HBVdb

Dataset for protein HBc of genotype E

[Download (right click)] [Edit] [Sequences] [Repertoires]

648 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


GQ161825_HBc_P-E      MDLDPYKEFGATVELLSFLPGDFFPSVRDLLYTASALYRDALESPEHCSP
OK318680_HBc_P-E      MDIDPYKEFGASAELLSFLPADFFPSXRDLLDTAKALFQDALESPEHCTA
EU726953_HBc_P-E      MDIDPYKEFGASVQLLSFLPSDFFPSIRDLLDTAAALYRDALESPEHCSA
KP857055_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP856982_HBc_P-E      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCTP
MF772359_HBc_P-E      MDIDPYKELGATVELLSFLHNDFFPSLRDLLDTASALYRDALESPEHCSP
MF772356_HBc_P-E      MDIDPYKEFGASVELLSFLPPDFFPSVKDLLDTASALFRDALESGEHCSP
KF798305_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCTP
KP856998_HBc_P-E      MDIDPYKEFGATIELLSFLPSDFYPSVRDLLDTASALYREALESQDHCSP
AB915180_HBc_P-E      MDIDPYKEFGATVELISFLPSDFFPSVRDLLDTASALFRDALESSEHCSP
AB274977_HBc_P-E      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
AB274975_HBc_P-E      MDIDPYKEFGATVELLSFLPVDFYPSVRDLLDTASALFRDALQSPEHCSP
FN594749_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASTLYRDALESPPHCSP
MN507840_HBc_P-E      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSP
KM606739_HBc_P-E      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPVHVSP
KF849728_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
KF849725_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161801_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AY935700_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494703_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494800_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FN594752_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSS
LT623844_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161768_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FN594766_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALKSPEHCSP
FN594758_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSX
FN594760_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSX
FN594759_HBc_P-E      MDIDPYKEFGASVZLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSX
FN594761_HBc_P-E      MDIDPYKEFGAXXELLSFLPSDFFPSVRDLLDTASALCRGALESPEHCSP
GQ161831_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494791_HBc_P-E      MDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHWSP
AM494793_HBc_P-E      MDIDPHKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDAVESPEHWSP
HM363597_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCTH
AB219534_HBc_P-E      MDIDPYKEFGASVELLSFLPTDFFPSVRDLLDTASALFRDALESPEHCSP
AB219529_HBc_P-E      MDIDPYKEFGATLQLLSFLPGDFFPSVRDLLDTASALFRDALESPEHCTP
MH580645_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
GQ161786_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTGPALYRDALESPEHCTP
MH580648_HBc_P-E      MDIDPYKEFGATVELLSFLPPDFFPSVKDLLDTISALFRDALESPEHCSP
MF772361_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRHDLESPEHCSP
KP856973_HBc_P-E      MDIDPYKEFGASVELLSFLPQDFFPSVRDLLDTASALYRQALESPEHCSP
AB194948_HBc_P-E      MDIDPYKEFGASVDLLSFLPADFFPSVRDLLDTASALYRDALESHEHCSP
HM363601_HBc_P-E      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHCTP
FN594748_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFYPSVRDLLDTASALYRDALESSEHCST
AF350110_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
AF350176_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363565_HBc_P-E      MDIDPYKEFGATVELLSFLPLDFFPSVKDLLDTASALYRDALESPEHCSP
FN594751_HBc_P-E      MDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSX
FN594763_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MG491180_HBc_P-E      MDLDPYKEFGASVELLSFLPGDFFPSVRDLLDTASALYRDALESPEHCSP
MF772358_HBc_P-E      MDIDPYKEFGASVELLSFLPADFYPSVKDLLDSATALFRDALESPEHCSP
KT749841_HBc_P-E      MDIDLYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
KF849724_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCTP
HM363611_HBc_P-E      MDIDPYKEFGASVELLSFLPTDFYPSVRDLLDTASALFRDALESPEHCSP
HM363607_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDIIDTASGLFRDAFESLEHCSP
GQ161823_HBc_P-E      MDIDPYEEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161814_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSP
GQ161811_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSARDLLDTASALYRDALESPEHCSP
FN594762_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
FN545842_HBc_P-E      MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTAQALFRDALESPEHCSP
EU239220_HBc_P-E      MDIDPYKEFGATVELLSFLPGDFFPSVRDLLDTATALYRDALESPEHCSP
AB274979_HBc_P-E      MDIDPYKEFGATVQLLSFLPGEFFPSVRDLLDTASALYREALESPEHCTP
AB219533_HBc_P-E      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESSQHCSP
FN594765_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVKDLLDTASALYRDALESSEHCSP
MF772355_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSA
MF772357_HBc_P-E      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALFRDALESPEHFSP
HM363609_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLVTAPARNRNALEFPEHCST
HM363606_HBc_P-E      MVIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHWSP
HM363602_HBc_P-E      MVIDPYKEFGASVELLSFLPSDFFPSVRDLIDTASALYRDAFESPEHCSP
HM363599_HBc_P-E      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALFRDALESPEHCSP
FN545823_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVXDLLDTASALFRDALESPEHCSP
AF350215_HBc_P-E      MDIDPYKEFGATVELLSFWPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350187_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
AF350211_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPQHHSP
AF350101_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350191_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350202_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350111_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350117_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHGSP
AF350159_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350160_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350166_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350183_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KP857010_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
HM363610_HBc_P-E      MDIDPYKEFGASVELLSFLPPDFFPSVRDLLDTAAALFRDAFESPEHCTP
HM363605_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363598_HBc_P-E      MDIDPYKEFGGTVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
GQ161807_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FN594753_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ349240_HBc_P-E      MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTAKALFRDALESPEHCSP
AB915178_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDAIESPEHCSP
MW455164_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580626_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESSEHCSP
LT623847_HBc_P-E      MDIDPYKEFGATVQLLSFLPPDFFPSVRDLLDTASALYRDALESPEHCSP
KP857011_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSARDLLDTASALYREALESPEHCSP
KP857001_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAAALYREALESPEHCSP
KF849713_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363608_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
HM363603_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTAQALYRDALESSEHCSP
HM363600_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALEGPEHCTP
HM363587_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM363575_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTGSSLYGDALQSPEHCSP
HM363576_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTGSSLCGDALESPEHCSP
GQ491112_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161824_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161783_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161773_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
GQ161802_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
AF350184_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB274984_HBc_P-E      MDIDPYKEFGASVELLSFLPADFYPSVKDLLDTASALYRDALESPEHCSP
AB274976_HBc_P-E      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPQHCSP
AB205188_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FN594756_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363566_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHVSH
X85274_HBc_P-E        MDIDPYKEFGASVELLSFLPNDFYPSVRDLLDTASALYREALESPEHCSP
HM363595_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLIDTASALYRDAFESPEHCSP
GQ161812_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDSASAMFRDALESPEHCSP
AM494792_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALKSPEHCSP
MT731872_HBc_P-E      MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTAKALFRDALESPEHCSP
HM363604_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALFRDALESPDHCSP
GQ161797_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161796_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494695_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350175_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB274980_HBc_P-E      MDIDPYKEFGASVELLSFLPADFXPSVKDLLDTASALYRDALESPEHCSP
AM494691_HBc_P-E      MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYRDALESPEHCSP
OK318681_HBc_P-E      MDIDPYKEFGASVELLSFLPXDFFPSVRDLLDTAAALYRDALESPEHCSP
MW455162_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427111_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDVLDTASALYRDALECPEHCSP
KF849720_HBc_P-E      MVIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849718_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849716_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALKSPEHCSP
KF170741_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363593_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
HM363578_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSA
HM363570_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363569_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161833_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FN545821_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494803_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494797_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPAVRDLLDTASALYRDALESPEPCSP
AM494796_HBc_P-E      MDIDPYKEFGATVELLSFLPADFFPSVRDLLDTASALYRDALESPEHCSP
AF350105_HBc_P-E      MDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHRSP
AB274982_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHSSP
AB274981_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
AB274972_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB205190_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB201290_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363594_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALFRDALESPEHCSP
HM363596_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRALLDTASALFRDALESPEHCSP
HM363567_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM363568_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM363586_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM363588_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM363589_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM363590_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM363591_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
HM363592_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCTP
GQ161782_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161792_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494692_HBc_P-E      MDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTALALYRDALESPEHCSP
AM494787_HBc_P-E      MDIDPYKEFGASVDLLSFLPSDFFPSVRDLLDTALALYRDALESPEHCSP
MT731911_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161755_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGDALESPEHCSP
MZ962190_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGDALESPEHCSP
MZ962196_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYGDALESPEHCSP
GQ161794_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESHEHCSP
MZ962194_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESHEHCSP
MF772360_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
LT623845_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849719_HBc_P-E      MDIDPYKEFGATVEFLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161835_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESLEHCSP
GQ161762_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSP
AF350207_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB274985_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB106564_HBc_C-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350115_HBc_P-E      MDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350137_HBc_P-E      MDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ000009_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN507841_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427171_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427138_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT426115_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH725192_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSS
MH725010_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736892_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161834_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHGSP
GQ161757_HBc_P-E      MDIDPYKEFGATVELLSFLPTDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161756_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494786_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSP
AB274973_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSP
AM494714_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161826_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLYTASALYRDALESPEHCSP
MT731905_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FN545827_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVXDLLDTASALYRDALESPEHCSP
KU736913_HBc_P-E      MDIDPYKEFGAXVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
LT623842_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHXSP
AM494795_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AY739675_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSP
EU239217_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161758_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSP
GQ161766_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSP
GQ161774_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSP
GQ161778_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161790_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161810_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363584_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HQ700551_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KM606738_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
LT623848_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB091255_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB091256_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB194947_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB201287_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB201288_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB201289_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB205129_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB205189_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB205191_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB205192_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB274969_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB274970_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB274971_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB274974_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB274978_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AB915175_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494689_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494690_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494693_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494694_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494696_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494697_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494698_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494699_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494700_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494701_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494702_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494704_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494705_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494706_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494707_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494708_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494709_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494710_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494711_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494712_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494713_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494715_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494717_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494788_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494789_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494790_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494794_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494798_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494799_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494801_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494802_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494804_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494805_HBc_P-E      MDIDPYKEFGAAVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494806_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494807_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AY738144_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AY738145_HBc_C-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AY738146_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AY738147_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AY739674_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ060822_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ060823_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ060824_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ060825_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ060826_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ060827_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ060828_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ060829_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
DQ060830_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU239218_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU239219_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU239221_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU239222_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU239224_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU239226_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU620071_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ349226_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ349237_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ349238_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FJ349239_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FN545822_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
FN545841_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161759_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161760_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161761_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161763_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161764_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161765_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161769_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161770_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161771_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161772_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161775_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHVSP
GQ161776_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161777_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161779_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161780_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161781_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161784_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161785_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSA
GQ161787_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161789_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161791_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161793_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161798_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161800_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161804_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161808_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161815_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161816_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161817_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161819_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161827_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161828_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161829_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161832_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363571_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363572_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363573_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363574_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363577_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363579_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363580_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363581_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363582_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363583_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HM363585_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HQ700550_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
HQ700552_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
JQ000008_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF170742_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849714_HBc_P-E      MDIDPYKEFGATVELXSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849715_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849717_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849721_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849722_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849723_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849726_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF849727_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF922438_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF922439_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KT192626_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736891_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736893_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736894_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161803_HBc_P-E      MDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580650_HBc_P-E      MDIDPYKEFGATEELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MZ962189_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSP
MW082636_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427196_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFSSVRDLLDTASALYRDALESPEHCSP
MT427163_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427123_HBc_P-E      MDIDPYKEFGATVELLSFLPSYFFPSVRDLLDTASALYRDALESPEHCSP
MN507842_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580641_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580640_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU239223_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MZ962195_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MZ962192_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MW455161_HBc_P-E      MDIDPYKEFGATVELLSFLPHDFFPSVRDLLDTASALYRDALESPEHCSP
MT427126_HBc_P-E      MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYRDALESPEHCSP
MT427121_HBc_P-E      MDIDPYKEFGATVELLSFLPPDFFPSVRDLLDTASALYRDALESPEHCSP
MF772354_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
LT623849_HBc_P-E      MDIDPYKEFGATVELLSFLPXDFFPSVRDLLDTASALYRDALESPEHCSP
LT623850_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN967526_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736911_HBc_P-E      MDIDPYKEFGATVZLLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
FN594750_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
GQ161795_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MW455165_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
LT623843_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTARALFRDALESPEHCSP
KU736909_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736912_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
LT623851_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTATALYRDALESPEHCSP
MW455163_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736910_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KX186584_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MF772362_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KY271392_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736908_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736907_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736906_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736905_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736904_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736903_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736902_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736901_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736900_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736899_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736898_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736897_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736895_HBc_P-E      MDIDPYKEFGATVELLXFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KU736896_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
LT623846_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN507847_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSP
MN507844_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSP
GQ161820_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSX
GQ161836_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFHSVRDLLDTASALYRDALESPEHCSP
MT427156_HBc_P-E      MDIDPYKELGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427132_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
X75657_HBc_P-E        MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MZ962199_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MZ962198_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MZ962197_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVKDLLDTASALYRDALESPEHCSP
MZ962193_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MZ962191_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MW679683_HBc_P-E      MDIDPYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MW679682_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MW401520_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427201_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427200_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427199_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427198_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427197_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427195_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427194_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427193_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427192_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427191_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427190_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427189_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427188_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427187_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427186_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427185_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427184_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427183_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427182_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427181_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427180_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427179_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427178_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427177_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427176_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427175_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427174_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427173_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427172_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427170_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427169_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427168_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427167_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427166_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427165_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427164_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427162_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427161_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427159_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427158_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427157_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427155_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427154_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSL
MT427153_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSL
MT427152_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427151_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427150_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427149_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427148_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427147_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427146_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427144_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427143_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427142_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427141_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427140_HBc_P-E      MDIDPYIDFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427139_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427137_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427136_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427135_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427134_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427131_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427130_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427129_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427128_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427127_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427125_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427124_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427122_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427120_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427119_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427117_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427116_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427115_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427114_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MT427110_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN967529_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN967528_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN967527_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN507848_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN507846_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN507845_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MN507843_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MK720632_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MK720631_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MK321264_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH918655_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH725114_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH725042_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH725021_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH725020_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580652_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580651_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580649_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580647_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580646_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580644_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580638_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580637_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580636_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580635_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580634_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580633_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580632_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580631_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580630_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580629_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580628_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580625_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580624_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580623_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580622_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580621_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580620_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580619_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580618_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580617_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580616_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580615_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH464855_HBc_P-E      --IDPYXXFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH580614_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350204_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350209_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350144_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
EU726883_HBc_P-E      MDIDAYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
AF350208_HBc_P-E      MDIDPYKEFGATVELLSFLPNDFFPSVRDLLDTASALYRDALESPEHCSP
AF350206_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350180_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350167_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350164_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350158_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350146_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350135_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350131_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350123_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSR
AF350114_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350113_HBc_P-E      MDIDSYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350168_HBc_P-E      MDIDSYKEFGASVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350107_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350173_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
MH725024_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYRDALESPEHCSP
MH725141_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSIRDLLDTASALYREALESPDHCSP
AY269055_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSS
KF798275_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTAAALYRDALESPEHCSP
AF350154_HBc_P-E      MDIDPYKEFGATVESLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350099_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350100_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350102_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350103_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350104_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350106_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350108_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350109_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350116_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350118_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350119_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350120_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350121_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350122_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350124_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350125_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350126_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350127_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350128_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350130_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350132_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350133_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350134_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350136_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350138_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350139_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350140_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350141_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350142_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350143_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350145_HBc_P-E      MDIDPYKEFGATVQLLSFLPSDFFPSVRDLLDTASALFRDALESPEHCSP
AF350147_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350148_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350149_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350150_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350151_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350152_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350153_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350155_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350156_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350157_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350161_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350162_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350163_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350165_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350169_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350170_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350171_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350172_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350174_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350177_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350178_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350179_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350181_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350182_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350185_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350186_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350188_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350189_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350190_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350192_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350193_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350194_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350195_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350196_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350197_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350198_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350199_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350200_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350201_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350203_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350205_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350210_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350212_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350213_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350214_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350216_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350217_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350218_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350219_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350220_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494808_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494809_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494810_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
KF798259_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798270_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYREALESPEHCSP
KF798298_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AF350112_HBc_P-E      MDIDPYKEFGATVEILSFLPSDFFPSVRDLLDTASALYRDALESPEHCSP
AM494811_HBc_P-E      MDVDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYRDALESPEHCSP
AM494812_HBc_P-E      MDIDPYKEFGATVELLSFLPSDFFPSVRGLLDTASALYRDALESPEHCSP
                        :* :  :*.      *    *  :   :: :        .:     : 

GQ161825_HBc_P-E      HHTALRQAILCWGDVMNLATWVGANLEDPVSRDLVVSYVNNNMGLKFRQL
OK318680_HBc_P-E      HHTAIRQAIICWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU726953_HBc_P-E      HHTALRQAILCWGDLMSLATWVGGNLEDPVSRELVIGYVNTTVGLKFRQL
KP857055_HBc_P-E      HHTAIRQAVLCWGDLMSLATWVGVNLEDQASRDLIVSYVNNNMGLKFRQL
KP856982_HBc_P-E      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MF772359_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVNYVNSHMGIKFRQL
MF772356_HBc_P-E      HHTALRHAFLCWGDLMSLATWVGVNLEDQASRDQVVSYVNTNMGLKFRQL
KF798305_HBc_P-E      HHTALRQAFLCWGELMTLATWVGANLEDQGSRDLVVSYVNVNMGLKFRQL
KP856998_HBc_P-E      HHTALRQAILCWGELMNLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
AB915180_HBc_P-E      HHTALRQAVLCWGDIMNIATWVGANLEDPASRELVVSYVNTNMGLKFRQL
AB274977_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNNNMGLKFRQL
AB274975_HBc_P-E      HHTALRQAILCWGDVMNLATWVGANLEDPASRDLVVGYVNTNMGLKFRQL
FN594749_HBc_P-E      SHTALRQAVLCWGDVMNLATGVGTNLEDPASRDLVVGYVNTNMGLKFRQL
MN507840_HBc_P-E      HHTALRQAILCWGDVMNLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQL
KM606739_HBc_P-E      HHTALRQAILCWGDVMSLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQL
KF849728_HBc_P-E      HHTALRQAILCWGDVMNLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQL
KF849725_HBc_P-E      HHTALRQACLCWGDVMNLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQL
GQ161801_HBc_P-E      HHTALRQAILCWGEVMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY935700_HBc_P-E      HHTALRQAILCWGDVMSLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQL
AM494703_HBc_P-E      HHTALRQAILCWGDVMTLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQL
AM494800_HBc_P-E      HHTALRQAILCWGDVMTLATWVGVNLEGPASRDLVVGYVNTNMGLKFRQL
FN594752_HBc_P-E      XHLPLRQAILCWGDVMNLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQL
LT623844_HBc_P-E      HHTALRQAILCWGDVMNLATWVGVNLEDPASRDLVVGYVNTNMGLKFRQL
GQ161768_HBc_P-E      HHTALRQAILCWGDVMNLATWVGVNLQDPASRDQVVGYVNTNMGLKFRQL
FN594766_HBc_P-E      HHTALRQAILCWGDLMNLATWVGANLEDQASRDLVVGYVNTTVGLKFRQL
FN594758_HBc_P-E      HHTALRQAILCWGDLMNLATWVGANLEDPSSRELVVGYVNTNVGLKFRQL
FN594760_HBc_P-E      HHTALRQAILCWGDLMNLATWVGANLEDPSSRELVVGYVNTNVGLKFRQL
FN594759_HBc_P-E      HTTALRQALLCWGDLMNLATWVGANLEDPSSRELVVGYVNTNVGLKFRQL
FN594761_HBc_P-E      HHTALRQAILCWGDLMNLATWVGANLEDPASRDLVVGYVNTTVGLKFRQL
GQ161831_HBc_P-E      HHTALRQAILCWGDLMNLATWVGGNLEDPASRDVVVNYVNTNIALKFRQL
AM494791_HBc_P-E      HHSAIRQAILCWGELMTLATWVGVKLEDPASRDLVVSYVNTNLGLKFQQL
AM494793_HBc_P-E      HHSAIRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNLGLQFQQL
HM363597_HBc_P-E      HHTAIRQAIICWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB219534_HBc_P-E      HHTALRQAILCWGELMSLATWVGANLQDPASRDQVVTYVNTNMGTKFRQL
AB219529_HBc_P-E      HHTALRQVILCWGDLMNLATWVGGNLQDPASRDLVVNYVNINMGLKFRQL
MH580645_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPGSRELVVSYVNTHMGLKFRQL
GQ161786_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLQDQASRDLVVNYVNTNMGLKFRQL
MH580648_HBc_P-E      HHTAIRQAILCWGNLMNLATWVGVNLEDQASRDLVVSYVNTNMGLQFRQL
MF772361_HBc_P-E      HHTALRQAILCWGDLMTLATWVGGNLEDQASRDLVVNYVNINVGLKFRQL
KP856973_HBc_P-E      HHTAIRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
AB194948_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363601_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDQASRDLIVSYVNSSMGLKFRQI
FN594748_HBc_P-E      HPAALRQAILCWGDLMNLGTWVGGNLEDQASRDAVVSYVNTNMGLKFRQL
AF350110_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350176_HBc_P-E      HHTALRQAVLCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363565_HBc_P-E      HHTALRQAILCWGDLMNLATWVGANLDDPGSRDQVVSYVNTNMGLKFRQL
FN594751_HBc_P-E      HPAALRQAILCWGDLMNLATWVGANLDDPASRDLVVSYVNTNMGLKFRQL
FN594763_HBc_P-E      HNTALRQAILCWGDLMNLATWVGANLDDPASRDLVVSYVNTNMGLKFRQL
MG491180_HBc_P-E      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
MF772358_HBc_P-E      HHTALRQAILCWGDLMNLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
KT749841_HBc_P-E      HHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVSYVNTTIGLKFRQL
KF849724_HBc_P-E      HHTALRQAVLCWGELMNLATWVGANLQDPTSRDLVVSYVNTNMGLKFRQL
HM363611_HBc_P-E      HHTALRQAILCWGDLMTLATWVGANLEGPASRDLVVSYVNTNMGLKFRQL
HM363607_HBc_P-E      YHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTHMGLKFRQL
GQ161823_HBc_P-E      HHTALRQAILCWGDLMNLGTWVGVNLEDQASRDRVVSYVNTNMGLKFRQL
GQ161814_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRELLVSYVNTNIALKFRQL
GQ161811_HBc_P-E      HHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVGYVNTNMGIRFRQL
FN594762_HBc_P-E      HHSALRQAVLCWGDLMNLATWVGVNLEDPASRDLVVSYVNTDMGLKFRQL
FN545842_HBc_P-E      HHTALRQAILCWGDLMSLATWVGTNLDDPASRDXVVSYVNTNMGLKFRQL
EU239220_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNDNMGLKFRQL
AB274979_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVNDNMGLKFRQL
AB219533_HBc_P-E      HHTALRQAILCWGDIMTIATWVGVNLQDQESRDLVVSYVNTNMGLKFRQL
FN594765_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDQVVSYVNTNMGVKFRQL
MF772355_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKXRQL
MF772357_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363609_HBc_P-E      QPTAIRPSLFCWGELMTLATWVGVNLEDPSSRDLVVSYVNTNMGLKFRQL
HM363606_HBc_P-E      HHTALRHVILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363602_HBc_P-E      HHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363599_HBc_P-E      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
FN545823_HBc_P-E      HHTALRQAILCWGXLXXLATWVGVNLEDPASRDXVVSYVNTNMGLKFRQL
AF350215_HBc_P-E      HHTAIRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350187_HBc_P-E      HHTAIRQAILCWGELMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQF
AF350211_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350101_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
AF350191_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
AF350202_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
AF350111_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
AF350117_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
AF350159_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350160_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350166_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350183_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KP857010_HBc_P-E      HHTALRQAILCWGELMTLATWVGGNLDDPTSRDLVVSYVNTNMGLKFRQL
HM363610_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
HM363605_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLDDPASRDLVVSYVNTHMGLKFRQL
HM363598_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDQGSRDLVVSYVNNHMGLKFRQL
GQ161807_HBc_P-E      HHTALRQAILCWGDLMTLATWVGANLEDPASRDQVVSYVNDNIALKFRQL
FN594753_HBc_P-E      HHTALRQAILCWGDVMNMATWVGVNLQDQASRDQVVSYVNTNMGLKFRQL
FJ349240_HBc_P-E      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNINVGLKFRQL
AB915178_HBc_P-E      HHTALRQAIICWGDLMSLATWVGENLQDQASRDLVVSYVNTNMGLKFRQL
MW455164_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
MH580626_HBc_P-E      HHTALRQAILCWGDLMNLGTWVGGNLEDPASRDLVVSYVNTNMGLKFRQL
LT623847_HBc_P-E      HHTALRQAILCWGDIMNIATWVGANLEDQTSRDLVVSYVNTNMGIKFRQL
KP857011_HBc_P-E      HHTALRQAILCWGDLMTLATWVGGNLEDPGSRDLVVSYVNTNMGLKFRQL
KP857001_HBc_P-E      HHTALRQAILCWGELMTLATWVGGNLEDPTSRDLVVSYVNTNMGLKFRQL
KF849713_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFREL
HM363608_HBc_P-E      HHTALRQAILCWGDVMNLATWVGANLEDPTSRDLVVSYVNTHMGLKTRQL
HM363603_HBc_P-E      HHTALRQAILCWGDLMSLGTWVGGNLEDQASRDLVVSYVNTNMGLKFRQL
HM363600_HBc_P-E      HHTALRQAIICWGELMTLATWVGVNLDDPASRDLVVSYVNTNMGLKFRQL
HM363587_HBc_P-E      HHTALRQVILCWGDLMTLATWVGGNLEDQTSRDLIVSYVNTNMGLKFRQL
HM363575_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
HM363576_HBc_P-E      HHTELRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
GQ491112_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLDDQASRDLVVSYVNTHMGLKFRQL
GQ161824_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVNTNMGLKFRQL
GQ161783_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVNTNMGLKFRQL
GQ161773_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPSSRELVVSYVNTNMGLKFRQL
GQ161802_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPSSRELVVSYVNTNMGLKFRQL
AF350184_HBc_P-E      HHTALRHAVLCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB274984_HBc_P-E      HHTALRQAILCWGDLMNLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
AB274976_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVGYVNSNMGLKFRQL
AB205188_HBc_P-E      HHTALRQAILCWGDLMNLGTWVGGNLEDPASRDLVVSYVNTNMGLKFRQL
FN594756_HBc_P-E      HHTALRQAILCWGDIMNIATWVGANLEDQASRDLVVSYVNSNMGLKFRQL
HM363566_HBc_P-E      HHTALRQAILCWGDIMNIATWVGANLEDQASRDLVVSYVNTNMGLKFRQL
X85274_HBc_P-E        HHTALRQAILCWGDLMTLATWVGGNLEDPTSRDVVVSYVNTNVGLKFRQL
HM363595_HBc_P-E      YHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161812_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494792_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
MT731872_HBc_P-E      HHTALRQAILCWGDLMTLATWVGENLEDPASRDLVVSYVNTNAGLKFRQL
HM363604_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
GQ161797_HBc_P-E      HHTAIRQAIICWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161796_HBc_P-E      HHTALRQAILCWGDLMNLGTWVGANLDDQASRDLVVSYVNTNMGLKFRQL
AM494695_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350175_HBc_P-E      HHTALRQAIVCWGDIMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB274980_HBc_P-E      HHTALRQAILCWGDLMTLATWVGENLEDPASRDLVVSYVNTNVGLKFRQL
AM494691_HBc_P-E      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
OK318681_HBc_P-E      HHTALRQAVLCWGELMTLATWVGANLEDPASRDLVVTYVNXXMGLKFRQL
MW455162_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNNNMGLKFRQL
MT427111_HBc_P-E      PHTAVRRAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF849720_HBc_P-E      HHTALRQAILCWGELMTLATWVGGNLQDPTSRDLVVSYVNTNMGLKFRQL
KF849718_HBc_P-E      HHTALRQXILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF849716_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFXQL
KF170741_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363593_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363578_HBc_P-E      HHTALRQAVLCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
HM363570_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363569_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161833_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FN545821_HBc_P-E      HHTALRQAILCWGELMTLATWVGENLQDQASRDLVVSYVNTHMGLKFRQL
AM494803_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKYRQL
AM494797_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFGQL
AM494796_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350105_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASKDLVVSYANTNMGLKFRQL
AB274982_HBc_P-E      HHTALRQAILCWGDLMSLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
AB274981_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB274972_HBc_P-E      HHTALREAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB205190_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDQASRDLVVSYVNTNMGLKFRQL
AB201290_HBc_P-E      HHTALRQVILCWGDLMTLATWVGVNLDDPASRDLVVSYVNTNMGLKFRQL
HM363594_HBc_P-E      HHTALRQAIICWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363596_HBc_P-E      HHTALRQAIICWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363567_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363568_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363586_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363588_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363589_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363590_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363591_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363592_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161782_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNIALKFRQL
GQ161792_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNIALKFRQL
AM494692_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
AM494787_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
MT731911_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161755_HBc_P-E      HHTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MZ962190_HBc_P-E      HHTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MZ962196_HBc_P-E      HHTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161794_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MZ962194_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF772360_HBc_P-E      HHTALRQAVLCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
LT623845_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
KF849719_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161835_HBc_P-E      HHTALRQAILCWGELMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161762_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350207_HBc_P-E      HHTALRQAILCWGDLITLSTWVGANLEDPASRDLVVSYVNTNMGLKFRQL
AB274985_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB106564_HBc_C-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350115_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350137_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ000009_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN507841_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427171_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427138_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT426115_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725192_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725010_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736892_HBc_P-E      HHTALRQAILCWGDVMNLATWVGVNLEDPVSRDLVVSYVNTNMGLKFRQL
GQ161834_HBc_P-E      HHTALRQAILCWGDLMTLATWVGENLEDPASRDLVVSYVNTNAGLKFRQL
GQ161757_HBc_P-E      HHTALRQAILCWGDLITLSTWVGANLEDPASRDLVVSYVNTNMGLKFRQL
GQ161756_HBc_P-E      HHTAFRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494786_HBc_P-E      HHTALRQAILCWGDLMNLATWVGANLQDPASRDQVVSYVNTTAGLKFRQL
AB274973_HBc_P-E      HHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494714_HBc_P-E      HHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161826_HBc_P-E      HHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT731905_HBc_P-E      HHTALRQAILCWGDLMTLATWVGANLEDPASRDLVVSYVNTNVGLKFRQL
FN545827_HBc_P-E      HHTALRQAXLCWGDLMNLATWVGVNLEDPASRDLVVSYVNTXVGLKFRQL
KU736913_HBc_P-E      HHTALRQAILCWGDLMNLATWVGVNLEDPASRDLVVSYVNTNXGLKFRQL
LT623842_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
AM494795_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
AY739675_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
EU239217_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
GQ161758_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
GQ161766_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
GQ161774_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
GQ161778_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
GQ161790_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
GQ161810_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
HM363584_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
HQ700551_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
KM606738_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
LT623848_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
AB091255_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB091256_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB194947_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB201287_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB201288_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB201289_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB205129_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB205189_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB205191_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB205192_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB274969_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB274970_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB274971_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB274974_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AB274978_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTHMGLKFRQL
AB915175_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494689_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494690_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494693_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494694_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494696_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494697_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494698_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494699_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494700_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494701_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494702_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494704_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494705_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494706_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494707_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494708_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494709_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494710_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494711_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494712_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494713_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494715_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494717_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494788_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494789_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494790_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494794_HBc_P-E      HYTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494798_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494799_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494801_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494802_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494804_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494805_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494806_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494807_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY738144_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY738145_HBc_C-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY738146_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY738147_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AY739674_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ060822_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ060823_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ060824_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ060825_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ060826_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ060827_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ060828_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ060829_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
DQ060830_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU239218_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU239219_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU239221_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU239222_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU239224_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU239226_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU620071_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ349226_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVNTNMGLKFRQL
FJ349237_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ349238_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FJ349239_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FN545822_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FN545841_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161759_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161760_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161761_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161763_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161764_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161765_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161769_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161770_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161771_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161772_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161775_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161776_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161777_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161779_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161780_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161781_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161784_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161785_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTNMGLKFRQL
GQ161787_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161789_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161791_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161793_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161798_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161800_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161804_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161808_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161815_HBc_P-E      HHTALRQAILCWGXLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161816_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161817_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161819_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161827_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161828_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161829_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161832_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363571_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363572_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363573_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363574_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363577_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363579_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363580_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363581_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363582_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363583_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HM363585_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700550_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
HQ700552_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
JQ000008_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF170742_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF849714_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF849715_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF849717_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF849721_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF849722_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF849723_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF849726_HBc_P-E      HHTALRQAIICWGELMTLATWVGVNLEDPSSRDLVVSYVNTNMGLKFRQL
KF849727_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF922438_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF922439_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KT192626_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736891_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736893_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736894_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161803_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580650_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MZ962189_HBc_P-E      HHTALRQAILFSGELMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
MW082636_HBc_P-E      HHTALRQAILCWGDLMNLGTWVGGNLEDPASRDLVVSYVNTNMGLKFRQL
MT427196_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427163_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427123_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN507842_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580641_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580640_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
EU239223_HBc_P-E      HHTALRQAILCWGDIMTIATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MZ962195_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
MZ962192_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
MW455161_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427126_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427121_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF772354_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNVGLKFRQL
LT623849_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNXGLKFRQL
LT623850_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN967526_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736911_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
FN594750_HBc_P-E      XHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
GQ161795_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MW455165_HBc_P-E      HHTALRQAILCWGDLITLSTWVGANLEDPASRDLVVSYVNTNMGLKFRQL
LT623843_HBc_P-E      HHTALRQAILCWGDLMXLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736909_HBc_P-E      HHTALRQAILCWGDLMXLATWVGVNLEDPASRDLVVSYVNTXMGLKFRQL
KU736912_HBc_P-E      HHTALRQAILCWGDIMTIXTWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
LT623851_HBc_P-E      HHTALRQAIXCWGELMTLATWVGANLXDPASRDLVVSYVNTNMGLKFRQL
MW455163_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736910_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KX186584_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MF772362_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KY271392_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736908_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736907_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736906_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736905_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736904_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736903_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736902_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736901_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736900_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736899_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736898_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736897_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736895_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KU736896_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
LT623846_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN507847_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN507844_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNNNMGLKFRQL
GQ161820_HBc_P-E      HHTALRQAILCWGEXMTLATWVGVNLEDPASRDLVVSYVNXNMGLKFRQL
GQ161836_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427156_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427132_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
X75657_HBc_P-E        HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MZ962199_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MZ962198_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MZ962197_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MZ962193_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MZ962191_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MW679683_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MW679682_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MW401520_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427201_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427200_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427199_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427198_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427197_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427195_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427194_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427193_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427192_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427191_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427190_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427189_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427188_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427187_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427186_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427185_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427184_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427183_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427182_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427181_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427180_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427179_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427178_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427177_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427176_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427175_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427174_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427173_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427172_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427170_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427169_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427168_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427167_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427166_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427165_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427164_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427162_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427161_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427159_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427158_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427157_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427155_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427154_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427153_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427152_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427151_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427150_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427149_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427148_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427147_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427146_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427144_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427143_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427142_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427141_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427140_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427139_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427137_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427136_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427135_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427134_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427131_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427130_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427129_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427128_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427127_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427125_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427124_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427122_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427120_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427119_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427117_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427116_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427115_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427114_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MT427110_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN967529_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN967528_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN967527_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN507848_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN507846_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN507845_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MN507843_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK720632_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK720631_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MK321264_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH918655_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725114_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725042_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725021_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725020_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580652_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580651_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580649_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580647_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580646_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580644_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580638_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580637_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580636_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580635_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580634_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580633_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580632_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580631_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580630_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580629_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580628_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580625_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580624_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580623_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580622_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580621_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580620_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580619_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580618_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580617_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580616_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580615_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH464855_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH580614_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350204_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350209_HBc_P-E      HHTALRQAILCWGDLMSLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350144_HBc_P-E      HHTALRQAILCWGDLMSLGTWVGGNLEDQASRDLVVSYVNTNMGLKFRQL
EU726883_HBc_P-E      HHTALRQAILCWGELMTLATWVGGNLEDPISRDLVVSYVNTNMGLKFRQL
AF350208_HBc_P-E      HHTALRQAILCWGELMTLATWVGANLEDPASRDLVVSYVNTHMGLKFRQL
AF350206_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350180_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPAPRDLVVSYVNTNMGLKFRQL
AF350167_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350164_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350158_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350146_HBc_P-E      YHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350135_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350131_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350123_HBc_P-E      HHIALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350114_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350113_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350168_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPSSRDLVVSYVNTNMGLKFRQL
AF350107_HBc_P-E      NHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350173_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725024_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
MH725141_HBc_P-E      HHTALRQAILCWGELMTLATWVGGNLEDPASRDLVVSYVNTNMGLKFRQL
AY269055_HBc_P-E      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
KF798275_HBc_P-E      HHTALRQAILCWGELMTLATWVGTNLEDPASRDLVVSYVNTNMGLKFRQL
AF350154_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350099_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350100_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350102_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350103_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350104_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350106_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350108_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350109_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350116_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350118_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350119_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350120_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350121_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350122_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350124_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350125_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350126_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350127_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350128_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350130_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350132_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350133_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350134_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350136_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350138_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350139_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350140_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350141_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350142_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350143_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350145_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350147_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350148_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350149_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350150_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350151_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350152_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350153_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350155_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350156_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350157_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350161_HBc_P-E      HHTALKQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350162_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350163_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350165_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350169_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350170_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350171_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350172_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350174_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350177_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350178_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350179_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350181_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350182_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350185_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350186_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350188_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350189_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350190_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350192_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350193_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350194_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350195_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350196_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350197_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350198_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350199_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350200_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350201_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350203_HBc_P-E      HHTALRQAILCWGDLMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350205_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350210_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350212_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350213_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350214_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350216_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350217_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350218_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350219_HBc_P-E      HHTALRQAILCWGDLMTIATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350220_HBc_P-E      HHTALRQAILCWGDLMTIATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494808_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494809_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494810_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF798259_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF798270_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
KF798298_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AF350112_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494811_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
AM494812_HBc_P-E      HHTALRQAILCWGELMTLATWVGVNLEDPASRDLVVSYVNTNMGLKFRQL
                          ..      *    : * ** :* .  ..: :: *.*   . .  ::

GQ161825_HBc_P-E      LWVHISCLTFGRETVLQYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
OK318680_HBc_P-E      LWFHLSCLMFGRDTVLEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVIR
EU726953_HBc_P-E      LWFHISCLMFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
KP857055_HBc_P-E      LWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSSLPETTVLR
KP856982_HBc_P-E      LWFHISCLTFGRQTVIEYLVSFGVWIRTPQGYRPPNAPILSTLPETTVIR
MF772359_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVR
MF772356_HBc_P-E      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KF798305_HBc_P-E      LWFHISCLTFGRQTVIEYLVSFGVWIRTPQPYRPPNAPILSTLPECTVVR
KP856998_HBc_P-E      LWFHISCLTFGRDTVAEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB915180_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB274977_HBc_P-E      LWFHTSCITFGRDIVLEYLVSFGVWIRTPPPYRPANAPILSTLPETTVLR
AB274975_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FN594749_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN507840_HBc_P-E      LWFHTSCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
KM606739_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849728_HBc_P-E      LWFHLSCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849725_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161801_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AY935700_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494703_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494800_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FN594752_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
LT623844_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161768_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FN594766_HBc_P-E      LWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETSVVR
FN594758_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FN594760_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FN594759_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FN594761_HBc_P-E      LWFHISCLTFGRDVVIEYLVSFGVWIRTPIAYRPPNAPILSTLPENTVVR
GQ161831_HBc_P-E      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494791_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTIPENTVVR
AM494793_HBc_P-E      LGFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTIPENTVVR
HM363597_HBc_P-E      LWFHVSCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB219534_HBc_P-E      LWFHISCITFGREIVVEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVIR
AB219529_HBc_P-E      LWFHISCLTFGRETVTEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MH580645_HBc_P-E      MWFHISCLTFGRELVVEYLVSFGVWIRTPPAYRPQNAPILSTLPETAVVR
GQ161786_HBc_P-E      LWFHISCLTFGREIVLEYLVSFGVWIRTPPAYRPLNAPILSTLPENTVVR
MH580648_HBc_P-E      LWFHMSCIIFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MF772361_HBc_P-E      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP856973_HBc_P-E      LWFHISCLTFGRDTVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
AB194948_HBc_P-E      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPQNAPILSTLPETTVVR
HM363601_HBc_P-E      FWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVR
FN594748_HBc_P-E      LWFHISCLTFGRDTVVEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
AF350110_HBc_P-E      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AF350176_HBc_P-E      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM363565_HBc_P-E      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
FN594751_HBc_P-E      LWFHISCLTFGTPTVVEYLVSFGVWIRTPIAYRPPNAPILSTLPEHTVVR
FN594763_HBc_P-E      LWFHISCLTFGTPTVVEYLVSFGVWIRTPIAYRPPNAPILSTLPEHTVVR
MG491180_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
MF772358_HBc_P-E      LWFHTSCITFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KT749841_HBc_P-E      LWFHISCLTFGRDIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849724_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPQNAPILSTLPETTVVR
HM363611_HBc_P-E      LWFHVSCLTFGREVVVEFLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
HM363607_HBc_P-E      LWFHFSCITFGRDTVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ161823_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVR
GQ161814_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161811_HBc_P-E      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FN594762_HBc_P-E      LWFHISCLTFGRDTVVEYLVSFGVWIRTPIPYRPPNAPILSTLPETTVVR
FN545842_HBc_P-E      LWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
EU239220_HBc_P-E      LWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVIR
AB274979_HBc_P-E      LWFHISCLTFGRDVVLEFLVSFGVWIRTPPPYRPPNAPILSTLPEITVVR
AB219533_HBc_P-E      LWFHISCLTFGREIVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FN594765_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVR
MF772355_HBc_P-E      LWFHISCLTFGRDVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MF772357_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPIAYRPQNAPILSTLPETTVIR
HM363609_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363606_HBc_P-E      LWFHVSCLMFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363602_HBc_P-E      LWFHISCLTFGREIVVEYLVSFGVWIRTPIAYRPPNAPILSTLPETTVVR
HM363599_HBc_P-E      LWFHISCLIFGRDVVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVR
FN545823_HBc_P-E      LWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPQNAPILSTLPEXAVVR
AF350215_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AF350187_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AF350211_HBc_P-E      LWFHISCLTFGRDTVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVR
AF350101_HBc_P-E      LWFHISCLTFGRETAIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVR
AF350191_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVR
AF350202_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVR
AF350111_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVR
AF350117_HBc_P-E      LWFHISCLTFGRDTVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVR
AF350159_HBc_P-E      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AF350160_HBc_P-E      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AF350166_HBc_P-E      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AF350183_HBc_P-E      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KP857010_HBc_P-E      LWFHLSCLMFGREVVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVXR
HM363610_HBc_P-E      FWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
HM363605_HBc_P-E      LWFHLSCLMFGRDTVVEYLVSFGVWIRTPIAYRPPNAPILSTLPENTVVR
HM363598_HBc_P-E      MWFHISCLTFGREIVLEFLVSFGVWIRTPPPYRPPNAPILSTLPEITVVR
GQ161807_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVR
FN594753_HBc_P-E      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FJ349240_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
AB915178_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPLNAPILSTLPETTVVR
MW455164_HBc_P-E      LWFHTSCITFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
MH580626_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETSVVR
LT623847_HBc_P-E      LWFHISCLTFGREVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KP857011_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
KP857001_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
KF849713_HBc_P-E      LWFHISCLTLGRETVXDYLVSFGVWIPTPPAYRPPNAPILSTLPENTVVR
HM363608_HBc_P-E      LWFHISCLTFGRDIVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363603_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM363600_HBc_P-E      LWFHISCLTFGRDTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363587_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363575_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363576_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ491112_HBc_P-E      LWFHISCLTFGRETVHEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161824_HBc_P-E      LWFHTSCITFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ161783_HBc_P-E      LWFHTSCITFGRQTVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ161773_HBc_P-E      LWFHISCLTFGRQVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161802_HBc_P-E      LWFHISCLTFGRQVVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AF350184_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
AB274984_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB274976_HBc_P-E      LWFHISCLTFGREIVLEFLVSFGVWIRTPPPYRPPNAPILSTLPEITVVR
AB205188_HBc_P-E      LWFHISCLTFGRDTVVEYLVSFGVWIRTPPAYRPPNAPIVSTLPENTVVR
FN594756_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVR
HM363566_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
X85274_HBc_P-E        LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM363595_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161812_HBc_P-E      LWFHISCLTFGREAVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494792_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVR
MT731872_HBc_P-E      LWFHISCLTFGRDIVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVR
HM363604_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENAVVR
GQ161797_HBc_P-E      LWFHTSCITFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVR
GQ161796_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494695_HBc_P-E      LWFHTSCITFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVIR
AF350175_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB274980_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494691_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVR
OK318681_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPPYRPPNAPILSTLPEITVVR
MW455162_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVR
MT427111_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849720_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849718_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPECTVIR
KF849716_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF170741_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363593_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPQNAPILSTLPENTVVR
HM363578_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
HM363570_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363569_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161833_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTTPENTVVR
FN545821_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494803_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494797_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494796_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLSENTVVR
AF350105_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB274982_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
AB274981_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPLNAPILSTLPENTVVR
AB274972_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB205190_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB201290_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363594_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363596_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363567_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363568_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363586_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363588_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363589_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363590_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363591_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363592_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161782_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161792_HBc_P-E      LWFHISCLTFGREPVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494692_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPEITVVR
AM494787_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPEITVVR
MT731911_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPSYRPPNAPILSTLPETTVVR
GQ161755_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MZ962190_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MZ962196_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161794_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MZ962194_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MF772360_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
LT623845_HBc_P-E      LWFHISCLTFGRQTVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849719_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161835_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161762_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AF350207_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB274985_HBc_P-E      LWFHTSCITFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB106564_HBc_C-E      LWFHISCLTLGRETVIEYLVSFGVWIPTPPAYRPPNAPILSTLPENTVVR
AF350115_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AF350137_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
JQ000009_HBc_P-E      LWLHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN507841_HBc_P-E      LWLHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427171_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPNLSTLPENTVVR
MT427138_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT426115_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPVLSTLPENTVVR
MH725192_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH725010_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KU736892_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVR
GQ161834_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVR
GQ161757_HBc_P-E      LWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ161756_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AM494786_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB274973_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494714_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
GQ161826_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT731905_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPEHTVVR
FN545827_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPXAYRPPNAPILSTLPENTVVR
KU736913_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVR
LT623842_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPXNAPILSTLPEXTVVR
AM494795_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AY739675_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
EU239217_HBc_P-E      LGFHISCLTFGRETVIEYLVSFGVWIRTPSAYRPPNAPILSTLPENTVVR
GQ161758_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161766_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161774_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161778_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVR
GQ161790_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161810_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVR
HM363584_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVR
HQ700551_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVR
KM606738_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVR
LT623848_HBc_P-E      LWFHISCLTFGRETVXEYLVSFGVWIRTPXAYRPPNAPILSTLPENTVVR
AB091255_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB091256_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB194947_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB201287_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB201288_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB201289_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB205129_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB205189_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB205191_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB205192_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB274969_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB274970_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB274971_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB274974_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AB274978_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
AB915175_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494689_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494690_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494693_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494694_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494696_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494697_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494698_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPENTVVR
AM494699_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494700_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494701_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494702_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494704_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494705_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494706_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494707_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494708_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494709_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494710_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494711_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
AM494712_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494713_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494715_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494717_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494788_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494789_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494790_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494794_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494798_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494799_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494801_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494802_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494804_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494805_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494806_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AM494807_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AY738144_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AY738145_HBc_C-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AY738146_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AY738147_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
AY739674_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
DQ060822_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
DQ060823_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
DQ060824_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
DQ060825_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
DQ060826_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
DQ060827_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
DQ060828_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
DQ060829_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
DQ060830_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
EU239218_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
EU239219_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
EU239221_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
EU239222_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
EU239224_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
EU239226_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
EU620071_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FJ349226_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FJ349237_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FJ349238_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FJ349239_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
FN545822_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPETTVVR
FN545841_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161759_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161760_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ161761_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161763_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161764_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161765_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161769_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161770_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161771_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161772_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161775_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
GQ161776_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161777_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161779_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161780_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGGWIRTPPAYRPPNAPILSTLPENTVVR
GQ161781_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161784_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161785_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161787_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161789_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161791_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161793_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161798_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161800_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161804_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161808_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161815_HBc_P-E      LWFHISCLTFGRETVIEYLVSCGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161816_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161817_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161819_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161827_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161828_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161829_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161832_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363571_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363572_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363573_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363574_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363577_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363579_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363580_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363581_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363582_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363583_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HM363585_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HQ700550_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
HQ700552_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
JQ000008_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF170742_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849714_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849715_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849717_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849721_HBc_P-E      LWFHISCLTLGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849722_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849723_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF849726_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSSLPECTVVR
KF849727_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF922438_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KF922439_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KT192626_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736891_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736893_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736894_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
GQ161803_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580650_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MZ962189_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MW082636_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427196_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427163_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIPTPPAYRPPNAPILSTLPENTVVR
MT427123_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIPTPPAYRPPNAPILSTLPENTVVR
MN507842_HBc_P-E      LWFHISCLTLGRETVIEYLVSFGVWIPTPPAYRPPNAPILSTLPENTVVR
MH580641_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580640_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
EU239223_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MZ962195_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPTAYRPPNAPILSTLPENTVVR
MZ962192_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MW455161_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427126_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427121_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MF772354_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
LT623849_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIXTPXAYRPPNAPILSTLPEXTVVR
LT623850_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN967526_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736911_HBc_P-E      LWFHISCLTFGRETVLEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
FN594750_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPETTVVR
GQ161795_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MW455165_HBc_P-E      LWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
LT623843_HBc_P-E      LWFHISCLTFGRETVVEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
KU736909_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPXAYRPPNAPILSTLPETTVVR
KU736912_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
LT623851_HBc_P-E      LWFHISCLTFGREVVLEYLVSFGVWIRTPPPYRPPNAPILSTLPETTVVR
MW455163_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVR
KU736910_HBc_P-E      LWFHISXLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KX186584_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MF772362_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KY271392_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTIVR
KU736908_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736907_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736906_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736905_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736904_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736903_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736902_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736901_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736900_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736899_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736898_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736897_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736895_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
KU736896_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
LT623846_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPXYRPPNAPILSTLPENTVVR
MN507847_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN507844_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPPYRPPNAPILSTLPENTVVR
GQ161820_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPXYRPPNAPILSTLPENTVVR
GQ161836_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427156_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427132_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
X75657_HBc_P-E        LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MZ962199_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MZ962198_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MZ962197_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MZ962193_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MZ962191_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MW679683_HBc_P-E      LWFHISCLTFGREVVLEYLVSFGVWIRTPPAYRPPNAPILSTLPETTVVR
MW679682_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MW401520_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427201_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427200_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427199_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427198_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427197_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427195_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427194_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427193_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427192_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427191_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427190_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427189_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427188_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427187_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427186_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427185_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427184_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427183_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427182_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427181_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427180_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427179_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427178_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427177_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427176_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427175_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427174_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427173_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427172_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427170_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427169_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427168_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427167_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427166_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427165_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427164_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427162_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427161_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427159_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427158_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427157_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427155_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427154_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427153_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427152_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427151_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427150_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427149_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427148_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427147_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427146_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427144_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427143_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427142_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427141_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPLAYRPPNAPILSTLPENTVVR
MT427140_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427139_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427137_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427136_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427135_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427134_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427131_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427130_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427129_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427128_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427127_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427125_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427124_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427122_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427120_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427119_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427117_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427116_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427115_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427114_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MT427110_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN967529_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN967528_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN967527_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN507848_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN507846_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN507845_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MN507843_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MK720632_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MK720631_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MK321264_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH918655_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH725114_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH725042_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH725021_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH725020_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580652_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580651_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580649_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580647_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580646_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580644_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580638_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580637_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580636_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580635_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580634_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580633_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPQAYRPPNAPILSTLPETTVVR
MH580632_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580631_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580630_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580629_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580628_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580625_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580624_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580623_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580622_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580621_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580620_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580619_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580618_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580617_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580616_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH580615_HBc_P-E      LWFHISCLTFGRETVIEYLVSFGVWIRTPPAYRPPNAPILSTLPENTVVR
MH464855_HBc_P-E      LW