWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW926556_HBx_P-E      SAMSTKDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW926557_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW926558_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPSPCNF
MW926559_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW926560_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW926562_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLMIFVLGGCRHKLVCAPAPCNF
MW926563_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEMRLKVFVLGGCRHKLVCAPAPCNF
MW926564_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
MW926565_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKIFVLGGCRHKLVCAPTPCNF
MW926566_HBx_P-E      PAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNF
MZ962189_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MZ962192_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVIVLGGCRHKLVCAPAPCNF
MZ962198_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCIF
OL362103_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLKVFVLGGCRHKLVCAPAPCNF
OL362105_HBx_P-E      SAISTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
OM256457_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
ON402785_HBx_P-E      SAMSTTDLEANFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCPPAPCNF
MN507842_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB201288_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPSPCNF
AB274971_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AB274972_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
EU239221_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161755_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161756_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161758_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161761_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161763_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161766_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161770_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161772_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161773_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161774_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161777_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161780_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161786_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161787_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161791_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161793_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161794_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161795_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161798_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161800_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161802_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161804_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161819_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161826_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161827_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161829_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161830_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161832_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161835_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363588_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
JQ000008_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736895_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736896_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KX186584_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580638_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MN507845_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MZ962191_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MZ962193_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MZ962194_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MZ962196_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MZ962199_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
ON528578_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
LT623848_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
FN545823_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
GQ161811_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
KT749841_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLMIFVLGGCRHKLVCAPAPCNF
FN594756_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNF
GQ161816_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCVPAPCNF
FN594763_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363577_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580621_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580625_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580637_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580647_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736905_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736906_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736907_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736908_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736912_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736913_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
X75657_HBx_P-E        SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494704_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494715_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494696_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494700_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
ON093163_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494709_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363569_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736901_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MG776737_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494708_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494713_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494717_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MN967529_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AM494714_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
AY738145_HBx_C-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
AY738146_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
DQ060828_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
DQ060829_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW679682_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW926561_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161815_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
FJ349238_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580631_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580632_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580652_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363571_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363572_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW455161_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161808_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161769_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161779_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161784_HBx_P-E      YAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161789_HBx_P-E      YAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161828_HBx_P-E      YAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MZ962197_HBx_P-E      YAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MZ962195_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161792_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161824_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW455163_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161799_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161805_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161818_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
GQ161821_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MZ962190_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MN507847_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MN507846_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MN507848_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
HM363581_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363580_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
MT426115_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEETRLKVFVLGGCRHKLVCAPAPCNF
HM363583_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRSKVFVLGGCRHKLVCAPAPCNF
HQ700552_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849713_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849721_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MN507841_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
ON402784_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF849722_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW679683_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
KF922439_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
KT192626_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLMIFVLGGCRHKLVCAPAPCNF
KU736900_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MG776678_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
KU736898_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MF772357_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEELRLQVFVLGGCRHKLVCAPAPCNF
MG776799_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPSPCNF
MG776798_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MG776744_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLMTFVLGGCRHKLVCAPAPCNF
MH580615_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580616_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580618_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580619_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580620_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580623_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580651_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580628_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580629_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580646_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580649_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580635_HBx_P-E      SAMSTTDLEAYFKNCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580636_HBx_P-E      SAMSTTDLEAYFKNCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
MH580641_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MK720632_HBx_P-E      SAMSTTDLEAYFKDCLFKDWEESGEEIRLKVFVLGGCRHKLVCAPAPCNF
MW455164_HBx_P-E      SVMSTTDLEAYFKDCLFKDWEELGEEIRLKVFVLGGCRHKLVCAPAPCNF
                        :**. **. *: *::*:**: **       * *. * : :       *

KM606739_HBx_P-E      FTSA
AB091255_HBx_P-E      FTSA
AB091256_HBx_P-E      FTSA
AB106564_HBx_C-E      LTSA
AB194947_HBx_P-E      FTSA
AB194948_HBx_P-E      FTSA
AB201287_HBx_P-E      FTSA
AB201289_HBx_P-E      FTSA
AB201290_HBx_P-E      FTSA
AB205129_HBx_P-E      FTSA
AB205188_HBx_P-E      FTSA
AB205189_HBx_P-E      FTSA
AB205190_HBx_P-E      FTSA
AB205191_HBx_P-E      FTSA
AB205192_HBx_P-E      FTSA
AB219529_HBx_P-E      FTSA
AB219534_HBx_P-E      FTSA
AB274969_HBx_P-E      FTSA
AB274970_HBx_P-E      FTSA
AB274973_HBx_P-E      FTSA
AB274974_HBx_P-E      FTSA
AB274975_HBx_P-E      FTSA
AB274976_HBx_P-E      FTSA
AB274977_HBx_P-E      FTSA
AB274978_HBx_P-E      FTSA
AB274979_HBx_P-E      FTSA
AB274980_HBx_P-E      FTSA
AB274981_HBx_P-E      FTSA
AB274982_HBx_P-E      FTSA
AB274984_HBx_P-E      FTSA
AB274985_HBx_P-E      FTSA
AB915175_HBx_P-E      FTSA
AB915176_HBx_P-E      FTSA
AB915177_HBx_P-E      FTSA
AB915178_HBx_P-E      FTSA
AB915180_HBx_P-E      FTSA
AM494689_HBx_P-E      FTSA
AM494690_HBx_P-E      FTSA
AM494691_HBx_P-E      FTSA
AM494692_HBx_P-E      FTSA
AM494693_HBx_P-E      FTSA
AM494694_HBx_P-E      FTSA
AM494695_HBx_P-E      FTSA
AM494697_HBx_P-E      FTSA
AM494698_HBx_P-E      FTSA
AM494699_HBx_P-E      FTSA
AM494701_HBx_P-E      FTSA
AM494702_HBx_P-E      FTSA
AM494703_HBx_P-E      FTSA
AM494705_HBx_P-E      FTSA
AM494706_HBx_P-E      FTSA
AM494707_HBx_P-E      FTSA
AM494710_HBx_P-E      FTSA
AM494711_HBx_P-E      FTSA
AM494712_HBx_P-E      FTSA
AM494832_HBx_P-E      FTSA
AY738144_HBx_P-E      FTSA
AY738147_HBx_P-E      FTSA
AY739674_HBx_P-E      FTSA
AY739675_HBx_P-E      FTSA
AY935700_HBx_P-E      FTSA
DQ060822_HBx_P-E      LTSA
DQ060823_HBx_P-E      LTSA
DQ060824_HBx_P-E      FTSA
DQ060825_HBx_P-E      FTSA
DQ060826_HBx_P-E      FTSA
DQ060827_HBx_P-E      FTSA
DQ060830_HBx_P-E      LTSA
EU239217_HBx_P-E      FTSA
EU239219_HBx_P-E      FTSA
EU239220_HBx_P-E      FTSA
EU239222_HBx_P-E      FTSA
EU239223_HBx_P-E      FTSA
EU239224_HBx_P-E      FTSA
EU239226_HBx_P-E      FTSA
FJ349226_HBx_P-E      FTSA
FJ349227_HBx_P-E      FTSA
FJ349237_HBx_P-E      FTSA
FJ349239_HBx_P-E      FTSA
FJ349240_HBx_P-E      FTSA
FN545821_HBx_P-E      FTSA
FN545822_HBx_P-E      FTSA
FN545827_HBx_P-E      FTSA
FN545841_HBx_P-E      FTSA
FN545842_HBx_P-E      FTSA
FN594748_HBx_P-E      FTSA
FN594749_HBx_P-E      FTSA
FN594750_HBx_P-E      FTSA
FN594751_HBx_P-E      FTSA
FN594752_HBx_P-E      FTSA
FN594753_HBx_P-E      FTSA
FN594758_HBx_P-E      FTSA
FN594759_HBx_P-E      FTSA
FN594760_HBx_P-E      FTSA
FN594761_HBx_P-E      FTSA
FN594762_HBx_P-E      FTSA
FN594765_HBx_P-E      FTSA
FN594766_HBx_P-E      FTSA
GQ161757_HBx_P-E      FTSA
GQ161759_HBx_P-E      FTSA
GQ161760_HBx_P-E      FTSA
GQ161762_HBx_P-E      FTSA
GQ161764_HBx_P-E      FTSA
GQ161765_HBx_P-E      FTSA
GQ161768_HBx_P-E      FTSA
GQ161771_HBx_P-E      FTSA
GQ161775_HBx_P-E      FTSA
GQ161776_HBx_P-E      FTSA
GQ161778_HBx_P-E      FTSA
GQ161781_HBx_P-E      FTSA
GQ161782_HBx_P-E      FTSA
GQ161783_HBx_P-E      FTSA
GQ161785_HBx_P-E      FTSA
GQ161790_HBx_P-E      FTSA
GQ161796_HBx_P-E      FTSA
GQ161797_HBx_P-E      FTSA
GQ161801_HBx_P-E      FTSA
GQ161803_HBx_P-E      FTSA
GQ161807_HBx_P-E      FTSA
GQ161810_HBx_P-E      FTSA
GQ161812_HBx_P-E      FTSA
GQ161814_HBx_P-E      FTSA
GQ161817_HBx_P-E      FTSA
GQ161820_HBx_P-E      FTSA
GQ161822_HBx_P-E      FTSA
GQ161823_HBx_P-E      FTSA
GQ161825_HBx_P-E      FTSA
GQ161831_HBx_P-E      FTSA
GQ161833_HBx_P-E      FTSA
GQ161834_HBx_P-E      FTSA
GQ161836_HBx_P-E      FTSA
HM363565_HBx_P-E      FTSA
HM363566_HBx_P-E      FTSA
HM363568_HBx_P-E      FTSA
HM363570_HBx_P-E      FTSA
HM363573_HBx_P-E      FTSA
HM363574_HBx_P-E      FTSA
HM363575_HBx_P-E      FTSA
HM363576_HBx_P-E      FTSA
HM363578_HBx_P-E      FTSA
HM363579_HBx_P-E      FTSA
HM363582_HBx_P-E      FTSA
HM363584_HBx_P-E      FTSA
HM363586_HBx_P-E      FTSA
HM363587_HBx_P-E      FTSA
HM363589_HBx_P-E      FTSA
HM363590_HBx_P-E      FTSA
HM363591_HBx_P-E      FTSA
HM363592_HBx_P-E      FTSA
HM363593_HBx_P-E      FTSA
HM363594_HBx_P-E      FTSA
HM363596_HBx_P-E      FTSA
HM363597_HBx_P-E      FTSA
HM363598_HBx_P-E      FTSA
HM363599_HBx_P-E      FTSA
HM363600_HBx_P-E      FTSA
HM363603_HBx_P-E      FTSA
HM363605_HBx_P-E      FTSA
HM363606_HBx_P-E      FTSA
HM363608_HBx_P-E      FTSA
HM363609_HBx_P-E      FTSA
HM363611_HBx_P-E      FTSA
HQ700550_HBx_P-E      FTSA
HQ700551_HBx_P-E      FTSA
JQ000009_HBx_P-E      FTSA
JQ272902_HBx_P-E      FTSA
KF170741_HBx_P-E      FTPA
KF170742_HBx_P-E      FTSA
KF849714_HBx_P-E      FTSA
KF849715_HBx_P-E      FTSA
KF849716_HBx_P-E      FTSA
KF849717_HBx_P-E      LTSA
KF849718_HBx_P-E      FTSA
KF849719_HBx_P-E      FTSA
KF849720_HBx_P-E      FTSA
KF849723_HBx_P-E      FTSA
KF849724_HBx_P-E      FTSA
KF849725_HBx_P-E      FTSA
KF849726_HBx_P-E      FTSA
KF849727_HBx_P-E      FTSA
KF849728_HBx_P-E      FTSA
KF922438_HBx_P-E      FTSA
KM606738_HBx_P-E      FTSA
KR811564_HBx_P-E      L---
KR811565_HBx_P-E      L---
KR811571_HBx_P-E      L---
KR811574_HBx_P-E      L---
KR811894_HBx_P-E      L---
KR811897_HBx_P-E      L---
KR811898_HBx_P-E      L---
KR811906_HBx_P-E      L---
KR811907_HBx_P-E      L---
KU736891_HBx_P-E      FTSA
KU736892_HBx_P-E      FTSA
KU736893_HBx_P-E      FTSA
KU736894_HBx_P-E      FTSA
KU736897_HBx_P-E      FTSA
KU736899_HBx_P-E      FTSA
KU736902_HBx_P-E      FTSA
KU736903_HBx_P-E      FTSA
KU736904_HBx_P-E      FTSA
KU736909_HBx_P-E      FTSA
KU736910_HBx_P-E      FTSA
KU736911_HBx_P-E      FTSA
LT623842_HBx_P-E      FTSA
LT623843_HBx_P-E      FTSA
LT623844_HBx_P-E      FTSA
LT623845_HBx_P-E      FTSA
LT623846_HBx_P-E      FTSA
LT623847_HBx_P-E      FTSA
LT623849_HBx_P-E      FTSA
LT623850_HBx_P-E      FTSA
LT623851_HBx_P-E      FTSA
MF772354_HBx_P-E      FTSA
MF772355_HBx_P-E      FTSA
MF772356_HBx_P-E      FTSA
MF772358_HBx_P-E      FTSA
MF772359_HBx_P-E      FTSA
MF772360_HBx_P-E      FTSA
MF772361_HBx_P-E      FTSA
MF772362_HBx_P-E      FTSA
MG776403_HBx_P-E      FTSA
MG776426_HBx_P-E      FTSA
MG776427_HBx_P-E      FTSA
MG776503_HBx_P-E      FTSA
MG776512_HBx_P-E      FTSA
MG776534_HBx_P-E      FTSA
MG776550_HBx_P-E      FTSA
MG776729_HBx_P-E      FTSA
MG776734_HBx_P-E      FTSA
MG776745_HBx_P-E      FTSA
MG776772_HBx_P-E      FTSA
MG776797_HBx_P-E      FTSA
MG776800_HBx_P-E      FTSA
MH464856_HBx_P-E      FTSA
MH580614_HBx_P-E      FTSA
MH580617_HBx_P-E      FTSA
MH580622_HBx_P-E      FTSA
MH580624_HBx_P-E      FTSA
MH580626_HBx_P-E      LTSA
MH580630_HBx_P-E      FTSA
MH580633_HBx_P-E      FTSA
MH580634_HBx_P-E      FTSA
MH580640_HBx_P-E      FTSA
MH580644_HBx_P-E      FTSA
MH580645_HBx_P-E      FTSA
MH580648_HBx_P-E      FTSA
MH580650_HBx_P-E      FTSA
MH918655_HBx_P-E      FTSA
MK321264_HBx_P-E      FTSA
MK720631_HBx_P-E      FTSA
MN507840_HBx_P-E      FTSA
MN507843_HBx_P-E      FTSA
MN507844_HBx_P-E      FTSA
MN967526_HBx_P-E      FTSA
MN967527_HBx_P-E      FTSA
MN967528_HBx_P-E      FTSA
MT570162_HBx_P-E      FT-S
MT570163_HBx_P-E      FT-S
MT570164_HBx_P-E      FT-S
MW082636_HBx_P-E      -SSA
MW455162_HBx_P-E      FTSA
MW455165_HBx_P-E      FTSA
MW926548_HBx_P-E      FTSA
MW926549_HBx_P-E      FTSA
MW926550_HBx_P-E      FTSA
MW926551_HBx_P-E      FTSA
MW926552_HBx_P-E      FTSA
MW926554_HBx_P-E      FTSA
MW926555_HBx_P-E      FTSA
MW926556_HBx_P-E      FTSA
MW926557_HBx_P-E      FTSA
MW926558_HBx_P-E      FTSA
MW926559_HBx_P-E      FTSA
MW926560_HBx_P-E      FTSA
MW926562_HBx_P-E      FTSA
MW926563_HBx_P-E      FTSA
MW926564_HBx_P-E      FTSA
MW926565_HBx_P-E      FTSA
MW926566_HBx_P-E      FTSA
MZ962189_HBx_P-E      FTSA
MZ962192_HBx_P-E      FTSA
MZ962198_HBx_P-E      FTSA
OL362103_HBx_P-E      FTSA
OL362105_HBx_P-E      FTSA
OM256457_HBx_P-E      FTSA
ON402785_HBx_P-E      FTSA
MN507842_HBx_P-E      LTSA
AB201288_HBx_P-E      FTSA
AB274971_HBx_P-E      FTSA
AB274972_HBx_P-E      FTSA
EU239221_HBx_P-E      FTSA
GQ161755_HBx_P-E      FTSA
GQ161756_HBx_P-E      FTSA
GQ161758_HBx_P-E      FTSA
GQ161761_HBx_P-E      FTSA
GQ161763_HBx_P-E      FTSA
GQ161766_HBx_P-E      FTSA
GQ161770_HBx_P-E      FTSA
GQ161772_HBx_P-E      FTSA
GQ161773_HBx_P-E      FTSA
GQ161774_HBx_P-E      FTSA
GQ161777_HBx_P-E      FTSA
GQ161780_HBx_P-E      FTSA
GQ161786_HBx_P-E      FTSA
GQ161787_HBx_P-E      FTSA
GQ161791_HBx_P-E      FTSA
GQ161793_HBx_P-E      FTSA
GQ161794_HBx_P-E      FTSA
GQ161795_HBx_P-E      FTSA
GQ161798_HBx_P-E      FTSA
GQ161800_HBx_P-E      FTSA
GQ161802_HBx_P-E      FTSA
GQ161804_HBx_P-E      FTSA
GQ161819_HBx_P-E      FTSA
GQ161826_HBx_P-E      FTSA
GQ161827_HBx_P-E      FTSA
GQ161829_HBx_P-E      FTSA
GQ161830_HBx_P-E      FTSA
GQ161832_HBx_P-E      FTSA
GQ161835_HBx_P-E      FTSA
HM363588_HBx_P-E      FTSA
JQ000008_HBx_P-E      FTSA
KU736895_HBx_P-E      FTSA
KU736896_HBx_P-E      FTSA
KX186584_HBx_P-E      FTSA
MH580638_HBx_P-E      FTSA
MN507845_HBx_P-E      FTSA
MZ962191_HBx_P-E      FTSA
MZ962193_HBx_P-E      FTSA
MZ962194_HBx_P-E      FTSA
MZ962196_HBx_P-E      FTSA
MZ962199_HBx_P-E      FTSA
ON528578_HBx_P-E      FTSA
LT623848_HBx_P-E      FTSA
FN545823_HBx_P-E      FTSA
GQ161811_HBx_P-E      FTSA
KT749841_HBx_P-E      FTSA
FN594756_HBx_P-E      FTSA
GQ161816_HBx_P-E      FTSA
FN594763_HBx_P-E      FTSA
HM363577_HBx_P-E      FTSA
MH580621_HBx_P-E      FTSA
MH580625_HBx_P-E      FTSA
MH580637_HBx_P-E      FTSA
MH580647_HBx_P-E      FTSA
KU736905_HBx_P-E      FTSA
KU736906_HBx_P-E      FTSA
KU736907_HBx_P-E      FTSA
KU736908_HBx_P-E      FTSA
KU736912_HBx_P-E      FTSA
KU736913_HBx_P-E      FTSA
X75657_HBx_P-E        FTSA
AM494704_HBx_P-E      FTSA
AM494715_HBx_P-E      FTSA
AM494696_HBx_P-E      FTSA
AM494700_HBx_P-E      FTSA
ON093163_HBx_P-E      FTSA
AM494709_HBx_P-E      FTSA
HM363569_HBx_P-E      FTSA
KU736901_HBx_P-E      FTSA
MG776737_HBx_P-E      FTSA
AM494708_HBx_P-E      FTSA
AM494713_HBx_P-E      FTSA
AM494717_HBx_P-E      FTSA
MN967529_HBx_P-E      FTSA
AM494714_HBx_P-E      FTSA
AY738145_HBx_C-E      FTSA
AY738146_HBx_P-E      FTSA
DQ060828_HBx_P-E      FTSA
DQ060829_HBx_P-E      FTSA
MW679682_HBx_P-E      FTSA
MW926561_HBx_P-E      FTSA
GQ161815_HBx_P-E      FTSA
FJ349238_HBx_P-E      FTSA
MH580631_HBx_P-E      FTSA
MH580632_HBx_P-E      FTSA
MH580652_HBx_P-E      FTSA
HM363571_HBx_P-E      FTSA
HM363572_HBx_P-E      FTSA
MW455161_HBx_P-E      FTSA
GQ161808_HBx_P-E      FTSA
GQ161769_HBx_P-E      FTSA
GQ161779_HBx_P-E      FTSA
GQ161784_HBx_P-E      FTSA
GQ161789_HBx_P-E      FTSA
GQ161828_HBx_P-E      FTSA
MZ962197_HBx_P-E      FTSA
MZ962195_HBx_P-E      FTSA
GQ161792_HBx_P-E      FTSA
GQ161824_HBx_P-E      FTSA
MW455163_HBx_P-E      FTSA
GQ161799_HBx_P-E      FTSA
GQ161805_HBx_P-E      FTSA
GQ161818_HBx_P-E      FTSA
GQ161821_HBx_P-E      FTSA
MZ962190_HBx_P-E      FTSA
MN507847_HBx_P-E      FTSA
MN507846_HBx_P-E      FTSA
MN507848_HBx_P-E      FTSA
HM363581_HBx_P-E      FTSA
HM363580_HBx_P-E      FTSA
MT426115_HBx_P-E      FTSA
HM363583_HBx_P-E      FTSA
HQ700552_HBx_P-E      FTSA
KF849713_HBx_P-E      FTSA
KF849721_HBx_P-E      FTSA
MN507841_HBx_P-E      FTSA
ON402784_HBx_P-E      FTSA
KF849722_HBx_P-E      FTSA
MW679683_HBx_P-E      FTSA
KF922439_HBx_P-E      FTSA
KT192626_HBx_P-E      FTSA
KU736900_HBx_P-E      FTSA
MG776678_HBx_P-E      FTSA
KU736898_HBx_P-E      FTSA
MF772357_HBx_P-E      FTSA
MG776799_HBx_P-E      FTSA
MG776798_HBx_P-E      FTSA
MG776744_HBx_P-E      FTSA
MH580615_HBx_P-E      FTSA
MH580616_HBx_P-E      FTSA
MH580618_HBx_P-E      FTSA
MH580619_HBx_P-E      FTSA
MH580620_HBx_P-E      FTSA
MH580623_HBx_P-E      FTSA
MH580651_HBx_P-E      FTSA
MH580628_HBx_P-E      FTSA
MH580629_HBx_P-E      FTSA
MH580646_HBx_P-E      FTSA
MH580649_HBx_P-E      FTSA
MH580635_HBx_P-E      FTSA
MH580636_HBx_P-E      FTSA
MH580641_HBx_P-E      FTSA
MK720632_HBx_P-E      FTSA
MW455164_HBx_P-E      FTSA
                          

© 1998-2024Centre National de la Recherche Scientifique logoInstitut national de la sante et de la recherche médicale logoUniversité de Lyon logoLegal notice