HBVdb

Dataset for protein HBx of genotype D

[Download (right click)] [Sequences] [Repertoires]

2253 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KT749823_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVPTDHG
JN792908_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
EF103281_HBx_P-D      MAARLRCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
AB048701_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
AB078031_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB090268_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB090269_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGNLSSPSPSAVSSDHG
AB090270_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB104709_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
AB104710_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB104712_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB109475_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109476_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109478_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB109479_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB116266_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSSVSSDHG
AB119251_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119252_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119253_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119254_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB119256_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTPSSPSPSAVSSDHG
AB126581_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB188241_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHG
AB188242_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
AB188244_HBx_P-D      MAARLCCQLDPARDVLCLRPFGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB205127_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB205128_HBx_P-D      MAARLCCQLDLARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSSDHG
AB210820_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSTDHG
AB222709_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB222710_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPFGTLSSPSPSAVSTDHG
AB222711_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSSPSPSAVSTDHG
AB222712_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB222713_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSSDHG
AB246347_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
AB246348_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
AB270537_HBx_P-D      MAARLCCQLDPAWDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB270539_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVPPDHG
AB270540_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB270541_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB270542_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSSDHG
AB270543_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB270546_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB270548_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTVSSPSLSAVSTDHG
AB270549_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB270550_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESCGRPVSGPFGTLSSPSPSAVSTDHG
AB330367_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSPSAVSSDHG
AB330369_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB493846_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB555496_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPHPFAVSSDHG
AB555497_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPPPSAVSSDHG
AB555501_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPPSAVSSDHG
AB674403_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXLSSPSPSAVSTDHG
AB674404_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674405_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674406_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674407_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674408_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674409_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674411_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674413_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674414_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AB674415_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSSDHG
AB674416_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674417_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674419_HBx_P-D      MAARLCCQLDPARDVLCLRPVEAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674420_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLRSLSSPSPSAVSTDHG
AB674422_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674423_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
AB674424_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674425_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674426_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGTLGTLSSPSPSAVSTDHG
AB674427_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674428_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674429_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AB674430_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
AB674431_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
AF043593_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
AF121239_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
AF151735_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AJ131956_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
AJ344116_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPLSGPLGTISSPSPSAVSTDHG
AJ627215_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSVHG
AJ627216_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSVHG
AJ627219_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
AJ627220_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPTAVSTDHG
AJ627222_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVXTDHG
AJ627223_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPVSGSLGTLSSPPPSAVSTDHG
AJ627224_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
AM422939_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AY090452_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY161150_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161157_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHG
AY161158_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSTDHG
AY161159_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY161160_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY233291_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGSLSSPSPSAVPTDHG
AY233292_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
AY233294_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
AY233296_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AY236160_HBx_P-D      MAARPCCQLDPARDVLYLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AY236162_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
AY236164_HBx_P-D      MAARLSCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AY661792_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY661793_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
AY721605_HBx_P-D      MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY721607_HBx_P-D      MAGRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721608_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721609_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
AY721610_HBx_P-D      MAVRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721611_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
AY721612_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY741794_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
AY741797_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
AY741798_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY796030_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
AY796031_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGIFSSPSPSAVSSDHG
AY796032_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
DQ111986_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ304547_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
DQ304548_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
DQ304550_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
DQ315778_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHG
DQ329356_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPAAVPTDHG
DQ336674_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336680_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336681_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336682_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSQSAVSTDHG
DQ336686_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336690_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ399006_HBx_P-D      MAARLCCQLDPARDVLCLRPVVAESRGRPFSGPLGTLSSPSPSAVSSDHG
DQ464168_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ464169_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ464174_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ464175_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPRNHG
DQ464178_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSTSPSAVPTDHG
DQ464181_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVPTDHG
DQ486021_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ486023_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLPSPSPSAVSPNHG
DQ486025_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLSSPSPSAVPTDHG
EF103275_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVPSDHG
EF103276_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EF103279_HBx_P-D      MAGRLCCQRDLARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EF103280_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSTSAVSTDHG
EF594771_HBx_P-D      MAVRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
EF594774_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF594775_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF594776_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
EU155893_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
EU414135_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EU414138_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU414139_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
EU414140_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTNHG
EU414141_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPYPSAVPTDHG
EU414142_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU414143_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU594382_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU594396_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
EU594397_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594398_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594400_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594401_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594404_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594409_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594411_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594412_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594415_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594422_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594430_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
EU594433_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
EU594434_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EU787437_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSTVSTDHG
EU787438_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787440_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
EU787442_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
EU787443_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EU787447_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
EU919197_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
EU921418_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGALSSPSPSAVPTDHG
EU939681_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349206_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPPAVSSDHG
FJ349208_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSSDHG
FJ349211_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349213_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSTGTLSSPSPSAVPTDHG
FJ349214_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349215_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349216_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349229_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
FJ349231_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGSLGTLSSPSPSAVSTDHG
FJ349235_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
FJ386590_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
FJ562309_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSSDHG
FJ562338_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFEGSLGTLSSPSPSAVPTDHG
FJ692532_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSSSLPAVPTDHG
FJ692533_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRTLSSSSLPAVPTDHG
FJ876242_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ876253_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ876254_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ876256_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ876257_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
FJ899792_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ904395_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904399_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVSTDHG
FJ904402_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
FJ904410_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSSSLPAVPADHG
FJ904412_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
FJ904415_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSNHG
FJ904418_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
FJ904419_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904420_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSNHG
FJ904422_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904424_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ904426_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ904427_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ904429_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
FJ904432_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRRRPLSGPLGTLSSPSPSAVSTDHG
FJ904433_HBx_C-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGGLSSPSLPAVPTDHG
FJ904435_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGDLSSSSLPAVPADHG
FJ904438_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904439_HBx_P-D      MAARLCCQLDPTRDVLCLRPLGAESCGRPFSGPLGDLSSSSLPAVPADHG
FJ904443_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
FJ904445_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
FJ904446_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
GQ183457_HBx_P-D      MADRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183460_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183463_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183471_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183472_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183473_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
GQ183476_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGQPFSGPLGTLSSPSPSAVSSDHG
GQ183478_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GQ183484_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
GQ205380_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205382_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
GQ205384_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLRSLSSSPPSAVPTDHG
GQ205385_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ205388_HBx_P-D      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
GQ377589_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ477452_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477453_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477455_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
GQ477457_HBx_P-D      MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
GQ477458_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
GQ477459_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSPSPSAVSTDHG
GQ922000_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
GQ922001_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPPPSAVPTDHG
GQ922002_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPPPSAVPTDHG
GQ922003_HBx_P-D      MAARLCCQLDPARDXLCLRPLSAESRGRPXSGPLGPLSSSSLPAVPTDHG
GQ922004_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPISXPLGSLSSSSLPAVPTNHG
GQ922005_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPLSGPLGPLSSSSLPAVPPDHG
GU456635_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456636_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
GU456637_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLASPSPSAVSTDHG
GU456638_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GU456639_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456640_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456641_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456642_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSPPSPSTVSTDHG
GU456643_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPHPSAVSTDHG
GU456644_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVSTDHG
GU456645_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPTPSAVSTDHG
GU456646_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456647_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456648_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDYG
GU456649_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456650_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPASSAVSTDHG
GU456651_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTISSSSPSAVSTDHG
GU456652_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVPTDHG
GU456653_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456657_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSSSPSAVSTDHG
GU456658_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456662_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDYG
GU456664_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSPSPSAVSTDHG
GU456665_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456666_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
GU456667_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456668_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPTPSAVSSDHG
GU456669_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSASPSAISTDHG
GU456670_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
GU456671_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GU456672_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHG
GU456673_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
GU456674_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSTPSPSAVSTDHG
GU456675_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456676_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGXLGTLSSPSPSAVSTDHG
GU456677_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456678_HBx_P-D      MAARLCCQLDPARDVLYLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GU456679_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPFGTLSSPSPSAVSTDHG
GU456680_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSPSPSAVSTDHG
GU456681_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
GU456682_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTATVSTDHG
GU456683_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456684_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HM750151_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFAGSLGTLSSPSPSAVPTDHG
HM750152_HBx_P-D      MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
HM750153_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
HM750154_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HM750155_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HM750156_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ236014_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
HQ236015_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
HQ236016_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAIPTDHG
HQ700439_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700440_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700442_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700445_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSTSAVSTDHG
HQ700446_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSTSAVSTDHG
HQ700454_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSPPSTSAVSTDHG
HQ700455_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSPPSTSAVSTDHG
HQ700458_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
HQ700466_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700467_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700468_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700469_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700471_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPIPGPLGTLSSPSTSAVSTDHG
HQ700472_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HQ700473_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700474_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700477_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700478_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700479_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGTLSSPSTSAVSTDHG
HQ700480_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTISSPSTSAVSTDHG
HQ700481_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTISSPSTSAVSTDHG
HQ700482_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSTSAVSTDHG
HQ700483_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HQ700489_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700510_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ700511_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
HQ700512_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ700514_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ833465_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833466_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833467_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
HQ833468_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
HQ833469_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
HQ833471_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSPISTDHG
JF754590_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754592_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JF754593_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
JF754594_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754595_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754597_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
JF754598_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF754600_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSTDHG
JF754603_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754604_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPFGTFSSSSPSAVSTDHG
JF754605_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
JF754606_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSTSAVSTNHG
JF754607_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754608_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JF754609_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754610_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JF754611_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754612_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754614_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
JF754615_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGTLSSSSPSAVSTDHG
JF754617_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754619_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754621_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSPSPSAVSSDHG
JF754622_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754624_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
JF754625_HBx_P-D      MAARLCCQLDPARDVLCLRPVGTESRGRSFSGSLGTFSSPSPSAVPTDHG
JF754627_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JF754628_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JF754629_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
JF754630_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754631_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
JF754632_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
JF754633_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754634_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSXSAVSTDHG
JF754635_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF911682_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLLSPSPSAVSTDHG
JF911683_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF911685_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JF911687_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JF911690_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPTPSAVSTDHG
JN040750_HBx_P-D      MAARLCCQLDPARDVLCLRPFGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040751_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040752_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN040753_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSHSAVSTDHG
JN040754_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
JN040755_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040756_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESGGRPFSGPLGTLSSPSPSAVSTDHG
JN040757_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040758_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040759_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
JN040760_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040761_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040762_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPVSGPLGPFSSPSPSAVSTDHG
JN040766_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
JN040767_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSTDHG
JN040768_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN040770_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
JN040771_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040772_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040773_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040774_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
JN040775_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040776_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGTLSSPSPSAVSTDHG
JN040777_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040778_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSTDHG
JN040779_HBx_P-D      MAARLYCQLDPARDVLCLRPVVPESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040781_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN040782_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPHPSAVSSDHG
JN040783_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040784_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
JN040785_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040786_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
JN040787_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040788_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040790_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
JN040792_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040794_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTISSSSPSAVSTDHG
JN040795_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSPSAVSTDHG
JN040796_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040797_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040799_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040800_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040801_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040802_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSSSPSAVSTDHG
JN040804_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040805_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040806_HBx_P-D      MAARLRCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040807_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040808_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTISSPSPSAVSTDHG
JN040809_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
JN040810_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040811_HBx_P-D      MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040812_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
JN040813_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVSTDHG
JN040814_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSPSTSAVSTDHG
JN040815_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040817_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
JN040818_HBx_P-D      MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPPAVSTDHG
JN040819_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
JN040820_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSTVSSDHG
JN040821_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSSDHG
JN040822_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSADHG
JN040823_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
JN040824_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040826_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSSVSTVHG
JN040828_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN040830_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
JN257149_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPXSGPLGTLSSPSPSAVSTDHG
JN257150_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257152_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSSDHG
JN257153_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPXPSAVSPNHG
JN257159_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPTSAVSTDHG
JN257160_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN257162_HBx_P-D      MAARLCCQLDPXRNVLCLRPVGAESRGRPFSGPLGTLSSPSPXAVSTNHG
JN257163_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257165_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
JN257170_HBx_P-D      MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257172_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
JN257176_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257178_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN257179_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSSDHG
JN257181_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN257183_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257185_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257187_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JN257190_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLTSPSPSAVSTDHG
JN257193_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
JN257195_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSPNHG
JN257200_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
JN257202_HBx_P-D      MAARLCCQLDPARDVLCXRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257203_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257205_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257209_HBx_P-D      MAARMCCQLDTARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHG
JN257211_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSADHG
JN574723_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN574725_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
JN574728_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
JN642126_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642128_HBx_P-D      MAARLCCQLDPARDVLCLRPVGDESRGRPFSGPLGTLSSPSPSAVSPNHG
JN642129_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642130_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642132_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642133_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSLSAVSTDHG
JN642135_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642136_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
JN642138_HBx_P-D      MAARLCCQLDPARDVLCLRPFGAESRGRPVSGPLGTLTSPSPSAVSTDHG
JN642140_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPSAVSTDHG
JN642142_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642143_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN642144_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
JN642145_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN642146_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSQSAVSTNHG
JN642147_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGNLSSPSPSAVSTDHG
JN642148_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALTSPSPSAVSTDHG
JN642149_HBx_P-D      MAARLYCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642150_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSLSAVSTDHG
JN642151_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642153_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPSPSAVSTDHG
JN642154_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSTDHG
JN642155_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642156_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
JN642157_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642158_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
JN642159_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHG
JN642161_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
JN642162_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLTSPSPSAVSTDHG
JN642163_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVSTDHG
JN642165_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642166_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
JN642167_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTFSSPSPSAVSTDHG
JN664909_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664910_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSSSPSAVPTDHG
JN664912_HBx_P-D      MAARLCCQLDLARDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
JN664913_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664918_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
JN664919_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLTSPSPSAVPTDHG
JN664921_HBx_P-D      MAARLCCQLDPARDILCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664926_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
JN664927_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLASPSPSAVSSDHG
JN664931_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSSHHG
JN664939_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JN664941_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSSSAVSSDHG
JN664947_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGPRSSSHPSAVPTDHG
JN688678_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDYG
JN688679_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN688683_HBx_P-D      MAARLXCQLDPXRDVLCLRPVGAESRGRPXSGXLGTLSSPSPSAVPXDHG
JN688685_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLPSPSPSAVPTDHG
JN688695_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN688708_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPXSGXLGTXSSPSPSAVPTDHG
JN688710_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN688711_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN688712_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN688713_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN688722_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
JN792903_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792904_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792911_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792912_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JQ032005_HBx_P-D      MAARLCCQLVPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
JQ032006_HBx_P-D      MAARLCCHGVPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JQ032007_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
JQ272897_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPSAVSSDHG
JQ518361_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSTDHG
JQ687530_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
JQ687531_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSSDHG
JQ707476_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707477_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707483_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707489_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPLGTRSSPSPSAVSSDHG
JQ707491_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707493_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRPSPSPSAVSSDHG
JQ707494_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707497_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707498_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707506_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707508_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSSSAVSSDHG
JQ707509_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707510_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707511_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707526_HBx_P-D      MAARLCCQLDPTRDVLCFRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707528_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707530_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSLSAVSSDHG
JQ707682_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707687_HBx_P-D      MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707688_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ927384_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPLGTLPSPXTPAVSSDHG
JX096954_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
JX096955_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSPSPSAVSTDHG
JX096957_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
JX470760_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
JX898689_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898697_HBx_P-D      MAARLXCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KC012652_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
KC774436_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPAGTLSSPSPSAVPTDHG
KC774437_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC774440_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESSGRPFSGPLGTLSSPSPPAVSTDHG
KC774444_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESGGRPFSGPLGTLSSPSPPAVSTDHG
KC774445_HBx_P-D      MAVRLCCQLDRARDVLCLRPVGAESRGRPFSGPLGILLSLCPFAVSSDPG
KC774459_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
KC774460_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFQGPAGTLSSPSPSAVPTDHG
KC774462_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC774477_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLLSPSPSAVSSDPG
KC875275_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875276_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875278_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875279_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
KC875281_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875282_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875283_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875284_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875286_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875287_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875291_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875293_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875299_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875300_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875301_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875302_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875303_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875304_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875306_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875311_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KC875312_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KC875314_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875315_HBx_P-D      MAARLCCQLDPARDVLCLRPGGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875316_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTLSSPSPSAVPTDHG
KC875318_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSTSAVPTDHG
KC875320_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875324_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875325_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875328_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875329_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875330_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875331_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875333_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875335_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875340_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KC875342_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSHPSAVPTDHG
KF018208_HBx_P-D      MAARVCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF018210_HBx_P-D      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF061167_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KF061170_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KF170739_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF192830_HBx_P-D      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF471640_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF471641_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSQSAVSTDHG
KF471642_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471644_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471645_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSTSAVSTDHG
KF471646_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471647_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTFSSPSPSAVSTDHG
KF471651_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KF471653_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTAAVSTDHG
KF471654_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471655_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF471658_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471660_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
KF679990_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSFGTLTSPSPSAVPTDHG
KF679992_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KF679995_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVSSDHG
KF679997_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF922432_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALSSSSLPAVPTDHG
KJ470885_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470889_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470893_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470894_HBx_P-D      MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470895_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ470896_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
KJ647352_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSSSPSAVSTDHG
KJ647353_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSRSLGTLSSPSPSAVPXDHG
KJ647355_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KJ843187_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
KJ997852_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ997860_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ997861_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM519455_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KM524338_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPPAVPTDHG
KM524339_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAISSPPPSAVSTDHG
KM524341_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524344_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KM524345_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KM524346_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KM524347_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
KM524348_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KM524349_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KM524352_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
KM524356_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTFSSPSPSAVPTDHG
KM524358_HBx_P-D      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KM577668_HBx_P-D      MAARLCCQLDTARDVLCLRPVSAESRGRPVSGPLGTLASPSPSAVSTDHG
KM577669_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLASPSPPAVSTDHG
KM577670_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLASPSPSAVSTDHG
KM606744_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHG
KM606745_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESSGRPFSGSLGTLSSPSPSAVPTDHG
KM606752_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTVHG
KM606753_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
KM606754_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHG
KM606755_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTLSSSSLPAVPTDHG
KP090177_HBx_P-D      MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KP090179_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTAHG
KP168419_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPVSRPLGTLPSPSTPPVSPDHG
KP317981_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP317983_HBx_P-D      MAARLCCQLNPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP995100_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KR811561_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812075_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812091_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812092_HBx_P-D      MAARLCRQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPYPSAVSTDHG
KR812093_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPYPSAVSTDHG
KR812105_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPYPSAVSTDHG
KR812106_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KT151620_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT235615_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPPSAVSTDHG
KT235621_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
KT347090_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KT366491_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSVVSSDHG
KT366493_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSSDHG
KT366499_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSHSTSALSTDHG
KT366508_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDVSSPSPSAVSTDHG
KT749821_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
KT749827_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFAGPLGTLSSPSPSAVSSDHG
KT749828_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
KT749845_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KT963508_HBx_P-D      MAARMCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KU668434_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668436_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668439_HBx_P-D      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KU668447_HBx_P-D      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KU668448_HBx_P-D      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KU668449_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLASPSPSAVSSDHG
KU736924_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KU736926_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KU736927_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
KX276856_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KX276857_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
KX357622_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVPPDHG
KX357638_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSTDHG
KX357639_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTHSSPSPSAVSTDHG
KX423692_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX423693_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSNHG
KX423695_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPPAVSSDHG
KX423696_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
KX423698_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KX423706_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KX423707_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
KX423710_HBx_P-D      MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPFGTLSSPSPSAVSSDHG
KX423711_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KX423719_HBx_P-D      MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPFGSLSSPSPSAVSSDHG
KX827290_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSTVSTDHG
KX827292_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KX827300_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
KX827301_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
KY629630_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSLSAVSTDHG
KY629633_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KY629634_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
L27106_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
LC365689_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
LC705462_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
LT992454_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPPDHG
M32138_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MF618341_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF618342_HBx_P-D      MAARLCCQLDPARGVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
MF618343_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MF618349_HBx_P-D      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
MF925363_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MF925366_HBx_P-D      MAARLCRRLEAARDVLCLRPVGAESRGRPLPGPLGALPSPSPSAVPTDHG
MF925379_HBx_P-D      MAARLFCQLDPARDVLCLRPVGAESRGRPLPGPLGALPSPSSSAVPTVHG
MF925383_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MF925390_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSSDHG
MF925391_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSADHG
MF925393_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MG776378_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776379_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
MG776382_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776384_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776386_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776387_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTNHG
MG776389_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALASPSPSAVSTDHG
MG776391_HBx_P-D      MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776392_HBx_P-D      MAARLCCQLDPARDVLCLRPIGAESRGRPFAGPLGTFSSPSPSAVSTDHG
MG776393_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776396_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSSSAVSTDHG
MG776397_HBx_P-D      MAARLCCQLGPARDVLCLRPVSAESRGRPFSGPLGTLPSPAASAVPPNHG
MG776398_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776401_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776402_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776405_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776409_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MG776410_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSSDHG
MG776412_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAISTDHG
MG776415_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776416_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776417_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776419_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776421_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776424_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSTDHG
MG776428_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPCTVSTDNG
MG776433_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSPSAVSTDHG
MG776435_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776436_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776438_HBx_P-D      MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776439_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776440_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPPAVSADHG
MG776441_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSSDHG
MG776442_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776443_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776444_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776451_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776452_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776457_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776461_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776462_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776464_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776473_HBx_P-D      MVVRLCCQQDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
MG776476_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSTSAVSTDHG
MG776477_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776483_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776484_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSASAVSTDHG
MG776487_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776490_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776491_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
MG776495_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776496_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776497_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
MG776498_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSPSAVPTDHG
MG776500_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776502_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776505_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776507_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776509_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776511_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776516_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776518_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776520_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
MG776522_HBx_P-D      MAARLCCQLDPARDVXCLRPVGAESRGRPFSGPLGTFSSPSPSXVSTDHG
MG776524_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776525_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
MG776527_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776528_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776529_HBx_P-D      MAARVCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776532_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776535_HBx_P-D      MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776536_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776539_HBx_P-D      MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776543_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776544_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTFAVSTDHG
MG776546_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTNHG
MG776547_HBx_P-D      MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MG776548_HBx_P-D      MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776549_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776553_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776555_HBx_P-D      MAARLCCQLDPARDVVCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776558_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776559_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPTNHG
MG776563_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVSTDHG
MG776566_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776567_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776568_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776571_HBx_P-D      MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776572_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776574_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776576_HBx_P-D      MATRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776578_HBx_P-D      MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTLSSPSASAVSTDHG
MG776579_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776581_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776582_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSACAVPPNHG
MG776585_HBx_P-D      MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776590_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSADHG
MG776592_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776593_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776594_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVPTDHG
MG776595_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776597_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776599_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776600_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776602_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776603_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776604_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776606_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSTDHG
MG776610_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776611_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGPLSSPSPSVVSTRHG
MG776612_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776613_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776616_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776619_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
MG776623_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MG776624_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRRRPFSGPLGSLSSPSPSAVSTDHG
MG776625_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776628_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776630_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSTDHG
MG776632_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776633_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776634_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776636_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776638_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776639_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776642_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776644_HBx_P-D      MAARLCCQPDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776647_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776648_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPPAVSTDHG
MG776649_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776651_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776653_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776654_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPTNHG
MG776655_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLTSPSPSAVSTDHG
MG776657_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPFAVSADHG
MG776658_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVPTDHG
MG776666_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776667_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776668_HBx_P-D      MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776670_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776676_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776679_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776680_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776682_HBx_P-D      MAARMSCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776683_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776687_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776688_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776691_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSTAAVSTDHG
MG776692_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776695_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776710_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
MG776712_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776713_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSRTLGTLSSPSPSAVSTDHG
MG776714_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSPNHG
MG776718_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776723_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTIHG
MG776725_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
MG776726_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776731_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776732_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776736_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSASAVSPNHG
MG776738_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
MG776742_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776747_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTFSSPSPSAVSSDHG
MG776748_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTFSSPSPSAVSSDHG
MG776749_HBx_P-D      MAARLYCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPYPSAVSTDHG
MG776751_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MG776754_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776756_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAFSSPSPSAVSTDHG
MG776757_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSTDHG
MG776759_HBx_P-D      MAARLCCKLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776760_HBx_P-D      MAARLCCKLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776761_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGTPGTLSSPSPSAVSTDHG
MG776763_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776765_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776766_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776768_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSADHG
MG776770_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVPTDHG
MG776776_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776777_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776778_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776781_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MG776784_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776785_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVPPNHG
MG776789_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MG776790_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776791_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MG776792_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSASAVPPNHG
MG776793_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
MG776794_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSASAVSTDHG
MG776796_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG877718_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSPSAVPTDHG
MG877719_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSPSAVPTDHG
MH464834_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464836_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464838_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464839_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464841_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPXDHG
MH464844_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH464854_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRRRPLSGSLGTLSSPSPSAVPTDHG
MH724215_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDNG
MH724217_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724223_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724225_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724226_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724232_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MH724233_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MH724235_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724236_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
MH724237_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724238_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPFPSAVSTDHG
MH724241_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724242_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724244_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724245_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
MH724247_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724251_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
MH724252_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MK052947_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052948_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MK052949_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052950_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052952_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MK052954_HBx_P-D      VAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MK052956_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052959_HBx_P-D      MAARLCCQLDPARDVPCLRPVSAESGGRPVSGPPGTLSSPSPSAVPPDHG
MK052960_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPPPSAVPPDHG
MK052961_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPTDHG
MK052963_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052971_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052972_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052974_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPNHG
MK355500_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK355501_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTNHG
MK507911_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
MK507912_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSTDHG
MK507913_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MK516278_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MK541688_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MK598636_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK598637_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGLPFSGPLGDLSSPSPSAVSTDHG
MK598638_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK598639_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598640_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MK598641_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MK598643_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
MK598644_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MK598645_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598648_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSSPSPSAVSTDHG
MK598649_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598655_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598657_HBx_P-D      MAARLCCQLDPARDVLCLRPLSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598661_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MK598668_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598669_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPFGTLSSPSPSAVSTDHG
MK598673_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGALSSPSPSAVSTDHG
MK598674_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSTDHG
MK598677_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598679_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618423_HBx_P-D      MAARLCCQLDPPRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MK618424_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGPLGTPSSPSPSAVSSDHG
MK618426_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618427_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVSTDHG
MK618428_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSTVSTDHG
MK618430_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
MK618434_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MK618437_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTFSSPSPSAVSSDHG
MK618441_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTPSSPSPSAVSTDHG
MK618443_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MK693107_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK693108_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGSLGTLSFPSPSAVSTDHG
MN066376_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066378_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MN066381_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066382_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
MN066383_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066385_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066386_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MN066387_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066388_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MN066389_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAASSDHG
MN066390_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
MN066394_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSDHG
MN066395_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066398_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066401_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSSDHG
MN066402_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066403_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MN066406_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066407_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSSDHG
MN066408_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182658_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182659_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182661_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSSDHG
MN182662_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MN182664_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTFSSPSPSAVSSDHG
MN182670_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MN182675_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MN182676_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182683_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182685_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSSDHG
MN182690_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN310706_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MN310708_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310715_HBx_P-D      MAXRLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTVSSPSPSAVPTDHG
MN476100_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESCGRPFSGPLGDLSSPPLSAVPTDHG
MN507837_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSTDHG
MN585095_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTNHG
MN839643_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MN844881_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTFSSPSPSAVSPNHG
MN844882_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MT114169_HBx_P-D      MAARLCCQLDPARDVVCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTNHG
MT114172_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MT579899_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT591276_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESSGRPFSGPLGTLSSPSPSAVSTDHG
MT591277_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESSGRPFSGPLGTLSSPSPSAVSTDHG
MT591278_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MT591279_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MT591281_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPIGGLSPPPLPAVPTDHG
MT603383_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVRTLSSPPPSAVSTDHG
MT603384_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603385_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVRTLSSPHPSAVSTDHG
MT603387_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPHPSAVSTDHG
MT603388_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVRTLSSSHPSAVSTDHG
MT603389_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603390_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPHPSAVSTDHG
MT603392_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSRQVGTLSSPPPSAVSTDHG
MT603393_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603394_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603395_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSSDHG
MT603396_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVXTLSSPPPSAVSTDHG
MT603397_HBx_P-D      MAARLCCQLDPTRDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603398_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVRTLSSPPPSAVSTDHG
MT603399_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603400_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVRTLSSPPPSAVSTDHG
MT603404_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MW455166_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601228_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSPDHG
MW601229_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MW601231_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTYHG
MW601234_HBx_P-D      MAARLCCQLDPARDVLCLRPVDAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601237_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSSGHG
MW601238_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MW601240_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSTDHG
MW601242_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601243_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSADHG
MW601244_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSAVHG
MW601245_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGTLSSPSPSAVSTDHG
MW601246_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGDLSSPSPSAVSSDHG
MW601247_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGALSSPSPYAVSADHG
MW601249_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601250_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601253_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MW601254_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601255_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPIGPLSSPSPSAVSTNYG
MW601256_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601257_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601261_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601262_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPDHG
MW601263_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MW601265_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601266_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFRTLSSPSPSAVSTDHG
MW601267_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601268_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPAGTPSSSSPSAVSSDHG
MW601270_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSSDHG
MW601271_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MW601273_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MW601274_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFRTLSSPSPSAVSTDHG
MW601275_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSAVPTDHG
MW601276_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPPAVSSDHG
MW601277_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTVSSPSPSAVSTDHG
MW601278_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPSSPAVSADHG
MW601279_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MW601280_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601281_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGGLSSPSPSAVSSDHG
MW601282_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601285_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601286_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGAFSSPSPSAVPTDHG
MW601287_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601288_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MW601289_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601290_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601291_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MW601292_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MW601293_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSSDHG
MW601294_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSSPAVSTDHG
MW601295_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601297_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSSDHG
MW601299_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601300_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601301_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601303_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601305_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601307_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLSSPSPSAVSTDHG
MW601308_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDDG
MW601311_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601312_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601314_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGAVSSSSLPAVPADHG
MW601315_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601316_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPSAVSSDHG
MW601318_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MW601319_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSTVSTDHG
MW601320_HBx_P-D      MAARLYCQLDPARDVLCLRPVVAESRGRPVSGPLGTLSSPSPPAVSSGLG
MW601321_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGTPGTLSSPSPSAVSTDHG
MW601323_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSRPLGSLSSPSLPAVPTDHG
MW601325_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601326_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601328_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPISGSLGGLSSPSPSAVSSDHG
MW601329_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MW601330_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MW601331_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MW601332_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MW601333_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MW601334_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601335_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601336_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MW601337_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MW601339_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSPGTLSSPSPSAVSTDHG
MW675897_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPPAVPTDHG
MW675898_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097624_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLPSPSPSAVSSDHG
MZ097625_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MZ097626_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ097627_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
MZ097628_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ097631_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPPGTLSSPSPSAVSTDHG
MZ097632_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097633_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLPSPSPSAVSSDHG
MZ097634_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGALSSPSPSAVSSDHG
MZ097635_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097636_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MZ097637_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSTDNG
MZ097638_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097639_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGXLSSPSPSAVSTDHG
MZ097641_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGGLSSPSPSAVSSDHG
MZ097642_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097643_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097645_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097646_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097647_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
MZ097651_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097653_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTXSSPSPSAVSTDHG
MZ097654_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPPAVSSAHG
MZ097655_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097656_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTVSSPSPSAVPTDHG
MZ097657_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097659_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDLSSPSPSAVSSDHG
MZ097660_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MZ097661_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097662_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097663_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPAPSAVSTDHG
MZ097664_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSXSPSAVSTDHG
MZ097665_HBx_P-D      MAARLCCQLDPXRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097668_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGDLSSPSPSAVSSDHG
MZ097669_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGSLGTFSSPSTSAVSADHG
MZ097670_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097671_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097672_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097673_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHG
MZ097674_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097675_HBx_P-D      MAARLCCQLDPARNVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097676_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097677_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097679_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ097682_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097683_HBx_P-D      MAARLXCQLDPARDVLCLRPVGAESRGRPFSGPLGXLSSPSPSAVSSDHG
MZ097684_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097685_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097686_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097689_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGSLGTLSSPSSIAVSTDHG
MZ097690_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGTLGTLSSPSPSAVSTDHG
MZ097691_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSWALGTLSSPSPSAVSSDHG
MZ097692_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097693_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097694_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MZ097695_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPPAVSTDHG
MZ097696_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDHG
MZ097697_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPTDHG
MZ097698_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097699_HBx_P-D      MAARLCCQLDPARNVLCLRPVGAESRGRSFSGPLGALSSPSPSAVSTDHG
MZ097700_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSASAFSANHG
MZ097701_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSXDHG
MZ097704_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097705_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097707_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGALSSPSPSAVSTDHG
MZ097708_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPSAVSSDHG
MZ097709_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTNHG
MZ097710_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGALSSPSPSAVSSDHG
MZ097711_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGPLSSPSPSAVSTNHG
MZ097713_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRRRPVSGPLGTLSSPSPSAVSTDHG
MZ097714_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097720_HBx_P-D      MAARLCCQLDPARDVLCLRPVDAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097729_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPXSGSLGDLSSPSPSAVSSDHG
MZ097730_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPXSGPLGTLSSPSPSAVSTDHG
MZ097733_HBx_P-D      MAARLCCQLDPARDVLCXRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097734_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097742_HBx_P-D      MAARLCCQLDXARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPDHG
MZ097743_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLRPLSSPSPSAVSTDHG
MZ097748_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MZ097749_HBx_P-D      MXGRLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097751_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097752_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097756_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097764_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MZ097765_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSSPAVSTDHG
MZ097768_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MZ097769_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097770_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTBHG
MZ097771_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097772_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097778_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097779_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSSSPSAVSTDHG
MZ097780_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097782_HBx_P-D      MAARXCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097784_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSRPLGSLSSPSLPAVPTDXG
MZ097785_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ097787_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097789_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097792_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGGLSSPSPSAVSTDHG
MZ097794_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPISGSLGGLSSPSPSAVSSDHG
MZ097795_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPPSAVSTDHG
MZ097796_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ097797_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097798_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPYPSAVSTDHG
MZ097799_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGGLSSPSPSAVSSNHG
MZ097800_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGGLSSPSPSAVSSNHG
MZ097801_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097802_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSASAVPTDHG
MZ097803_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALASPSPSAVPTDHG
MZ097804_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPISGSLGTLSSPSPSAVPTDHG
MZ097805_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097809_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDLG
MZ097810_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ097811_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
MZ097812_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPPSSPSPSAVSTDHG
MZ097815_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097816_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097817_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097818_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTNHG
MZ097819_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097820_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MZ097821_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097823_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097824_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097825_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097827_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097828_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097829_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097830_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097832_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097833_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MZ097834_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLRTLSSPSPSAVSTDHG
MZ097836_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFEGPFGTLSSPSPSAVSTBHG
MZ097837_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097839_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097840_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097841_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
MZ097842_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MZ097843_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSFAVSTDHG
MZ097844_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097845_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097846_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSAIHG
MZ097847_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGDLSSPSPSAVSSDHG
MZ097848_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097851_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097853_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097855_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097857_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPVGTLSSPSPSAVSTDHG
MZ097858_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSSSPSAVSTDHG
MZ097860_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSTSAVSTDHG
MZ097863_HBx_P-D      MAARLCCQLDPARDVLCLRPVGVESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097864_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTFASPSPSAVPPDHG
MZ097865_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFEGPFGSLSSPSPSAVSTDHG
MZ097866_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097867_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSSDHG
MZ097869_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPXGSLSSSPPSAVPTDHG
MZ097870_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MZ097871_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097872_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097873_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPAPSAVSSDHG
MZ097875_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097877_HBx_P-D      MAARLCCQLDPARDVLYLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097878_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDNG
MZ097879_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097880_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097881_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPXPSAVSTDHG
MZ097882_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSAPSPSAVPTDHG
MZ097884_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGDXSSPSLPAVPTDHG
MZ676995_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGALSSPSPSAVSTDHG
MZ711090_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MZ711091_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ711092_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ740067_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ820046_HBx_P-D      MAAKLCCQLDPAGDALCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ820047_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPDHG
MZ820050_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ820054_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ889444_HBx_P-D      -AARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
OK127811_HBx_P-D      -AARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OK143467_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
OK143468_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
OK143472_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OK143473_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
OK143474_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPVSGPLGTLSSPSPPAVSTDHG
OK143476_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
OK143479_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTVDG
OK143480_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
OK143486_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPVSGSLGTLSSPSPSAVPTVDG
OK143487_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
OK143488_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSSSPSAVPTDHG
OK143490_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
OK143496_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLGPLSSPSPSAVSSDHG
OK998522_HBx_P-D      MAARVCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
OK998524_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
OK998527_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSPSAVSSDHG
OL362106_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSXDHG
OL362107_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
OL362108_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPXSGPLGTLSSPSPSAVSTNHG
OL362109_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
OM025254_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
OM304310_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDVSSPPASAVSTDHG
OM304311_HBx_P-D      MADRLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTFPSPSTSAVSPDHG
OM304312_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSTDHG
OM304313_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
OM304314_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
OM304316_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPTAVSSDHG
OM304317_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
OM304318_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSFSTPSPSAVSSDHG
OM304322_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OM304323_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSSSPSAVSTDHG
OM304324_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OM304325_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
OM304327_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
OM333239_HBx_P-D      MAARQCCQLDPSGHVLCLRPVGGKSRGGTFVGPLGPLSSPSPSAVSSDHG
OM721315_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
OM721316_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGSLGTLSSPTPSAVSTDHG
ON346437_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLSAVPADHG
ON346438_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGTLSSPSLSAVSADHG
ON346439_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSLSAVSADHG
ON346440_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSASLSAVPTDHG
ON346441_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPTDHG
ON346442_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPLPAVPADHG
ON346443_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSASLSAVPADHG
ON346444_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVSTDHG
ON346445_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346446_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPPLPAVPTDHG
ON346447_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSAPLPAVPADHG
ON346448_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346449_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVSADHG
ON346450_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGTLSSPSLPAVSTDHG
ON346451_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLSAVPTDHG
ON346452_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVPTDHG
ON346453_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVSTDHG
ON346454_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALSSPSLSAVPTDHG
ON346455_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346456_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346457_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSAPLSAVPADHG
ON346458_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSAPLSAVPTDHG
ON346459_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSLPAVPADHG
ON346460_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPPLPAVSTDHG
ON346461_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPPLPAVSADHG
ON346462_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPPLPAVPADHG
ON346463_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSAPLSAVPTDHG
ON346465_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSAPLSAVPADHG
ON346466_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGALSSPSLPAVPADHG
ON346467_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPPLPAVPADHG
ON346468_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSAPLPAVPADHG
ON346469_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPPLPAVSADHG
ON346470_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPPLPAVPADHG
ON346471_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSAPLSAVPTDHG
ON346473_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSLPAVPADHG
ON346474_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLSAVPADHG
ON346476_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSAPLPAVPADHG
ON346477_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSAPLPAVSADHG
ON346478_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSASLPAVSTDHG
ON346479_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPLPAVSTDHG
ON346480_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGALSSPPLSAVPTDHG
ON346481_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSLPAVPADHG
ON346482_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVSTDHG
ON346483_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALSSPPLPAVPADHG
ON346485_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346486_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSASLSAVSADHG
ON346487_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSASLPAVPADHG
ON346488_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSLPAVSTDHG
ON346489_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSAPLPAVPTDHG
ON346490_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346491_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
ON346492_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346493_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSAPLPAVPTDHG
ON346494_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSAPLPAVPADHG
ON346495_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGTLSSPSLPAVPTDHG
ON346496_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFPGPLGTLSSPSLSAVPADHG
ON346497_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346499_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSLPAVPADHG
ON346500_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLPAVPADHG
ON346501_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPPLPAVPADHG
ON346504_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLSAVPADHG
ON346505_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSAPLSAVPADHG
ON346506_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPPLPAVPADHG
ON346507_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPLGTLSSASLPAVPADHG
ON346508_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSLPAVSTDHG
ON346509_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPLGTLSSAPLSAVPTDHG
ON346510_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFTGPLGALSSPPLPAVSTDHG
ON346511_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSAPLSAVPTDHG
ON346512_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSAPLSAVSTDHG
ON346513_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPLGTLSSPPLSAVSTDHG
ON346515_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
ON346516_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFTGPLGTLSSPSLPAVPADHG
ON346517_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFAGPLGTLSSPSLSAVSTDHG
ON346518_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346519_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSASLSAVSADHG
ON346520_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGALSSPPLSAVSTDHG
ON346521_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPPLSAVPTDHG
ON346523_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346524_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346525_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSASLSAVPADHG
ON346526_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON585703_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
S41175_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGALSSPSPSTVSTDHG
S77748_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
X02496_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
X59795_HBx_P-D        MAARLCCQLDPERDVLRLRPVGAESSGRPFSGPLGTLSSPSPSAVSSDHG
X65258_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
X80924_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
X85254_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPLSGSLGTFSSPSPSAVPTDHG
X97848_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
X97849_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
Y07587_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESHGRPFSGSLGALSSPSPSTVSTDHG
AB078032_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB078033_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB267090_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPSDHG
AB119255_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KX423702_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MH932714_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MK598664_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182693_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB104711_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
AB109477_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB110075_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB120308_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB205126_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB210821_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB210822_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB471856_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB471857_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF594773_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183479_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183480_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183481_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183483_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ924652_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JN574729_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KC875310_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679994_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679996_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF679998_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524353_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524354_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KR905424_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT235619_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT235620_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT235623_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT235626_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT235631_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT235637_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT366494_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT366495_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT366496_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT366506_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT366509_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT366510_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT366511_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KX423717_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KX423718_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KX423723_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MG776722_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MK598663_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN066392_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182660_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182678_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182692_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MT114173_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097859_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AF280817_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AY090453_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
EF594772_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183474_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GU357846_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN507838_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN507851_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
OM304307_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
FJ349218_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GQ477454_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX827291_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598659_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598670_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OK998520_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB583680_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121240_HBx_C-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121241_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AF121242_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY721606_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY945307_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU414136_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594399_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594425_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594426_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787436_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787441_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787445_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349234_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ904431_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456660_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456661_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456663_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754601_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754618_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040765_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040791_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040793_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257151_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257171_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642164_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471656_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471659_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584160_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584161_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584162_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584163_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584164_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584165_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF584166_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KM524342_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP317982_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP322600_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP322601_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KY382412_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KY382414_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776395_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776406_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776407_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776430_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776437_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776474_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776478_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776479_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776480_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776482_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776486_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776499_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776650_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776662_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776727_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776730_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776739_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776743_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776752_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776755_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776775_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MN310705_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MN507853_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MN891828_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601252_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601283_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601298_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601302_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097630_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097648_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097702_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097736_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097757_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097774_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097786_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097813_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097849_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097876_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ676992_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ676993_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ676994_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OM304306_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OM721310_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OM721311_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OM721312_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OM721313_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OM721314_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK618431_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVSSDHG
KT235630_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT235632_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366498_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366500_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366501_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
KT366502_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MZ666825_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MG776545_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB270547_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182684_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
AB674410_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ464182_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456659_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257214_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257215_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875292_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF018197_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF018211_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF471650_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX357637_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776488_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776510_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776533_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776541_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776626_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776629_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776641_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776643_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776656_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776703_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776704_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776705_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776708_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598646_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097629_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097715_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ820052_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB330370_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040769_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU921419_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
AB555500_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPIGTLSSPPPSAVSSDHG
GU456654_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642134_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601239_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097688_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097723_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097861_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU787446_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349228_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
GU456655_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776554_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776560_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776561_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097874_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ820051_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AB674418_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JF754602_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GQ183448_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183449_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183450_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183451_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183452_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183453_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183454_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183455_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183456_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183458_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183459_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183461_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183462_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183464_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183465_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183466_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183467_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183468_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
GQ183469_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSTDHG
AF043594_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598676_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
FJ349233_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754591_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JF754626_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040829_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776420_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776470_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776501_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776635_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776663_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776669_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601248_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601269_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097658_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097732_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ820053_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AJ627218_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSSVHG
MK598662_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSPSPTAVSTDHG
DQ315776_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
DQ464170_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
EU939680_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349209_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664911_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664914_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664917_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664920_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664922_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664930_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664937_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JN664938_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668433_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668435_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668437_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668442_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668444_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668445_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KU668446_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF488704_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MF618339_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MN507839_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
V01460_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
AY161151_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161152_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161153_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161154_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161155_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY161156_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
GQ183470_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MK507910_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
MK507914_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPPGTLSSPSPSAVSTDHG
AY373431_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN642131_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875277_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875280_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875285_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875290_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196209_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196212_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196215_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK618433_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MH464840_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPSDHG
DQ304549_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
DQ486022_HBx_P-D      MAARLSCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
EF103277_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
AY741795_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
AY741796_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
DQ304551_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSPNHG
DQ329357_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPAAVPTDHG
DQ336675_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336676_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336677_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336678_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336679_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336685_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ464172_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ464173_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336683_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336684_HBx_P-D      MAARLCCQLDPARDVLRLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
DQ336687_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336688_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336689_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
DQ336692_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
X72702_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVPSDHG
KF471657_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MZ097868_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
HQ700441_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598642_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097678_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ820056_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
FJ349205_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MK598660_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
FJ349232_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875313_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875317_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875319_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875321_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875334_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875336_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875337_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KP090180_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KP090181_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196216_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196219_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196220_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196221_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196222_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196231_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196232_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196233_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196234_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724214_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724221_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724224_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724227_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724228_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724229_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724230_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724248_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310713_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310714_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601327_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097793_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
OK998519_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FJ692506_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
FJ692507_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598651_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
GU456656_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN040780_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776404_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776423_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776455_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776469_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776481_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097712_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ820049_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
EU594403_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594405_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594407_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594408_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594410_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594427_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724216_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598671_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618418_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618419_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618421_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594402_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594416_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594428_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
GQ477456_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
JX096956_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724231_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598666_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598667_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598675_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618420_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK618422_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT579898_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT579900_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT579902_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ097856_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MZ097883_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
OK143489_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
OK998521_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594424_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
KJ647350_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MH724246_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598678_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594431_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594432_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT579901_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594421_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MT579903_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
EU594423_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
JX096958_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MK598672_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
OM304315_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRSFSGPLRPLSSPSPSAVSSDHG
EU787439_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN664936_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
FJ349217_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349219_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349220_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
FJ349230_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
MZ097650_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSTDHG
JN257182_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTFSSPSPSAVSTDHG
FJ904421_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSNHG
GQ183482_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KT366465_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MF925364_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
GQ183475_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
GQ183485_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSTVSSDHG
MK598665_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGQPFSGPLGTLSSPSPSAVSSDHG
KF679989_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
KX423713_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
GQ205389_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KM524340_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
KC875341_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSHPSAVPTDHG
JF754599_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JF754623_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
JF754596_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MK618429_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MK618432_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MW601251_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097681_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097735_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MG776390_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097666_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097852_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MN507852_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
HQ700444_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700463_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700443_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700447_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700448_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700449_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700450_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700451_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700453_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700459_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700464_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700487_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700488_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700470_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTFSSPSTSAVSTDHG
HQ700553_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
HQ700484_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSTSAVSTDHG
HQ700513_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGSLGTLSSSSPSAVSTDHG
HQ833470_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSLSAVSTDHG
JN257201_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257155_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257169_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257196_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
JN257199_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776459_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MG776460_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MK598650_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097640_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
OK106256_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPTPSAVSTDHG
MK693109_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257148_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776449_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MW601322_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097783_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776717_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KT235629_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KF471649_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097649_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN040816_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN664948_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN257161_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVSTDHG
JN257166_HBx_P-D      MAARLCCQLDTARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
JN257173_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
JN257177_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN257188_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
JN257194_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
KT235624_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPPGTLSSPSPSAVSTDHG
KM524355_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
MG776788_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
JN664932_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPPAVSSDHG
JQ707692_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JN792905_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792906_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792907_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792909_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JN792910_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603401_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603402_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
MT603403_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPPPSAVSTDHG
JQ707478_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707479_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707480_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707481_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707482_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707484_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707485_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707487_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707488_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707490_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707496_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707499_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707500_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707502_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707503_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707505_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707507_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707492_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707495_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707501_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707504_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707486_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707512_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707513_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707514_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707515_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707516_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707517_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707518_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707519_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707520_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707521_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707522_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707523_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707524_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707525_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707527_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707529_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MK618435_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MK618425_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
JQ707683_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707684_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707685_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707686_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707689_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707690_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707691_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707693_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707694_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707695_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707696_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707697_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707698_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707699_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707700_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707701_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707702_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707703_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707704_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707705_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
JQ707706_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MG877709_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MG877710_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
JX898691_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898692_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
JX898694_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KC875305_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196214_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875295_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875307_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196227_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875289_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875296_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875297_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875298_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875309_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KP322599_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196228_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196236_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK598647_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875288_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875308_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196208_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196211_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OK998525_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196210_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196213_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875294_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX196226_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KC875322_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875323_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196217_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196224_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196225_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875332_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KC875326_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK598658_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724234_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601233_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196235_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MW601324_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196218_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196230_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
KX196229_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPLGSLSSSHPSAVPTDHG
KF061168_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
KF061169_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGALSSPSPSAVSTDHG
MN507836_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
KF192831_HBx_P-D      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192832_HBx_P-D      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF192834_HBx_P-D      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KU668441_HBx_P-D      MAARLCCQLDLTRDVLCLRPVGAESRGRPFSGPLGTLSSSSLPAVPTDHG
KF679993_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KT366497_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KT366507_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVSTDHG
KR905423_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSASAVSSDHG
KJ997853_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ997854_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ997855_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ997857_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ997858_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KJ997859_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSSDHG
KM524351_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGSLSSPSPSAVSSDHG
KX712265_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
MF925358_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSSDHG
KX423721_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSSDHG
KP090178_HBx_P-D      MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MH724218_HBx_P-D      MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
MH724219_HBx_P-D      MAARLCCQLDPARDVLYLRPVGAESCGRPFSGSLGTLSSPSPSAVPTDHG
KR812097_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812099_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812100_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812102_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812103_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
KR812104_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MN182677_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSSSAVSSDHG
KU736925_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
KX423715_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
KX423722_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGSLSSSPPSAVPTDHG
MG776383_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776664_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MW601309_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MG776399_HBx_P-D      MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776400_HBx_P-D      MAARLCCQLDPARDVLCLRPVDAESRGRPFSGPPGTLSSPSPSAVSTDHG
MG776394_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776448_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776583_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776589_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776591_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776598_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776631_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776701_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MZ820055_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776418_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776434_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776445_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776468_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776661_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776411_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESRGRPFSGALGTLSSPSPSAVSSDHG
MG776466_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776523_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFPGPLGTLSSPSPSAVSTDHG
MG776506_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776586_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776587_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776753_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776450_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776453_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776454_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776471_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776504_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776514_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776492_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVPTDHG
MG776493_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776513_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776537_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776538_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776584_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776607_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776620_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776622_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776764_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776767_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776706_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDYG
MG776640_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTISSPSPSAVSTDHG
MG776530_HBx_P-D      MAARVCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776735_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776762_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097835_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776681_HBx_P-D      MAARLCCQLDPARNVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTNHG
MG776569_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776672_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776588_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776596_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTFSSPSPSAVSTDHG
MG776779_HBx_P-D      MAARLCCQLDPARDVLCLRPIGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776614_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776615_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776637_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776720_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776652_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776671_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGPLGTLSSPSPSAVSTDHG
MG776684_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776689_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776771_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776774_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776783_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTFSSPSPSAVSTDHG
MG776715_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLASPSPSAVSPNHG
MG776746_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALASPSASAVSPNHG
MG877720_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTFSSPSPSAVPTDHG
MH724220_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTFSSPSPSAVPTDNG
MH724249_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MH724250_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPFSGSLGTLSSPSPSAVPTDHG
MK052953_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052955_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052958_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052951_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPYPSAVPPDHG
MK052966_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052973_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MK052975_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESGGRPVSGPLGTLSSPSPSAVPPDHG
MW601313_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
OK998523_HBx_P-D      MAARLCCQLDPSRDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MK618436_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTRSSPSPSAVSSDHG
MN182682_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182668_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPSAVSSDHG
MN182673_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182691_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSSDHG
MN182663_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPYPPAVSSDHG
MN310707_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFGTLSSPSPSAVSTDHG
MN310709_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310710_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310711_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MN310712_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MT603391_HBx_P-D      MAARLCCQLDPARDVLCLRPVSAESRGRPVSGPVGTLSSPHPSAVSTDHG
MZ097717_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSPDHG
MZ097718_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSTDHG
MZ097722_HBx_P-D      MAARLYCQLDPARDVLCLRPVGAESCGRPFSGSLGTLSSPSPSAVSSGHG
MZ097725_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097726_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSADHG
MZ097727_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSAVHG
MZ097728_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPPGTLSSPSPSAVSTDHG
MZ097731_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGALSSPSPYAVSADHG
MZ097737_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
Z35716_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097738_HBx_P-D      MAARMCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097739_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097741_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097744_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGGLSSPSPSAVSSDHG
MZ097746_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVSTDHG
MZ097747_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFRTLSSPSPSAVSTDHG
MZ097750_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPFRTLSSPSPSAVSTDHG
MZ097753_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESRGRPFSGPLGTLSSPSTSAVSTDHG
MZ097754_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097755_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGGLSSPSPSAVSSDHG
MZ097759_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097760_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGAFSSPSPSAVPTDHG
MZ097761_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGSLGTLSSPSPSAVPTDHG
MZ097762_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGTLSSPSPSAVSTDHG
MZ097763_HBx_P-D      MAARLCCQLDPTRDVLCLRPVGAESCGRPFSGPLGTLSSPSPSAVSTDHG
MZ097788_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSTDHG
MZ097773_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097775_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRRRPFSGPLGTLSSPSPSAVSTDHG
MZ097776_HBx_P-D      MAARLCCQLDPARDVLCLRPLGAESRGRPFSGSLGTLSSPSPSAVPTDDG
MZ097781_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPISGPLGDLSSPSPSAVSSDHG
MZ097790_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097791_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097807_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPLSGPLGTLSSPSPSAVSTDHG
MZ097808_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
MZ097644_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGALSSPSPSAVSTDHG
OK143470_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGTLSSPSPSAVSTDHG
MZ097831_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESRGRPFSGPLGDLSSPSPSAVSSDHG
ON346464_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLSAVPADHG
ON346472_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346475_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346484_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346498_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346502_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346503_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346514_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
ON346522_HBx_P-D      MAARLCCQLDPARDVLCLRPVGAESCGRPFSGPLGALSSPSLPAVPADHG
X80926_HBx_P-D        MAARLCCQLDPARDVLCLRPVGAESRGRPVSGPLGDLSSPSPSAVSTDHG
                         :   :          **   :*   .                    *

KT749823_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTSAARRMETTVNAHT-FLPKVLHKRTL
JN792908_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHRPFLPKVLHKRTL
EF103281_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB048701_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB078031_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB090268_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB090269_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB090270_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB104709_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB104710_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-VLPKVLHKRTL
AB104712_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNTHP-VLHKVLHKRTL
AB109475_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB109476_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB109478_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB109479_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB116266_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB119251_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB119252_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB119253_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-SLPKVLHKRTL
AB119254_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB119256_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-CLPKVLHKRTL
AB126581_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
AB188241_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB188242_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB188244_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB205127_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
AB205128_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
AB210820_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB222709_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB222710_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB222711_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB222712_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB222713_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
AB246347_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB246348_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB270537_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
AB270539_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYKRTL
AB270540_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB270541_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
AB270542_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRLETTVNAHQ-FLPKVLHKRTL
AB270543_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB270546_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB270548_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
AB270549_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB270550_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB330367_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB330369_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB493846_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ--LPKVLHKRTL
AB555496_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-CLPKVLHKRTL
AB555497_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB555501_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
AB674403_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB674404_HBx_P-D      AYLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB674405_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB674406_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB674407_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB674408_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
AB674409_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB674411_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB674413_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
AB674414_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
AB674415_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTMNAHQ-FLPKVLYKRTL
AB674416_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
AB674417_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB674419_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AB674420_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB674422_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB674423_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB674424_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVSAHH-CLPKVLHKRTL
AB674425_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-VLPKVLHKRTL
AB674426_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
AB674427_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-CLPKVLHKRTL
AB674428_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-VLPKVLHKRTL
AB674429_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB674430_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AB674431_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AF043593_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
AF121239_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AF151735_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AJ131956_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-MLPKVLHKRTL
AJ344116_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AJ627215_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
AJ627216_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
AJ627219_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
AJ627220_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AJ627222_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AJ627223_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AJ627224_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
AM422939_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
AY090452_HBx_P-D      AHLSLRELPVCAFSSAGPCALRFTS-ARHMETTVNAHQ-FLPKVLHKRTL
AY161150_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
AY161157_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AY161158_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AY161159_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
AY161160_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
AY233291_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AY233292_HBx_P-D      AHLSLRGLPVCAFSSAGPCALCFTS-ARRMETTVNAHQ-ILPKVLHKRTL
AY233294_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
AY233296_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
AY236160_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTI
AY236162_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHQ-FLPKVLHKRTL
AY236164_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTI
AY661792_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
AY661793_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
AY721605_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AY721607_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AY721608_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AY721609_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AY721610_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARGMETTVNAHQ-FLPKVLHKRTL
AY721611_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
AY721612_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVKAHR-FLPKVLHKRTL
AY741794_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTI
AY741797_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
AY741798_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQFFLPKVLHKRTL
AY796030_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-VLPKVLHKRTL
AY796031_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHP-FLPKVLHKRTL
AY796032_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAQP-FLPKVLHKRTL
DQ111986_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
DQ304547_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHQ-FLPKVLHKRTL
DQ304548_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHQ-FLPKVLHKRTL
DQ304550_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHQ-FLPKVLHKRTL
DQ315778_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
DQ329356_HBx_P-D      AHLSLRGLPVCAFSSAGPWALRFTS-ARPMETTVNAHQ-ILPKVLHKRTL
DQ336674_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTI
DQ336680_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
DQ336681_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
DQ336682_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
DQ336686_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTI
DQ336690_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTI
DQ399006_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
DQ464168_HBx_P-D      PHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
DQ464169_HBx_P-D      PHLSLRGLPVCAFSSAGPCALRFTS-GRRMETTVNAHQ-ILPKVLHKRTL
DQ464174_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTI
DQ464175_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKGLHKRTI
DQ464178_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTI
DQ464181_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
DQ486021_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTI
DQ486023_HBx_P-D      ANLSLRGLPVCAFSSAGSCAALFTS-ARRMETTVNAHQ-ISPKVLHKRTL
DQ486025_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
EF103275_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
EF103276_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EF103279_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETPVNAHQ-FLLKVLHKRTL
EF103280_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
EF594771_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EF594774_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EF594775_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHH-FLPKVLHKRTL
EF594776_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLDKRTL
EU155893_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
EU414135_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU414138_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU414139_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU414140_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU414141_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
EU414142_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-XLPKVLHKRTL
EU414143_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
EU594382_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
EU594396_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594397_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
EU594398_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594400_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594401_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594404_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594409_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594411_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594412_HBx_P-D      ANLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594415_HBx_P-D      ANLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594422_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594430_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU594433_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNTHQ-FLPKVLHKRTL
EU594434_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYKRTL
EU787437_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU787438_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
EU787440_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
EU787442_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
EU787443_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU787447_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU919197_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
EU921418_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ--LPKVLHKRTL
EU939681_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ349206_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
FJ349208_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ349211_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
FJ349213_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
FJ349214_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
FJ349215_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHL-FLPKVLHKRTL
FJ349216_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHL-FLPKVLHKRTL
FJ349229_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ349231_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ349235_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ386590_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ562309_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ562338_HBx_P-D      AYLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHL-ILPKVLYKRTL
FJ692532_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
FJ692533_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
FJ876242_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
FJ876253_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
FJ876254_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
FJ876256_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
FJ876257_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
FJ899792_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ904395_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
FJ904399_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ904402_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ904410_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
FJ904412_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
FJ904415_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
FJ904418_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ904419_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
FJ904420_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
FJ904422_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-XLPKVLHKRTL
FJ904424_HBx_P-D      AHLSLRGLPVCAFSPAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ904426_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ904427_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ904429_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
FJ904432_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ904433_HBx_C-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
FJ904435_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-ILPKVLHKRTL
FJ904438_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
FJ904439_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
FJ904443_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
FJ904445_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRVETTVNAHQ-FLPKVLHKRTL
FJ904446_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ183457_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ183460_HBx_P-D      AHLSLRGLPVGAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ183463_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ183471_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
GQ183472_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
GQ183473_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
GQ183476_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
GQ183478_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ183484_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ205380_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKILHKRTL
GQ205382_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKILHKRTL
GQ205384_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFAS-ARRMETTVNAHQ-ILPKILHKRTL
GQ205385_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKILHKRTL
GQ205388_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKILHKRTL
GQ377589_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ477452_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ477453_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
GQ477455_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ477457_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ477458_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
GQ477459_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GQ922000_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNDRQ-VLPKVLHKRTL
GQ922001_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNDRQ-ILPKVLHKRTL
GQ922002_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNDRQ-ILPKVLHKRTL
GQ922003_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ACRMETTVSAHR-MLPKVLHKRTL
GQ922004_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTSAC-RMETTVSAHH-SLPKVLYKRTL
GQ922005_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTSAC-RMETTVRAHR-SLPKVLHKRTL
GU456635_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
GU456636_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNTHQ-FLPKVLHKRTL
GU456637_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456638_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARHMETTVNAHQ-FLPKVLHKRTL
GU456639_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-SLPKVLHKRTL
GU456640_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
GU456641_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456642_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456643_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456644_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHERTL
GU456645_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-CLPKVLHKRTL
GU456646_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-CLPKVLHKRTL
GU456647_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456648_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456649_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
GU456650_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
GU456651_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-CLPKVLHKRTL
GU456652_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
GU456653_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
GU456657_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456658_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTI
GU456662_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456664_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456665_HBx_P-D      AHLSLRGLPVCTFSSAGPCALRFTS-ARRMETTVNAHQ-SLPKVLHKRTL
GU456666_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456667_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456668_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456669_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456670_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
GU456671_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456672_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456673_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-VRRMETTVNAHQ-FLPKVLHKRTL
GU456674_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456675_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456676_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456677_HBx_P-D      AHLSLRGLPVCAFSPAGPCALRVTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456678_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTI
GU456679_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
GU456680_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456681_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456682_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
GU456683_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
GU456684_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
HM750151_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
HM750152_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHQ-FLPKVLHKRTL
HM750153_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HM750154_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HM750155_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HM750156_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ236014_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
HQ236015_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
HQ236016_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700439_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700440_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVTAHQ-FLPKVLHKRTL
HQ700442_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700445_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700446_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700454_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700455_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700458_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
HQ700466_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700467_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700468_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700469_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700471_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700472_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMEATVNAHQ-FLPKVLHKRTL
HQ700473_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700474_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700477_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700478_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
HQ700479_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700480_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700481_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700482_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700483_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700489_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700510_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700511_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700512_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ700514_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ833465_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ833466_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ833467_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ833468_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ833469_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
HQ833471_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754590_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JF754592_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMATTVNAHQ-FLPKVLYKRTL
JF754593_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JF754594_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754595_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754597_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754598_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754600_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JF754603_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JF754604_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754605_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754606_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JF754607_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754608_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHP-FLPKVLHKRTL
JF754609_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754610_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHP-FLPKVLHKRTL
JF754611_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JF754612_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754614_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRLTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754615_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754617_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754619_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754621_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
JF754622_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JF754624_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JF754625_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRLETTVNAHQ-FLPKVLYKRTL
JF754627_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754628_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754629_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754630_HBx_P-D      AHLSLRGLPVCALSSAGPCALRFTS-ARRMETTVNAHQ-SLPKVLHKRTL
JF754631_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754632_HBx_P-D      AYLSLRGLPVCAFTSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
JF754633_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHP-FLPKVLHKRTL
JF754634_HBx_P-D      ANLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF754635_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF911682_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JF911683_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARNMETTVNAHQ-FLPKVLHKRTL
JF911685_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARSMETTVNAHQ-FLPKVLHKRTL
JF911687_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JF911690_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040750_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JN040751_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040752_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
JN040753_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRITS-ARRMETTVNAHQ-FLPKVLHKRTI
JN040754_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040755_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040756_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040757_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
JN040758_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTI
JN040759_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040760_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040761_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040762_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040766_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-VRRMETTVNAHH-FLPKVLHKRTL
JN040767_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040768_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
JN040770_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040771_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JN040772_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
JN040773_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
JN040774_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040775_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040776_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040777_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN040778_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN040779_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-CLPKVLHKRTL
JN040781_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHL-FLPKVLHKRTL
JN040782_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN040783_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN040784_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHH-FLPKVLHKRTL
JN040785_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
JN040786_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHL-CLPKVLHKRTL
JN040787_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHL-CLPKVLHKRTL
JN040788_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHL-CLPKVLHKRTL
JN040790_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN040792_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040794_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040795_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040796_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JN040797_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN040799_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JN040800_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLYKRTL
JN040801_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLYKRTL
JN040802_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVSAHR-FLPKVLHKRTL
JN040804_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040805_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JN040806_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JN040807_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNAHR-FLPKVLHKRTL
JN040808_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040809_HBx_P-D      AHLSLRGLPVCAFSPAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JN040810_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040811_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNPHQ-FLPKVLHKRTL
JN040812_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040813_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JN040814_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
JN040815_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040817_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040818_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040819_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
JN040820_HBx_P-D      AQLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040821_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JN040822_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JN040823_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JN040824_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLYKRTL
JN040826_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN040828_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRLETTVNAHQ-ILPKVLHKRTL
JN040830_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257149_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257150_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257152_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JN257153_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257159_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHX--LPKVLHKRTL
JN257160_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLXKRTL
JN257162_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257163_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257165_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257170_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257172_HBx_P-D      AHLSLRGLPVCAFSXAGPCALRXTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257176_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-VLPKVLYKRTL
JN257178_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-VLPKVLHKRTL
JN257179_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVTAHQ-FLPKVLHKRTL
JN257181_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN257183_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAQQ-CLPKVLHKRTL
JN257185_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-VLPKVLHKRTL
JN257187_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHY-FLPKVLHKRTL
JN257190_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
JN257193_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257195_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257200_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVXAHQ-FLPKVLHKRTL
JN257202_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JN257203_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257205_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257209_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN257211_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVXAHQ-FLPKVLHKRTL
JN574723_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN574725_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN574728_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN642126_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN642128_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642129_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642130_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN642132_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN642133_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVTAHQ-FLPKVLYKRTL
JN642135_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JN642136_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642138_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JN642140_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642142_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARCMETTVNAHQ-SLPKVLHKRTL
JN642143_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642144_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRLTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642145_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642146_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642147_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JN642148_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTS-ARRMETTVNARQ-FLPKVLYKRTL
JN642149_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642150_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-SLPKVLHKRTL
JN642151_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRITS-ARRMETTVNAHH-FLPKVLHKRTL
JN642153_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-CLPKVLHKRTL
JN642154_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JN642155_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTLNARQ-FLPKVLYKRTL
JN642156_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642157_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN642158_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642159_HBx_P-D      AHLSLRGLPVCAFSSTGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
JN642161_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-CLPKVLHKRTL
JN642162_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
JN642163_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
JN642165_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN642166_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVTAHQ-FLPKVLHKRTL
JN642167_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN664909_HBx_P-D      AHLSLRGLPVCAFSSAGPCALSFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN664910_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN664912_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-ILPKVLHKRTL
JN664913_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKILHKRTL
JN664918_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN664919_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN664921_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN664926_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKILHKRTL
JN664927_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN664931_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRSL
JN664939_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN664941_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JN664947_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKILYKRTL
JN688678_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN688679_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN688683_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN688685_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYXRTL
JN688695_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JN688708_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLXKRTL
JN688710_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN688711_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN688712_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMGTTVNAHH-VLPKVLHKRTL
JN688713_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRVTSASCRMETTVNAHQ-ILPKVLHKRTL
JN688722_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
JN792903_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JN792904_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLYKRTL
JN792911_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTLKAHQ-CLPKVLHKRTL
JN792912_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
JQ032005_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ032006_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ032007_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ272897_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ518361_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ687530_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ687531_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ707476_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLYKRTL
JQ707477_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ707483_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ707489_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLYKRTL
JQ707491_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ707493_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ707494_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLYKRTL
JQ707497_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ707498_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ707506_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ707508_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLYKRTL
JQ707509_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ707510_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ707511_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ707526_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ707528_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMEATVNAHH-FLPKVLHKRTL
JQ707530_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
JQ707682_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ707687_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ707688_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFPS-ARRMETTVNAHQ-FLPKVLHKRTL
JQ927384_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYKRTL
JX096954_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JX096955_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
JX096957_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
JX470760_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-MLPKVLHKRTL
JX898689_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-MLPKVLHKRTL
JX898697_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-MLAKVLHKRTL
KC012652_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-MLPKVLHKRTL
KC774436_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
KC774437_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KC774440_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KC774444_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KC774445_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARGMETTVNAHQ-FLPKVLHKRTL
KC774459_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KC774460_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-VLPKVLHKRTL
KC774462_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KC774477_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FFPKVLHKRTL
KC875275_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARR-FLPKVLHKRTL
KC875276_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KC875278_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLYKRTL
KC875279_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPNVLHKRTL
KC875281_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KC875282_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETSVNAHR-FLPKVLHKRTL
KC875283_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KC875284_HBx_P-D      AHLSLRGLPVCAFSFAGPCALRFTS-ARRMETTVNARR-FLPKVLHKRTL
KC875286_HBx_P-D      AHVSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARR-FLPKVLHKRTL
KC875287_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARR-FLPKVLHKRTL
KC875291_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KC875293_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARR-FLPKVLHKRTL
KC875299_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARR-FLPKVLYKRTL
KC875300_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLYKRTL
KC875301_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARR-FLPKVLHKRTL
KC875302_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KC875303_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KC875304_HBx_P-D      AHLSLPGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KC875306_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KC875311_HBx_P-D      AHLSLRGLPVCAVSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KC875312_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTC-ARRMETTVNAHH-FLPKVLHKRTL
KC875314_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KC875315_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KC875316_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KC875318_HBx_P-D      AHLSLHGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYKRTL
KC875320_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYKRTL
KC875324_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KC875325_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYKRTL
KC875328_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KC875329_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-ILPKVLYKRTL
KC875330_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYKRTL
KC875331_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KC875333_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-ILPKVLHKRTL
KC875335_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-ILPKVLHKRTL
KC875340_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKILHKRTL
KC875342_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHE-ILPKILYKRTL
KF018208_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHL-FLPKVLHKRTL
KF018210_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF061167_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLXKRTL
KF061170_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLXKRTL
KF170739_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF192830_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-ILPKVLHKRTL
KF471640_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
KF471641_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF471642_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTI
KF471644_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF471645_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMATTMNAHQ-FLPKVLHKRTL
KF471646_HBx_P-D      AHLSLRGLPVCALLSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF471647_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF471651_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KF471653_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF471654_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
KF471655_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KF471658_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF471660_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF679990_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYKRTL
KF679992_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF679995_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KF679997_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-VRRMETTVNAHH-FLPKVLHKRTL
KF922432_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KJ470885_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KJ470889_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KJ470893_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-SLPKVLHKRTL
KJ470894_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHL-ILPKVLYKRTL
KJ470895_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KJ470896_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KJ647352_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KJ647353_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARXMETTVNAHQ-ILPKVLHKRTL
KJ647355_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMATTVNAHQ-ILPKVLHKRTL
KJ843187_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-MLPKVLHKRTL
KJ997852_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KJ997860_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KJ997861_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KM519455_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KM524338_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-ILPKVLHKRTL
KM524339_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KM524341_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHNRTL
KM524344_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLYKRTL
KM524345_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKILHKRTL
KM524346_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLYKRTL
KM524347_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KM524348_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KM524349_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-ILPKVLHKRTL
KM524352_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KM524356_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KM524358_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-ILPKVLHKRTL
KM577668_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
KM577669_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
KM577670_HBx_P-D      AHLSLRGLPVCTFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
KM606744_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KM606745_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KM606752_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KM606753_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KM606754_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYKRTL
KM606755_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KP090177_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KP090179_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETSVNAHQ-ILPKVLHKRTL
KP168419_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLYKRTL
KP317981_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KP317983_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KP995100_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KR811561_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KR812075_HBx_P-D      AHLSLRGPPVCAFSSAGPCALRFTP-ARRMETTVNAHQ-FLPKVLHKRTL
KR812091_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KR812092_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARCMETTVNAHQ-FLPKVLHKRTL
KR812093_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKALHKRTL
KR812105_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARCMETTVNAHQ-FLPKVLHKRTL
KR812106_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKALHKRTL
KT151620_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHX-FLPKVLHKRTL
KT235615_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KT235621_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KT347090_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KT366491_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRLTS-ARRMETTVNAHR-FLPKVLHKRTL
KT366493_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KT366499_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KT366508_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KT749821_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
KT749827_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
KT749828_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARSMETTVNAHQ-FLPKVLHKRTL
KT749845_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRITS-ARRMETTVNAHQ-ILPKVLHKRTL
KT963508_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-SLPKVLHKRTL
KU668434_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KU668436_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KU668439_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHE-ILPKILHKRTL
KU668447_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKILHKRTL
KU668448_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKILHKRTL
KU668449_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KU736924_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-FLPKVLHKRTL
KU736926_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KU736927_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-ILPKVLHKRTL
KX276856_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLYKRTL
KX276857_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-XLPKVLHKRTL
KX357622_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLYKRTL
KX357638_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KX357639_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNARQ-FLPKVLHKRTL
KX423692_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHQ-FLPKVLHKRTL
KX423693_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KX423695_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KX423696_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KX423698_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHKRTL
KX423706_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-ILPKILHKRTL
KX423707_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHR-ILPKILHKRTL
KX423710_HBx_P-D      AHLSLRGLPVCAFSSAGPCALRFTS-ARRMETTVNAHH-FLPKVLHK<