HBVdb

Dataset for protein HBSP of genotype D

[Download (right click)] [Sequences] [Repertoires]

1581 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


MK052972_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB048701_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
AB078031_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB078032_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
AB090268_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB104709_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB104710_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB104711_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
AB104712_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB109479_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDLP
AB119252_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQ
AB119254_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB119255_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB119256_HBSP_P-D      MPLSYHHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
AB120308_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQ
AB126581_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB188241_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDRQ
AB188242_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLR
AB188244_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB205127_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB205128_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AB210820_HBSP_P-D      MPLSYQHFRRLLLLEDESGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AB210821_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNDLQ
AB222709_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB222710_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB222711_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDRQ
AB222713_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
AB246347_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB246348_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB267090_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB270537_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
AB270539_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
AB270540_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
AB270541_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
AB270547_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB270548_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB270549_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB270550_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTDLQ
AB330367_HBSP_P-D      MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB330369_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AB493846_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDPQ
AB555496_HBSP_P-D      MPLSYQHFWRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLYDLQ
AB555497_HBSP_P-D      MPLSYQHFWRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB555500_HBSP_P-D      MPLSYQHFRRLLLLDXEAGPLEEELPRLADEDLNRRVAEDLNLGTPNDLQ
AB555501_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
AB674403_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674404_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674405_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
AB674406_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674407_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674408_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674411_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
AB674413_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674415_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQ
AB674416_HBSP_P-D      MPLSYQHFRRVLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
AB674417_HBSP_P-D      MPLSYQHFRRLLLLDQEAGPLEEELPRLADEGLNRRVADDLNLGNLNDLQ
AB674418_HBSP_P-D      MPLSYQHFRRLLLLDQEAGPLEEELPRLADEGLNRRVADDLNLGNLNDLQ
AB674419_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
AB674420_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674422_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGXNRRVAEDLNLGNLNDLQ
AB674423_HBSP_P-D      MPLSYQHFRSVLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGTLNDLQ
AB674424_HBSP_P-D      MPLSYQLFRRLLLLDPEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674425_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGXNRRVAEDLNLGNLNDLQ
AB674427_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQ
AB674428_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPDDLQ
AB674431_HBSP_P-D      MPLSYHHFRRLVLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674435_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AF043593_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AF043594_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AF121239_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
AF121240_HBSP_C-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
AF151735_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AJ344116_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AJ627215_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQ
AJ627219_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
AJ627220_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AJ627222_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADXDLNHRVAEDLNLGNLNDLQ
AJ627224_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY090452_HBSP_P-D      MPLSYQHFRSVLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDPQ
AY090453_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY161150_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AY161157_HBSP_P-D      MPLSYQHFRRPLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY161158_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQ
AY161159_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY233291_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
AY233294_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
AY233296_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQ
AY236160_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
AY236164_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGNLNDPQ
AY721605_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
AY721606_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY721607_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
AY721608_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY721611_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY741794_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQDLNLGDLNDLQ
AY741795_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQNLNLGDLNDLQ
AY741797_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGNLNDLQ
AY741798_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAENLNLGNLNDLQ
AY796031_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY945307_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLNDRQ
DQ111986_HBSP_P-D      MPLSYQHFRRLVLLDXDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
DQ336674_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ336676_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ336680_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDLQ
DQ336681_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDLQ
DQ336682_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDLQ
DQ336683_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
DQ336685_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLLDPR
DQ336686_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPR
DQ336689_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGNLNDPR
DQ464172_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLQEELPHLADEGLNRRVAEDLNLRNLTDPQ
DQ464173_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
DQ464174_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ464181_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
DQ486023_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLEDEGLNRRVAEDLNLGNLNDLQ
DQ486025_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDPQ
EF103275_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EF103276_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EF103277_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
EF103279_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGNLNDLQ
EU414136_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU414138_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU414139_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEEXPRLADEDLNRRVAEDLNLGNLNDLQ
EU414141_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLXDEGLNRRVAEDLNLGNLNDPQ
EU414143_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRXAEDLNLGNLNDPQ
EU594396_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594398_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDLQ
EU594400_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594401_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594404_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594407_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594416_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLR
EU594418_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594419_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594426_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594433_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594434_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
EU787437_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU787438_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU787439_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEDLPRLADEGLNRRVAEDLNLGNLNDLQ
EU787441_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU787443_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
EU787445_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU787447_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU919197_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU921418_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDPQ
EU921419_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNPNDPQ
EU939680_HBSP_P-D      MPLSYQHFRRLLLLDNEAGTLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
EU939681_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
FJ349206_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLHLGNLNDLQ
FJ349208_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQ
FJ349213_HBSP_P-D      MPLSYQHFRRLVLLDNDTGPLEEELPRLADEGLNRRVAEDLNLGNLNDRR
FJ349218_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ349219_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
FJ349220_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
FJ349233_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
FJ349234_HBSP_P-D      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ349235_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
FJ386590_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ562309_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ692532_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPXLADEDLNRRVAEDLNLGNLNDHQ
FJ692533_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
FJ904395_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904399_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLAXEGXNRRVAEDLNLGNLNDLQ
FJ904402_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGVNRRVAEDLNLGNXNDLR
FJ904410_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
FJ904415_HBSP_P-D      MPLSYQHFRSILLLDDEAGPLEEELPRVAVEGVNRRVAEDLNLGNLNDLQ
FJ904419_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904420_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904422_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904424_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQ
FJ904426_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904427_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904429_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904432_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQ
FJ904433_HBSP_C-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVADDLNLGNXNDLQ
FJ904435_HBSP_P-D      MPLSYQHFRRLLLLEEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904438_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQ
FJ904439_HBSP_P-D      MPLSYQHFRRLLLLDQEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904445_HBSP_P-D      MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904446_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ167301_HBSP_P-D      MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
GQ183448_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGILNDLQ
GQ183449_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183470_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
GQ183472_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183473_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQ
GQ183475_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEKLPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183478_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQ
GQ183480_HBSP_P-D      MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183481_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183482_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ184322_HBSP_P-D      MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLDRRVAEDLNLGTLNDLQ
GQ205380_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
GQ477453_HBSP_P-D      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEDLNRRVAEDLNLGTPNDLP
GQ477455_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
GQ477456_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADQDLNRRVAEDLNLGNLNDLQ
GQ477457_HBSP_P-D      MPLSYQHFRKLLLLDDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
GQ477459_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ922000_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNPNDPQ
GQ922001_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GQ922003_HBSP_P-D      MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
GQ922004_HBSP_P-D      MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
GQ922005_HBSP_P-D      MPLSYPHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGTLNDHR
GU456636_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456637_HBSP_P-D      MPLSCQHFRRLVLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456638_HBSP_P-D      MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456639_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPIEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456640_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456641_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
GU456642_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
GU456643_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456645_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
GU456646_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456647_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDVNLGNLNDLQ
GU456648_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456651_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLHDLQ
GU456652_HBSP_P-D      MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456654_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTPNDRQ
GU456656_HBSP_P-D      MPLSYQHFRRLLLLDDESGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
GU456657_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
GU456665_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456666_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456667_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456668_HBSP_P-D      MPLSYRHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456669_HBSP_P-D      MPLSYQHFRRLLLLDPDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456670_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
GU456672_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456673_HBSP_P-D      MPLSYQHFRRLLLLEDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456674_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEDLNRRIAEDLNLGDLNDLQ
GU456675_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456676_HBSP_P-D      MPLSYHHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456677_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456678_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNGLR
GU456679_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456681_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456684_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
HM750151_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
HM750152_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEKELPRLADEGLNRRVAEDLNLGNLNDLQ
HM750155_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
HQ236014_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
HQ236015_HBSP_P-D      MPLSYQHFRRLVLLDDDAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
HQ236016_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQ
HQ700439_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQ
HQ700455_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLAXEGXNXRVAKDXNXGNLNDLQ
HQ700458_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDHR
HQ700463_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
HQ700467_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
HQ700472_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTDLQ
HQ700474_HBSP_P-D      MPLSYHHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700478_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700481_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700510_HBSP_P-D      MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ833465_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ833466_HBSP_P-D      MPLSYQHFRRLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ833467_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ833468_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
JF754588_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JF754590_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754591_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JF754592_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754593_HBSP_P-D      MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754594_HBSP_P-D      MPLSYQHFRRLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754595_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
JF754598_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754599_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
JF754600_HBSP_P-D      MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
JF754602_HBSP_P-D      MPLSYQHFRRLLLLDHEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
JF754603_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
JF754605_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754606_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
JF754607_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JF754611_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
JF754612_HBSP_P-D      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNRRVADDLNLGTLNDLQ
JF754617_HBSP_P-D      MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JF754619_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
JF754624_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754626_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
JF754629_HBSP_P-D      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JF754630_HBSP_P-D      MPLSCQHFRRLLLLDNESGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
JF754631_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQ
JF754632_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
JF754635_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
JN040750_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JN040752_HBSP_P-D      MPLSYQSFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHR
JN040755_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDPQ
JN040756_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040757_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040765_HBSP_P-D      MPLSYQYFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040766_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRLVAEDLNLGKLNDLQ
JN040767_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGHLNDLQ
JN040768_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040772_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGNLNDHQ
JN040773_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDLQ
JN040774_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JN040775_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040776_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
JN040777_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
JN040778_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADAGLNRRVAEDLNLGNLNDLQ
JN040779_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040782_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNPDDLQ
JN040783_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040784_HBSP_P-D      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040788_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040790_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040791_HBSP_P-D      MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040793_HBSP_P-D      MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040795_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDLQ
JN040796_HBSP_P-D      MPLSYQRFRSVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JN040797_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040800_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDLQ
JN040802_HBSP_P-D      MPLSYQHFRRLLLLEDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JN040804_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLN-LQ
JN040806_HBSP_P-D      MPLSYQHFRRLLLLDDETGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040807_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040808_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRIAEDLNLGNLNDLQ
JN040810_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040811_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
JN040812_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040813_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JN040814_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JN040815_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040816_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040817_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040818_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
JN040820_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
JN040822_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
JN040824_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAENLNLGNLNDLQ
JN040826_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040827_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040830_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257148_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JN257149_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257153_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257159_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDLQ
JN257160_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRXVAXDLNLGNLNDLQ
JN257162_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDXQ
JN257163_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257165_HBSP_P-D      MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQ
JN257172_HBSP_P-D      MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257176_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNVNXLQ
JN257178_HBSP_P-D      MPLSYQHFRKLLLLDDXAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257186_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257187_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257190_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNLRVAEDLNLGNLNDLQ
JN257200_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JN257201_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JN257202_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257203_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257211_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257214_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642128_HBSP_P-D      MPLSYQHFPRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642129_HBSP_P-D      MPLSYQHFRRLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642132_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
JN642133_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDHQ
JN642134_HBSP_P-D      MPLSYQHFRRLLLLDAESGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642135_HBSP_P-D      MPLSYQHFRRLLLLDNNAGPLEEELPRLADEGLNRRVAEDLSLGNLNDLQ
JN642136_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
JN642138_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRR
JN642140_HBSP_P-D      MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642143_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642144_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642145_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGRHRRVAEDLNLGNLNDLQ
JN642146_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JN642147_HBSP_P-D      MPLSYQHFPRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
JN642148_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQ
JN642153_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642154_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
JN642155_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642156_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDRQ
JN642157_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDLQ
JN642158_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642159_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQ
JN642161_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642162_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQ
JN642163_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQ
JN642165_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642166_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQ
JN642167_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRHVAEELNLGNLNDLQ
JN664919_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
JN664920_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
JN664927_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN664941_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN664948_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
JN688678_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
JN688679_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
JN688683_HBSP_P-D      MPLSYQHFRRLVLLNNKAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
JN688695_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPIEEELPRLADEGLNRRVAEDLNLGNLNDPR
JN688708_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQ
JN688710_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNHRVAEDLNLGDLNDHQ
JN688711_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPVEEELPRLADEGLNRRVAEELNLGNLNDPQ
JN688712_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLTLGTLNDPQ
JN688713_HBSP_P-D      MPLSYQHFRRLLLLDEKAGPLEEELPRLADEGLNRRVAEDLNLGDLNDPQ
JN792904_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN792907_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGNLNDLQ
JN792911_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEQELPRLADEGLNRRVAEDLNLGNLNDLQ
JN792912_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEQELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ687530_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLKEELPRLANEDLNRRVAKDLNLGNLNDLQ
JQ687531_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
JQ707479_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707487_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707489_HBSP_P-D      MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707490_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707491_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPVEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707493_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQ
JQ707497_HBSP_P-D      MPLSYQQFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707498_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707510_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707511_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707513_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707517_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707682_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707689_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ927384_HBSP_P-D      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JX096955_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JX310733_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JX898694_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC774440_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQ
KC774445_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLANEGLNRRVAKDLNLGNLNDLQ
KC774459_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC774477_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KC875279_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875290_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875297_HBSP_P-D      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875299_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875301_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875312_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875322_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC875324_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPPEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC875325_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC875329_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC875340_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLR
KC875341_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLR
KF053178_HBSP_P-D      MPLSYQRFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF061167_HBSP_P-D      MPLSYXHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF170739_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF192830_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF192831_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF192834_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471641_HBSP_P-D      MPLSYQHFRRLLCLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471642_HBSP_P-D      MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471645_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
KF471647_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471649_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471650_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KF471653_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNELQ
KF471657_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471658_HBSP_P-D      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471659_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF584160_HBSP_P-D      MPLSYXRFRXLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDLQ
KF584161_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF679990_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDPQ
KF679994_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KF679998_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KF779220_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
KF779382_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
KF922432_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
KJ470889_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KJ470893_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KJ470894_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KJ470895_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
KJ470896_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KJ647350_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRL
KJ647352_HBSP_P-D      MPLSYQXFRRLLLLDDESGPLEEELPRLADEDLNRRVADDLNLGNLSDLQ
KJ647355_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDPQ
KM524342_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524344_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524346_HBSP_P-D      MPLSYQHFRRLLLLDDKAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524348_HBSP_P-D      MPLSYQLFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524351_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524356_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524358_HBSP_P-D      MPLSYQHFRRLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
KM577668_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
KM577669_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
KM577670_HBSP_P-D      MPLSYQYFRRLVLLDNDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
KM577671_HBSP_P-D      MPQSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM606744_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
KM606752_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAENLNLGNLNDHQ
KM606753_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM606754_HBSP_P-D      MPLSYQHFRSVLLLDDEAGPLQEELPRLADEDLNRRVAEYLNLGNHNDHR
KP090179_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPQEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP090180_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KP090181_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLRNLNDPQ
KP168419_HBSP_P-D      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
KP995100_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366493_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366494_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366499_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366511_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT749821_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEELHLGNLNDPQ
KT749823_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLP
KT749828_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLANEDLNRRVAEDLNLGNLNDLQ
KU736924_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
KU736926_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KU736927_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KX196224_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KX196235_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KX276856_HBSP_P-D      MPLSYQHFRSVLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
KX276857_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNXNDLQ
KX357622_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
KX357637_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
KX357639_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
KX827291_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KX827300_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KY629630_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KY629633_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KY629634_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVADELNLGNLNDLQ
LT992439_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
LT992444_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
M32138_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRHVAEELNLGNLNDLQ
MF618349_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MF925363_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MF925379_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MF925391_HBSP_P-D      MPLSYQHFRSVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MH724215_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724216_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLAXEDLNRRVAEXLNLGNLNDLQ
MH724225_HBSP_P-D      MPLSYQHFRRLLWLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724226_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724231_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MH724232_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724234_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724235_HBSP_P-D      MPLSYQHFRRLLCLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDPQ
MH724236_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPR
MH724237_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724238_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MH724241_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MH724242_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDHQ
MH724245_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPHLADEGLNRRVAEDLHLGNLNDPQ
MH724246_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEELNLGNLNDLQ
MH724247_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLANEDLNRRVAEDLNLGNLNDLQ
MH724248_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDFNLRNLNDPQ
MH724249_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724250_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNDPQ
MH724251_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK052947_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDHNLGNLNDPQ
MK052948_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052949_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDFNLGNLNDPQ
MK052950_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052951_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052952_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052961_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052963_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052971_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRPADEGLNRRVAEDLNLGNLNDPQ
MK052973_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK052974_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADDGLNRRVAEDLNLGNLNDPQ
MK355501_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MK507913_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598636_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNNLQ
MK598637_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNLNNLQ
MK598638_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNNLQ
MK598641_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTNLQ
MK598646_HBSP_P-D      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598647_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598648_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEDLNHRVAEDLNLGNLNDLQ
MK598649_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598650_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598658_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598661_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598672_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598675_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598676_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK618423_HBSP_P-D      MPLSYQQFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618427_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618429_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618431_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618437_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618441_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK693108_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK693109_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDSQ
MN310706_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MN310710_HBSP_P-D      MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MN310712_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MN310714_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPXLADEGLNRRVAEDLNLGNLNDPQ
MN476100_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MN507837_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEEIPRLADEGLNRRVAEDLNLGNLNDLQ
MN507839_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPCLADEGLNRRVAEDLNLGNLNDLQ
MN507852_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEELNLGNLNDPQ
MN507853_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MN585095_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MN844882_HBSP_P-D      MPLSYPYFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
MT114169_HBSP_P-D      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT114172_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
MT114173_HBSP_P-D      MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT579901_HBSP_P-D      MPLSYQYFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MT591276_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT591277_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT591278_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MT591279_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MT591281_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MT603389_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603390_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
MT603393_HBSP_P-D      MPLSYQYFRRLLLLDDEAGPLEEELPRLANEGLNRRVAEDLNLGDLNDLQ
MT603396_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603398_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603404_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEQELPRLADEGLNRRVAEDLNLGNLNDLQ
MW455166_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601228_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601229_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDRQ
MW601231_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGDLNDPQ
MW601233_HBSP_P-D      MPLSYQHFRRLVLLDEDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601234_HBSP_P-D      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601236_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601237_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADPDLNRRVAEDLGLGNLNDLQ
MW601238_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADQDLNRRVAEDLNLGNLNDLQ
MW601239_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
MW601240_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
MW601242_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDPQ
MW601245_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
MW601246_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MW601248_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601251_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601253_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601255_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601259_HBSP_P-D      MPLSYQHFRKLLLLDVEAGPLEEELPRLADEDLNRRVAEDLNLGDLNDLH
MW601261_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601263_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601265_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
MW601268_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNVNDLQ
MW601270_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDLQ
MW601273_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601274_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601275_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601276_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601281_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNDRQ
MW601285_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601286_HBSP_P-D      MPLSYRHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPQ
MW601287_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNPNDPQ
MW601293_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601297_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLHDLQ
MW601298_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601299_HBSP_P-D      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601301_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601306_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLHDLQ
MW601307_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
MW601311_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601312_HBSP_P-D      MPLSYQHFRRLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGNLHDLQ
MW601314_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
MW601320_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601321_HBSP_P-D      MPLSYQHFRNVLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601323_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601326_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601328_HBSP_P-D      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601329_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
MW601330_HBSP_P-D      MPLSYQHFRRLLLLDDETGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601331_HBSP_P-D      MPLSYQHFRRLVLLDNEAGSLEEELPRLADEDLNRRVAEDLTLGNLNDRQ
MW601332_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQ
MW601335_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601338_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
MW601339_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
MW675897_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
MW847931_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLBDLQ
MW999636_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGDLNDPQ
MW999642_HBSP_P-D      MPLSYQHFRSILLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999644_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999648_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGXLNDLQ
MW999649_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999650_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999656_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999657_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999658_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097624_HBSP_P-D      MPLSYPHFRKLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097627_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNDLQ
MZ097628_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNDLQ
MZ097629_HBSP_P-D      MPLSYQHFRKLLLLDEVAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097631_HBSP_P-D      MPLSYQHFRRLLLLDTEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097632_HBSP_P-D      MPLSYQHFRRLLLLEDKAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
MZ097633_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNDLQ
MZ097634_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097636_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDLQ
MZ097637_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLR
MZ097639_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097642_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097643_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLSDLQ
MZ097645_HBSP_P-D      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
MZ097647_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097651_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097654_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097655_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097656_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEXLNRRVAEDLNLGNLNDPQ
MZ097658_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097659_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097660_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097661_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097662_HBSP_P-D      MPLSYQHFRRLLLLDHTAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097663_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097664_HBSP_P-D      MPLSYQHFLRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097665_HBSP_P-D      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097668_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEELNLGNLNDLQ
MZ097669_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDRQ
MZ097670_HBSP_P-D      MPLSYHCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097672_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097677_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLR
MZ097678_HBSP_P-D      MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
MZ097681_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097682_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097683_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNXNDLQ
MZ097684_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPP
MZ097686_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097688_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097691_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097692_HBSP_P-D      MPLSYQHFRRLLLLDEESGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097693_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
MZ097696_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDPQ
MZ097697_HBSP_P-D      MPLSYQCFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097698_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDLQ
MZ097699_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097700_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097701_HBSP_P-D      MPLSYQHFRRLLLLDAXAGXLEEELPRLADEGLNRRVAEDLNLGNPNDRQ
MZ097704_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGDLNDLQ
MZ097705_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
MZ097707_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLSDLQ
MZ097709_HBSP_P-D      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQ
MZ097710_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097711_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDPQ
MZ097713_HBSP_P-D      MPLSYQHFRRLLLLDEESGPLEEELPRLADEGLNRRVAEDLNLGTLTDLQ
MZ097715_HBSP_P-D      MPLSYQHFRSVLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDRQ
MZ097717_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADQDLNRRVAEDLNLGNLNDLQ
MZ097720_HBSP_P-D      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MZ097728_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGXXNDLQ
MZ097730_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGTLTDLQ
MZ097750_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEXELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097751_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097765_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLBDLQ
MZ097771_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097772_HBSP_P-D      MPLSYQHFRRLLLLDNDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097779_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097780_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLXDLQ
MZ097787_HBSP_P-D      MPLSYPHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097789_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MZ097792_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097794_HBSP_P-D      MPLSYQRFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097798_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097799_HBSP_P-D      MPLSYRRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDHQ
MZ097800_HBSP_P-D      MPLSYQHFRKLLLLDXEAGPLEEELPRLADEDLNRRVAEELNLGNLNDHQ
MZ097808_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLXLGNLNDLQ
MZ097809_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
MZ097812_HBSP_P-D      MPLSYQXFRRLLLLDHDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097813_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097815_HBSP_P-D      MPLSYQHFXRLLLLDDEAGPLEEELPRLADEDLNRRVAEELNLGNLNDLQ
MZ097816_HBSP_P-D      MPLSYHHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097817_HBSP_P-D      MPLSYHHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
MZ097823_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGILNDLQ
MZ097824_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097827_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097828_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097829_HBSP_P-D      MPLSYQHFRKLLLLEDEAGPLEEELPRLADEDLNRRVAEDLNLGNLSDLQ
MZ097830_HBSP_P-D      MPLSYQHFRRLLLLEDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097832_HBSP_P-D      MPLSYQHFRRLLLLDDDTGPLEEELPRLAEEGLNRRVAEDLNLGNPNDLQ
MZ097834_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097835_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQ
MZ097837_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNPTDLQ
MZ097845_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDRR
MZ097846_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097847_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097848_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDLQ
MZ097851_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097852_HBSP_P-D      MPLSYQHFRRLLLLDAEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097853_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097855_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097856_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097857_HBSP_P-D      MPLSCQRFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097863_HBSP_P-D      MPLSYQHFRRLLLLEDESGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097865_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097867_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNDLQ
MZ097871_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLSDLQ
MZ097872_HBSP_P-D      MPLSYQHFRKLLLLDDEAGSLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097873_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPIEEELPRLADEGLNRRVAEDLNLGNPNDLQ
MZ097875_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEDELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097877_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGGNRRVAEDLNLGNLNDLQ
MZ097879_HBSP_P-D      MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MZ097880_HBSP_P-D      MPLSYQHFRRLLLLEEGAGPLEEELPRLADQGLNRRVAEDLNLGNLDDLQ
MZ097881_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097882_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MZ097883_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097884_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQ
OK143467_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVADDLNLGNLNDPQ
OK143472_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNDLQ
OK143473_HBSP_P-D      MPLSYQHFRRLLLLEGEAGPLEEELPRLADEGLNRRVADDLNLGNLNDPQ
OK143474_HBSP_P-D      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OK143476_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDPQ
OK143486_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
OK143487_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDPQ
OK143488_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVADDLNLGNLNDPQ
OK143489_HBSP_P-D      MPLSYQHFRRLVLLDDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OK143496_HBSP_P-D      MHLSYQHFRRLLLLEGEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQ
OK998520_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OK998522_HBSP_P-D      MPLSYQYFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
OK998523_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OK998524_HBSP_P-D      MPLSYQQFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
OK998525_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OK998527_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLKEELPRLANEDLNRRVAKDLNLGNLNDLQ
OM025254_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OM304310_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM304313_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OM304316_HBSP_P-D      MPLSYQHFRRLLLLEDDAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OM304317_HBSP_P-D      MPLSYQHFRKLLLLDHEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OM304318_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
OM304322_HBSP_P-D      MPLSYQCFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM304323_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDLQ
OM304324_HBSP_P-D      MPLSYQHFRRLLLLDPEAGPLEEELPRLADEGLNRRVAEELNLGNLNDRQ
OM304325_HBSP_P-D      MPLSYQHFRRLLLLDIEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM304327_HBSP_P-D      MPLSYQHFRRLLLLDTEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM333239_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNPRVADDLDLGDLNDLQ
OM721315_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
OM721316_HBSP_P-D      MPLSYQRFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
ON585703_HBSP_P-D      MPLSYQHFRRLLLLDKDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
ON585704_HBSP_P-D      MPLSYQHFRKLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
X59795_HBSP_P-D        MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
X65258_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNEQQ
X80924_HBSP_P-D        MPLSYQHFRRLVLLDNEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDLQ
X80926_HBSP_P-D        MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNHRVAEDLNLGNLNDLQ
X85254_HBSP_P-D        MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
X97848_HBSP_P-D        MPLSYQHFRRLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLWNLNDHQ
Z35716_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AB078033_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB090269_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB090270_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB109475_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB109476_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB109477_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB109478_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB110075_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB116266_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB119251_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB205126_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB471856_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB471857_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183471_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183474_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183476_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183479_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ924652_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN664930_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707476_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707477_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707478_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707480_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707481_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707482_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707483_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707484_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707486_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707488_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707492_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707494_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707495_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707496_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707500_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707501_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707502_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707503_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707504_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707505_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707507_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707508_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707527_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF679997_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524338_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524341_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524347_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524352_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524353_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524354_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KM524355_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KR905424_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366491_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366495_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366506_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366509_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366510_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MF925358_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MF925364_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MF925393_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MH932714_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598664_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598665_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999632_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999652_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999653_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN664918_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
JF754601_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875292_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471646_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB222712_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754609_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
MW601303_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
AY721612_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB119253_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQ
AB210822_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAKDLNLGNLNDLQ
AB270542_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB270543_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB583680_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AF280817_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EF103280_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EF103281_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU414135_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU594397_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU787436_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ349230_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183455_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ377589_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU357846_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700440_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700441_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700442_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700443_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700444_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700445_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700446_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700447_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700448_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700449_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700450_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700451_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700459_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700464_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700466_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700469_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700470_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700471_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700473_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700477_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700479_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700480_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700482_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700483_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700484_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700487_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700488_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700489_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040751_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040780_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040781_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040794_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257179_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257185_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642164_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN664931_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN792903_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN792909_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN792910_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF061168_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366508_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
LC365689_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK507910_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK507911_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK507914_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603383_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603384_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603385_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603392_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603394_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603395_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603397_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603399_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603400_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603401_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603402_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603403_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601247_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601300_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999634_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999635_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097646_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097731_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097743_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097786_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097797_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097810_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097849_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097860_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097861_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097878_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM304311_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366498_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366500_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366501_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366502_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU787446_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MN507838_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601278_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601313_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB330370_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594399_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594425_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594430_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
GU456635_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JX096954_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JX096957_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598662_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW999646_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OK143490_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OM304307_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JN040785_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674409_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AJ627223_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY721610_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY796032_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ349215_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ349216_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ349217_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ349228_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ349229_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904431_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904443_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183484_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183485_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456653_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456658_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456659_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456662_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456663_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456680_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456683_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700511_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700512_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700513_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ700514_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754615_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754627_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754628_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040754_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040759_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040770_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040771_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040786_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040819_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257193_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257194_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257209_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642131_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642149_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN664939_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875277_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875283_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875286_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875287_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875288_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875293_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875294_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875295_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875306_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875308_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875309_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF061169_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471644_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471660_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF679995_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KP322599_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KP322600_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KP322601_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KR905423_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KX196208_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KX196211_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KX196215_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KX196227_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598645_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598668_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601243_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601244_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601279_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601283_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601308_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601322_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601325_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601337_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999631_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999637_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999638_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999639_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999641_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999643_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999645_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999651_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999655_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097625_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097638_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097640_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097648_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097650_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097674_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097679_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097726_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097727_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097753_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097757_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097776_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097783_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097785_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097790_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097796_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097803_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097811_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097825_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097836_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097843_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097858_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM721310_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456664_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040761_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040769_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875289_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601262_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097742_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097833_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097842_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097868_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AB674426_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY373431_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY661792_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY661793_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY721609_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY796030_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
DQ315778_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ349231_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456644_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456649_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456650_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754596_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754608_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754633_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040799_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040805_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040809_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040823_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040829_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257152_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257155_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257169_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257196_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257199_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257205_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642130_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642151_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471651_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471652_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471655_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MH724252_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601256_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601282_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601289_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601302_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601315_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601336_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999640_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW999647_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097630_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097649_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097690_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097695_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097702_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097738_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097756_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097762_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097774_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097807_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097839_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097840_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097866_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097874_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097876_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
X02496_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
Y07587_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF471640_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQ
AF121242_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
AF121241_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JN257150_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257170_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257171_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK516278_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601232_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601292_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097764_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097768_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097788_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM721312_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM721313_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM721314_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AJ627216_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQ
AJ627218_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQ
AY161151_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AY161152_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AY161153_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AY161154_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AY161155_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
AY161156_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097821_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQ
AY161160_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456661_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY233292_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
EU414142_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
EU594382_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
FJ349232_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
FJ562338_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
FJ692506_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
FJ692507_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
GQ922002_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
JN642126_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
JN688685_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC774436_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC774437_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC875330_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC875331_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KF679989_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KF779214_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KM519455_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KT347090_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
LT992438_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
LT992454_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724214_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724221_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724224_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724227_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724228_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724229_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MH724230_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK541688_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK598651_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MN310708_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MN310709_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MN310713_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MN310715_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601252_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601257_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601272_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601290_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601295_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601305_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601324_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601327_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601334_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW675898_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MZ097736_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MZ097739_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MZ097752_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MZ097793_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MZ097801_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MZ097805_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
OK143479_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
X65257_HBSP_P-D        MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
DQ486022_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELSHLADEGLNRRVAEDLNLGNLNDPQ
FJ904412_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
FJ904418_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
GU456660_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
JF754634_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
GQ477458_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
AY741796_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAQNLNLGDLNDLQ
DQ336675_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ336678_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ336690_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ464178_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ486021_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ336677_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ336679_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ464176_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ464177_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
DQ336684_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGKLNDLQ
DQ336687_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPR
DQ336688_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPR
DQ336692_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPR
DQ464175_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
HQ700468_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097653_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754622_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040762_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601280_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097754_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097870_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT749827_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598674_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNHRVAEDLNLGNLNDLQ
EU594403_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594405_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594408_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594410_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594411_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594412_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594413_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594414_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594415_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594421_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594424_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
GQ477452_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JX096956_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MH724217_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MH724223_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MH724244_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598666_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598667_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598669_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598671_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598673_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598677_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598678_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598679_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK618418_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK618419_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK618420_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK618421_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MT579898_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MT579899_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MT579900_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MT579902_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OK998521_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594402_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594409_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594417_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594429_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594431_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594432_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JX096958_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK618422_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601266_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097747_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OK143470_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594427_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
FJ349205_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JF754597_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
JF754621_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MK598660_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601271_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MW601333_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097748_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
X72702_HBSP_P-D        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594420_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594422_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594423_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU594428_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
EU787440_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
EU787442_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HM750153_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ833469_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ833470_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HQ833471_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC774462_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601319_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097635_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HM750154_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM304306_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ899792_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
GU456671_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JF754604_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
KF471654_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
MW601250_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
MZ097734_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
HQ700454_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
FJ904421_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GU456655_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257151_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM721311_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ167302_HBSP_P-D      MPLSYQHFLRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGTLNDLQ
GQ183450_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183451_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183452_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183453_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183454_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183456_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183457_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183458_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183459_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183460_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183461_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183462_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183463_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183464_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183465_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183466_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183467_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183468_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
GQ183469_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601309_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601258_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
GQ183477_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT366496_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC774460_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQ
MK598655_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQ
X97849_HBSP_P-D        MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQ
GQ183483_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601249_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097733_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OK106256_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754610_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601318_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097782_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040828_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097657_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257182_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097841_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040760_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
HM750156_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
KF679992_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
KF679993_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
KT366497_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
KT366507_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
MK507912_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
MK598657_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNLNDPQ
HQ700553_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097666_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097671_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDLQ
JN040758_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598642_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598643_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598644_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618428_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618434_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618435_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618436_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MN507836_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MN507851_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097819_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JF754623_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDRQ
JN040821_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MW601288_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
OM304315_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097795_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JN040792_HBSP_P-D      MPLSYQHFRRLLLLDNEAGSLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097675_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLHLGDLNDLQ
JN257183_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN040801_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDLQ
KM524339_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLDDLQ
JN642142_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC774444_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601269_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN642150_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
OM304312_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257195_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257161_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRXVAXDLNLGNLNDLQ
JN257166_HBSP_P-D      MPLSYQHFRRLLFLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDPNDLQ
JN257173_HBSP_P-D      MPLSYRHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN257188_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601291_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
MZ097763_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
JN257215_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097676_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEELNLGNLNDLQ
JQ707512_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707514_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707515_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707516_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707518_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707519_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707520_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707521_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707522_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707523_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707524_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707525_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707526_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707528_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707529_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707530_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KU668449_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598663_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN688722_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MN310711_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
OK998519_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MH724233_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDPQ
JN792906_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603387_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MT603388_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JN792908_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADQGLNRRVAEDLNLGNLNDLQ
JQ707485_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707499_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT151620_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707506_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707509_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MF925383_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MF925390_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707683_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707684_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707685_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707686_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707687_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707688_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707690_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707691_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707692_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707693_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707694_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707695_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707696_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707697_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707698_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707699_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707700_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707701_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707702_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707703_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707704_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707705_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
JQ707706_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875296_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875307_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KX196209_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KX196212_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KX196228_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097673_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KX196236_HBSP_P-D      MPLSYQHFRRLVLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KC875323_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC875328_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KX196225_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KC875326_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KF192832_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MF618348_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KT963508_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MW601294_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097689_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF584162_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF584163_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF584164_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF584165_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF584166_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KY382412_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KY382414_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MN310705_HBSP_P-D      MPLSYQRFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
KF679996_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
KX827290_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
KX827301_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MK618426_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
KU736925_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
KX357638_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDHQ
MK598659_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK598670_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097626_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MH724220_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MW601267_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPR
MZ097864_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052954_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052959_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052953_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052955_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052956_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052958_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052960_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052966_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MK052975_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDHQ
MK598639_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNNLQ
MK598640_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNNLQ
MK618424_HBSP_P-D      MPLSYQQFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618425_HBSP_P-D      MPLSYQQFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618430_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618432_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618433_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MK618443_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDPQ
MN310707_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097859_HBSP_P-D      MPLSYQHFRRLLLLDHEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097820_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MT603391_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
MZ097718_HBSP_P-D      MPLSYQHFRRLVLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDRQ
MZ097722_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADPDLNRRVAEDLGLGNLNDLQ
MZ097723_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDLQ
MZ097725_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLTDPQ
MW601316_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097641_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097708_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097729_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097781_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097844_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNPNDLQ
MZ097732_HBSP_P-D      MPLSYQHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097735_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097714_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097737_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097741_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097744_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097746_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGDLNDLQ
MZ097749_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097755_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGDLNDRQ
MZ097759_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097760_HBSP_P-D      MPLSYRHFRRLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNPNDPQ
MZ097761_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPHLADEGLNRRVAEDLNLGNPNDPQ
MZ097769_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097770_HBSP_P-D      MPLSYQHFRRLVLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097773_HBSP_P-D      MPLSYQHFRKLLLLDNEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097775_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLR
MZ097778_HBSP_P-D      MPLSYQHFRRLLLLDDESGPLEEELPRLADEGLNRRVAEDLNLGNLHDLQ
MZ097784_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
MZ097791_HBSP_P-D      MPLSYQHFRRLLLLDDDAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097685_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLTDLQ
MZ097818_HBSP_P-D      MPLSYQHFRRLLLLDDEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097712_HBSP_P-D      MPLSYQHFRRLLLLDEEAGPLEEELPRLADEGLNRRVAEDLNLGNLNDLQ
MZ097831_HBSP_P-D      MPLSYQHFRKLLLLDDEAGPLEEELPRLADEDLNRRVAEDLNLGNLNDLQ
OK143468_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVADDLNLGNLNDPQ
OK143480_HBSP_P-D      MPLSYQHFRRLLLLEDEAGPLEEELPRLADEGLNRRVADDLNLGNLNDPQ
                       *  *   *   : *:  :*  : . .       .   *            

MK052972_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB048701_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
AB078031_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB078032_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB090268_HBSP_P-D      PPAWDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB104709_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYGS
AB104710_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHLGLSENSYGS
AB104711_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB104712_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYGS
AB109479_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB119252_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB119254_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB119255_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYGS
AB119256_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB120308_HBSP_P-D      PPAWDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB126581_HBSP_P-D      PPARDHAEPGRLLVKEPLCIPPGAGPNLWTEIAPVFPSHHPGLSENSYGS
AB188241_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB188242_HBSP_P-D      PPAWDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB188244_HBSP_P-D      PPARDHAEPARLLLKEPLCGPHVAVPNLRTEIAPVFPSHRPGLSQNTYGS
AB205127_HBSP_P-D      PPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB205128_HBSP_P-D      PPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB210820_HBSP_P-D      PPARDHAEPARLLHKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB210821_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB222709_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB222710_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB222711_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB222713_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB246347_HBSP_P-D      PPARDHAEPARLLLEEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB246348_HBSP_P-D      PPARDPAEPARLLLKEPLYIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB267090_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB270537_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYGS
AB270539_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYGS
AB270540_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB270541_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB270547_HBSP_P-D      PPAREHAEPARPLLAEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB270548_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB270549_HBSP_P-D      PPARDHAEPARLLLKEPLYIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB270550_HBSP_P-D      PPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB330367_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB330369_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB493846_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB555496_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB555497_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB555500_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB555501_HBSP_P-D      QPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674403_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674404_HBSP_P-D      PPARXHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB674405_HBSP_P-D      PPARDHAKPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AB674406_HBSP_P-D      PPARDHARPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHXPGLSENSYGS
AB674407_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674408_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674411_HBSP_P-D      RPVRDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674413_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674415_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHXGLSENSYGS
AB674416_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674417_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674418_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674419_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
AB674420_HBSP_P-D      LPVRDHAKPARLLLKAPLCFPHVAVQNLRMEIAPVFPSHRPGLSQNTYGS
AB674422_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674423_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674424_HBSP_P-D      RPARDHAEPARVLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674425_HBSP_P-D      LPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674427_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674428_HBSP_P-D      RPARDHAEPARVLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AB674431_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
AB674435_HBSP_P-D      LPARDHAESARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AF043593_HBSP_P-D      PPAWDHAEPARPLFKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
AF043594_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
AF121239_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
AF121240_HBSP_C-D      PPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
AF151735_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRKEIAPVFPSHHPGLSENSYGS
AJ344116_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYGS
AJ627215_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
AJ627219_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHRPGLSENSYGS
AJ627220_HBSP_P-D      PPARDHAEPARLLLKETLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AJ627222_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AJ627224_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
AY090452_HBSP_P-D      PPARDHAKPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY090453_HBSP_P-D      PPAWDHARPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
AY161150_HBSP_P-D      PPARDHAEPARLLLKETLFIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AY161157_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY161158_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY161159_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYGS
AY233291_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY233294_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY233296_HBSP_P-D      QPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY236160_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGR
AY236164_HBSP_P-D      PPARDHAESARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGR
AY721605_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY721606_HBSP_P-D      PPVRDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY721607_HBSP_P-D      PPARDHAEPAQLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY721608_HBSP_P-D      PPARDHAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY721611_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYGS
AY741794_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY741795_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY741797_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
AY741798_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY796031_HBSP_P-D      PPARDHAEPARLLLKGPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
AY945307_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLWENSYGS
DQ111986_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
DQ336674_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGR
DQ336676_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGR
DQ336680_HBSP_P-D      PPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
DQ336681_HBSP_P-D      PPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
DQ336682_HBSP_P-D      PPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
DQ336683_HBSP_P-D      PPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
DQ336685_HBSP_P-D      PPARVLAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGR
DQ336686_HBSP_P-D      PPARDHAGPARLLLKEPLCILPVAVPNLRTEIAPVFPSHHPGLSENSYGR
DQ336689_HBSP_P-D      QPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGR
DQ464172_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGR
DQ464173_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGR
DQ464174_HBSP_P-D      PPARVHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGR
DQ464181_HBSP_P-D      PPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAHVFPSHHLGLSENSYGS
DQ486023_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPGAVPKLWTEIAPVFPSHHLGLSENSYGS
DQ486025_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRMEIAPVFPSHHPGLSENSYGS
EF103275_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
EF103276_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EF103277_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYGS
EF103279_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
EU414136_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTQIAPVFPSHHPGLSENSYGS
EU414138_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
EU414139_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU414141_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU414143_HBSP_P-D      PPARDHAAPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594396_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594398_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594400_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594401_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594404_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594407_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSQNSYGS
EU594416_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594418_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594419_HBSP_P-D      PPAWDHAGPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594426_HBSP_P-D      PPARDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594433_HBSP_P-D      PPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU594434_HBSP_P-D      PPARDHAEPARLLLKDPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
EU787437_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYGS
EU787438_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYGS
EU787439_HBSP_P-D      PPARDPAEPARLLLKEPLCIPLVAVPNPRTEIAPVFPSHHLGLSENSYGS
EU787441_HBSP_P-D      PPARDPAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHLGLSENSYGS
EU787443_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYGS
EU787445_HBSP_P-D      PPARDPAEHARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYGS
EU787447_HBSP_P-D      PPARDPAEPARLLLKEPLCIPLVAVPNPRTEIAPVFPSHHLGLSENSYGS
EU919197_HBSP_P-D      PPARDPAEPARLLLKEPLCIPTVAVPNPRTEIAPVFPSHHLGLSENSYGS
EU921418_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSQNSYGS
EU921419_HBSP_P-D      PPARDHVEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
EU939680_HBSP_P-D      PPARDHAEPARFLLKEPLCIPLVAVPKLRTEIAPVFPSHHPGLSENSYGS
EU939681_HBSP_P-D      PPARDPAEPARLLLKEPLCIPLVAVPNPRTEIAPVFPSHHLGLSENSYGS
FJ349206_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ349208_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
FJ349213_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ349218_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGI
FJ349219_HBSP_P-D      PPARDHAEPARLLLTEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ349220_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ349233_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ349234_HBSP_P-D      PPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ349235_HBSP_P-D      LPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
FJ386590_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHLGLSENSYGS
FJ562309_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
FJ692532_HBSP_P-D      PPARDPAEPARLLLKEPLCFPPVAVQNLRMETAPVFPSHRPGLSENSYGS
FJ692533_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRMETALVFPSHRPGLSENSYGS
FJ904395_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVQNLRMETAPVFPSHHPGLSENSYGS
FJ904399_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ904402_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ904410_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
FJ904415_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
FJ904419_HBSP_P-D      PPARDHAELARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
FJ904420_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
FJ904422_HBSP_P-D      PPARDXAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ904424_HBSP_P-D      PPARDHAEPARHLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ904426_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSQNSYGS
FJ904427_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRKEIAPVFPSHHHGLSENSYGS
FJ904429_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
FJ904432_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ904433_HBSP_C-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
FJ904435_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
FJ904438_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
FJ904439_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
FJ904445_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
FJ904446_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ167301_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
GQ183448_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
GQ183449_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
GQ183470_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
GQ183472_HBSP_P-D      PPAWDHAEPARQLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ183473_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ183475_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ183478_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ183480_HBSP_P-D      PPARDHAEPARLLLKDPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
GQ183481_HBSP_P-D      PPARDHAEPARLLFKEPLCIPLVAVPNLRTEIAPVFPSHHLGLSENSYGS
GQ183482_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ184322_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
GQ205380_HBSP_P-D      PPARDHAEPARLLLTEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
GQ477453_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHRPGLSENSYGN
GQ477455_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ477456_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ477457_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ477459_HBSP_P-D      LPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ922000_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ922001_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GQ922003_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
GQ922004_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
GQ922005_HBSP_P-D      PPARDPAEPARLLLKEPLCIPLVAVQNLRMETAPVFPSHHPGLSENSYGS
GU456636_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456637_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHRPGLSENSYGS
GU456638_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGN
GU456639_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHHGLSENSYGS
GU456640_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
GU456641_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYGS
GU456642_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456643_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
GU456645_HBSP_P-D      RPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456646_HBSP_P-D      LPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456647_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456648_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456651_HBSP_P-D      LPARDHAELARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYGS
GU456652_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456654_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456656_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456657_HBSP_P-D      PPARDHAKPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
GU456665_HBSP_P-D      PPARDHAELARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
GU456666_HBSP_P-D      PPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456667_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456668_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456669_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456670_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456672_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGVSENSYGS
GU456673_HBSP_P-D      PPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456674_HBSP_P-D      QPARDHAEPARLLLKEPLCIPHVAVQNLRTEIAPVFPSHHHGLSENSYGS
GU456675_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456676_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
GU456677_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
GU456678_HBSP_P-D      PPARNSAEPARLLLKEPLCISPVAVQNLREEIAPVFPSHHPGLSQNSYGS
GU456679_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
GU456681_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLSENSYGS
GU456684_HBSP_P-D      PQARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
HM750151_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
HM750152_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
HM750155_HBSP_P-D      PPARVPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
HQ236014_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
HQ236015_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
HQ236016_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
HQ700439_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
HQ700455_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHLGLSENSYGS
HQ700458_HBSP_P-D      PQARDPAEPARLLLKEPLCIPPVVVQNLRTETAPVFPSHHPGLSENSYGS
HQ700463_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
HQ700467_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
HQ700472_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
HQ700474_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
HQ700478_HBSP_P-D      PPARDHAEPARLLLKTTLCIPHVAVPNLRTEIAPVFPSHHLGLSENSYGS
HQ700481_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHLGLSENSYGS
HQ700510_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
HQ833465_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYGS
HQ833466_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVXNPRTEIAPVFPSHHLGLSENSYGS
HQ833467_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVXNPRTEIAPVFPSHHLGLSENSYGS
HQ833468_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNPRTEIAPVFPSHHLGLSENSYGS
JF754588_HBSP_P-D      PPARDHAEPARPLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754590_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSQNSYGS
JF754591_HBSP_P-D      LPARDHAEPARLLHKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754592_HBSP_P-D      PPARDPAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754593_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754594_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754595_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754598_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
JF754599_HBSP_P-D      PPARDHAEPARLLLKEPLCIHPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754600_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
JF754602_HBSP_P-D      LPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754603_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754605_HBSP_P-D      PPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754606_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JF754607_HBSP_P-D      LPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754611_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYGS
JF754612_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754617_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754619_HBSP_P-D      PPARDHAEHARLLLKEPLCIPPVAVQNLRTEIAHVFPSHHPGLSENSYGS
JF754624_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754626_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHLGLSENSYGS
JF754629_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVSNLRTEIAPVFPSHHPGLSQNSYGS
JF754630_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIALVFPSHHLGLSENSYGS
JF754631_HBSP_P-D      PPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754632_HBSP_P-D      LPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
JF754635_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040750_HBSP_P-D      PPAWDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040752_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040755_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
JN040756_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHRPGLSENSYGS
JN040757_HBSP_P-D      PPARDHAEPARPLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040765_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040766_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040767_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040768_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040772_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
JN040773_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040774_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN040775_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGI
JN040776_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040777_HBSP_P-D      PPARDHAEPARLLLKTPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040778_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040779_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040782_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
JN040783_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040784_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGI
JN040788_HBSP_P-D      PPARDHAEPARLLLEEPLCLPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040790_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040791_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN040793_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040795_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040796_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040797_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN040800_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040802_HBSP_P-D      LPVRDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYGS
JN040804_HBSP_P-D      IPARDHAEPARLLLKEPLRIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040806_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040807_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGVSENSYGS
JN040808_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040810_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPAAVQNLWTEIAPVFPSHHPGLSENSYGS
JN040811_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040812_HBSP_P-D      QPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040813_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040814_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGG
JN040815_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYGS
JN040816_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYGS
JN040817_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHLGLSENSYGS
JN040818_HBSP_P-D      QPARDHAGPAPLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040820_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYGT
JN040822_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040824_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040826_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040827_HBSP_P-D      LPARDHAEPARRLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN040830_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN257148_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257149_HBSP_P-D      LPARDHAXPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257153_HBSP_P-D      PPARDHAGPARRLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257159_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257160_HBSP_P-D      PPARDPAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257162_HBSP_P-D      XPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257163_HBSP_P-D      PPARDHAKPARLLLKEPLCIPPAAVPNLWTEIAPVFPSHHPGLSENSYGS
JN257165_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257172_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVQNLRTEIAPVFPSHHPGLSENSYGS
JN257176_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN257178_HBSP_P-D      PPAXDHAEPARLLLKEPLCIPPVAVPNLRTETAPVFPSHHPGLSENSYGS
JN257186_HBSP_P-D      RPARXHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257187_HBSP_P-D      LPARDHAEPARLLLKEPLCXPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257190_HBSP_P-D      PPAWDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGX
JN257200_HBSP_P-D      PPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN257201_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257202_HBSP_P-D      RPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257203_HBSP_P-D      LPARDHAEPARLLLEEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN257211_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVXNLRTEIAPVFPSHHLGLSENSYGS
JN257214_HBSP_P-D      PPARDHAEPARLLLKEPLXFPPVAVPNLRTXIAPVFPSHHPGLSENSYGS
JN642128_HBSP_P-D      PPARDHAKPARLLHKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGG
JN642129_HBSP_P-D      QPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642132_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
JN642133_HBSP_P-D      PPARDHAEPARLLLKETLRIPPVAVQNLRTEIAPVFPSHHLGLSENSYGS
JN642134_HBSP_P-D      LPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSRHHGLSENSYGS
JN642135_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642136_HBSP_P-D      PPARDHAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642138_HBSP_P-D      PPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642140_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642143_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
JN642144_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642145_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642146_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642147_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAVVQNLRTEIAPVFPSHHPGLSENSYGS
JN642148_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN642153_HBSP_P-D      PPARDPAKPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
JN642154_HBSP_P-D      LPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642155_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVPNLWTEIAPVFPSHHPGLSENSYGS
JN642156_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHLGLSENSYGS
JN642157_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642158_HBSP_P-D      PPARDHAEPARLLLKEPICIPHVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN642159_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
JN642161_HBSP_P-D      LPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642162_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642163_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN642165_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVQNLRTEIAPVFPSHHPGLSENSYGS
JN642166_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN642167_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN664919_HBSP_P-D      PPARDHAKPARLLLTEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
JN664920_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
JN664927_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN664941_HBSP_P-D      PPAWDHAEPARRLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN664948_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN688678_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN688679_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
JN688683_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
JN688695_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
JN688708_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN688710_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JN688711_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYGS
JN688712_HBSP_P-D      PPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYGG
JN688713_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN792904_HBSP_P-D      PPARDHAELARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN792907_HBSP_P-D      PPARDHAGLARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN792911_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JN792912_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
JQ687530_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ687531_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707479_HBSP_P-D      PPAWDHAEPARPLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707487_HBSP_P-D      PPAWDHAEPARLLFKELLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707489_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707490_HBSP_P-D      PPAWDHAGPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707491_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707493_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707497_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707498_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707510_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707511_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707513_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGI
JQ707517_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGT
JQ707682_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JQ707689_HBSP_P-D      PPTRDHAEPARLLLKEPLCIPPVAVPNFRTEIAPVFPSHHPGLSENSYGS
JQ927384_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
JX096955_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
JX310733_HBSP_P-D      LPAWEHAEAARLLLQEPLCIPPVAVPNLRXEIAPVFPSHHHGLSEDSYGX
JX898694_HBSP_P-D      PPARDHAEPARLLLKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC774440_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC774445_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
KC774459_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRMEIAPVFPSHHPGLSENSYGS
KC774477_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
KC875279_HBSP_P-D      PPARDHSEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875290_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875297_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875299_HBSP_P-D      PPARDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875301_HBSP_P-D      PPARDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875312_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875322_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875324_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875325_HBSP_P-D      PPARDHAAPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875329_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875340_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KC875341_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF053178_HBSP_P-D      PPAWDHAEHARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF061167_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
KF170739_HBSP_P-D      PPARDHAEPARLLLKETLCIPPVAVPNLRTEIAPVFPSHHPGPSGNSYGS
KF192830_HBSP_P-D      PPAREHAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
KF192831_HBSP_P-D      PPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
KF192834_HBSP_P-D      PPAREPAKPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
KF471641_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF471642_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF471645_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF471647_HBSP_P-D      LPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF471649_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
KF471650_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
KF471653_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF471657_HBSP_P-D      PPARDHAEPARLLLKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF471658_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF471659_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF584160_HBSP_P-D      LPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF584161_HBSP_P-D      LPARDHAEPARLLLKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF679990_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF679994_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF679998_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF779220_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KF779382_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
KF922432_HBSP_P-D      PPARDPAEPARHLLKEPLCIPPVAVQNLRTETAPVFPSHHHGLSENSYGS
KJ470889_HBSP_P-D      PPARDPAEPARLLLKEXLXIPPVAVXNLRMETAPVFPSHHPGLSENSYGS
KJ470893_HBSP_P-D      PPARDPAEPARLLLKEPLCIPHVAVQNLRMETAPVFPSHHPGLSENSYGS
KJ470894_HBSP_P-D      PPARDPAEPARLLLKEPLCFPPVAVQNLRTETAPVFPSHHPGLSENSYGS
KJ470895_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
KJ470896_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSZNSYGS
KJ647350_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KJ647352_HBSP_P-D      PPAWDHAKPAQLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSKNSYGS
KJ647355_HBSP_P-D      PPARDLAKPAXLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSXNSYGS
KM524342_HBSP_P-D      PPARDHAEPARLLLTEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
KM524344_HBSP_P-D      PPARDHAKPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KM524346_HBSP_P-D      PPAWDHAKPARLLFKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYGC
KM524348_HBSP_P-D      PPARDHAEPARLLLKDPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
KM524351_HBSP_P-D      PPAWDHAKPARLLFKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYGC
KM524356_HBSP_P-D      PPARDHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KM524358_HBSP_P-D      PPAREPAEPARLLLEEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
KM577668_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KM577669_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KM577670_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
KM577671_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KM606744_HBSP_P-D      PPARDPAGPARLLLKEPLCIPPVAVQNLRTETAPVFPSHHPGLSENSYGS
KM606752_HBSP_P-D      PPARDPAGPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
KM606753_HBSP_P-D      PPARDPAEHARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHLGLSENSYGS
KM606754_HBSP_P-D      PPARDPAGPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
KP090179_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KP090180_HBSP_P-D      PPARDHAEPAQLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
KP090181_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KP168419_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRMETAPVFPSHHPGLSENSYGS
KP995100_HBSP_P-D      PPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHLGLSENSYGS
KT366493_HBSP_P-D      PPAWDHAKPARLLFKEPLYIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KT366494_HBSP_P-D      PPARNHAEPARLLFKESLYSPPVAVPNVRKEIAPVFPSHHPGLSENSYGS
KT366499_HBSP_P-D      PPARDHAKPARLLLKEPLCIPPVAVPNLRTQIAPVFPSHHLGLSENSYGS
KT366511_HBSP_P-D      PPAWDHAEPARLLFKEPLYIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
KT749821_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KT749823_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGG
KT749828_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KU736924_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYGS
KU736926_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFXSHHPGLSENSYGS
KU736927_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KX196224_HBSP_P-D      PPARDYAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KX196235_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KX276856_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
KX276857_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KX357622_HBSP_P-D      LPARVHAEPARLLLKEPLCIPPVAVQNLRTETAHVFPSHHPGLSENSYGS
KX357637_HBSP_P-D      PPARDHAEPARPLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYGS
KX357639_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYGS
KX827291_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
KX827300_HBSP_P-D      PPARDHAEPARHLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
KY629630_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVXNPRTEIAPVFPSHHLGLSENSYGS
KY629633_HBSP_P-D      PPARDPAEPARLLLKEPLCIPLAAVXNLRTEIAPVFPSHHLGLSENSYGS
KY629634_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
LT992439_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
LT992444_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRMEIAPVFPSHHPGLSENSYGS
M32138_HBSP_P-D        PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MF618349_HBSP_P-D      PPARDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MF925363_HBSP_P-D      PPAWDHAEPARILFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MF925379_HBSP_P-D      PPAWDHAEPARLLFKAPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
MF925391_HBSP_P-D      PPARDHAGPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHLGLSENSYGS
MH724215_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724216_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRKEIAPVFSSHHPGLSENSYGS
MH724225_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724226_HBSP_P-D      PPARDPAEPARQLLKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724231_HBSP_P-D      PPAWDHAEPARPLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724232_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
MH724234_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724235_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724236_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724237_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MH724238_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724241_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724242_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
MH724245_HBSP_P-D      PPARDHAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724246_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724247_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTETAPVFPSHHPGLSENSYGS
MH724248_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724249_HBSP_P-D      PPARDPAEPARQLLKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724250_HBSP_P-D      PPARDPAEPARQLLKEPLCIPTVAVPNLRTEIAPVFPSHHPGLSENSYGS
MH724251_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
MK052947_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSRRHGLSENSYGS
MK052948_HBSP_P-D      QPARDHAEPARLLHKEPLCIPPVAVQNLRTEIAPVFPSRRHGLSENSYGS
MK052949_HBSP_P-D      QPARDHAELARLLLKQPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYGS
MK052950_HBSP_P-D      QPARDHAELARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYGS
MK052951_HBSP_P-D      QPARDHAEPARLLHKEPLCIPPVAVQNLRTEIAPVFPSRHHGLSENSYGS
MK052952_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK052961_HBSP_P-D      QPARDHAEPARLLLKEPLCTPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK052963_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLSENSYGS
MK052971_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHHGLSENSYGS
MK052973_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MK052974_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK355501_HBSP_P-D      PPARDHAEPARILLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK507913_HBSP_P-D      PPARDHAKPARLLLEEPLRIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MK598636_HBSP_P-D      PPARDLAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MK598637_HBSP_P-D      PPARDLAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MK598638_HBSP_P-D      PPARDLAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MK598641_HBSP_P-D      PPARDLAEHARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MK598646_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MK598647_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MK598648_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MK598649_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MK598650_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPLAVPNLRTEIAPVFPSHHLGLSENSYGS
MK598658_HBSP_P-D      PPARDHAEPARLLLKGPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK598661_HBSP_P-D      PPARDHAEHARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK598672_HBSP_P-D      PPAWDHAKPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK598675_HBSP_P-D      LPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK598676_HBSP_P-D      PPAWDHAEPARLLFKEPQCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK618423_HBSP_P-D      PPAWDHAKPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK618427_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
MK618429_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGASENSHGS
MK618431_HBSP_P-D      LPARAHAEPARLLLTEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK618437_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK618441_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
MK693108_HBSP_P-D      PPARDHAGPARILVKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MK693109_HBSP_P-D      PPARDHAEPARILVKEPLCIPPVAVPNLRTENAPVFPSHHPGLSENSYGS
MN310706_HBSP_P-D      PPAWDHAKPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSEDSYGS
MN310710_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MN310712_HBSP_P-D      PPARDHAEPARLLLKEPLCFPPVVVPNLRTEIAPVFPSHHPGLSQNSYGS
MN310714_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGG
MN476100_HBSP_P-D      PPARDHAEPARLLLTEPLCIPHVAVQNLRMETAPVFPSHHPGLSENSYGS
MN507837_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MN507839_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MN507852_HBSP_P-D      PPARDHAEPARLPLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MN507853_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MN585095_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MN844882_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRKEIAPVFPSHHLGLSENSYGS
MT114169_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MT114172_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MT114173_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MT579901_HBSP_P-D      PPAWDHAEPARLLFTEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
MT591276_HBSP_P-D      PPAREHAEPARLLLKEPLCFPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MT591277_HBSP_P-D      PPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MT591278_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
MT591279_HBSP_P-D      PPARDHAEPARVLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
MT591281_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
MT603389_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIALVFPSHHLGLSENSYGS
MT603390_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MT603393_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHLGLSENSYGS
MT603396_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MT603398_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHLGLSENSYGS
MT603404_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MW455166_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
MW601228_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
MW601229_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MW601231_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MW601233_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601234_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVQNLRTEIAPVFPSHHPGLSENSYGS
MW601236_HBSP_P-D      PPARDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVLPSHHPGLSETSYGS
MW601237_HBSP_P-D      PPARDHAEPARLLLKEPLCIPLVAVPNFRTEIAPVFPSHHLGLSENSYGS
MW601238_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MW601239_HBSP_P-D      PPARDHAEPARHLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MW601240_HBSP_P-D      PPARDHAEPARPLLKEPLCIPPVAVPNLRTEIAHVFPSHHHGLSENSYGS
MW601242_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601245_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601246_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601248_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTETAPVFPSHHPGLSENSYGS
MW601251_HBSP_P-D      LPARDHAEPARLLLKESLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MW601253_HBSP_P-D      PPARDHAEPARLLLKEPLCIPLVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601255_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601259_HBSP_P-D      PPARDPAKPARPLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601261_HBSP_P-D      LPARDHAEPARLLLKAPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601263_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
MW601265_HBSP_P-D      LPAREHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601268_HBSP_P-D      PPARDHAEPARLLLKTPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
MW601270_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601273_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601274_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601275_HBSP_P-D      PPAWDHAEPARLLLKEPLFIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601276_HBSP_P-D      PPARDHAEPARPLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601281_HBSP_P-D      TPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601285_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601286_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601287_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601293_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601297_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601298_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHRPGLSENSYGS
MW601299_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAHVFPSHHHGLSENSYGS
MW601301_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601306_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601307_HBSP_P-D      PPARDPAEPARLLLKEPLCFPLVAVPNLRTEIAPVFPSHHLGLSENSYGS
MW601311_HBSP_P-D      PPARDHAEPARLLLKEPLSIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601312_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601314_HBSP_P-D      RPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
MW601320_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MW601321_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MW601323_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
MW601326_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601328_HBSP_P-D      PPARDHAEPARLLLKAPLYFPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MW601329_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601330_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601331_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MW601332_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW601335_HBSP_P-D      PPARDHAEPARLLLKATLRIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MW601338_HBSP_P-D      PPARDPAEPARLLLKEPLCIPLVAVPNPRTEIAPVFPSHHLGLSENSYGS
MW601339_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MW675897_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
MW847931_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW999636_HBSP_P-D      PPARDHAEPARPLLTEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW999642_HBSP_P-D      LPARDHAEHARLLLKQPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGN
MW999644_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHLGLSENSYGS
MW999648_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW999649_HBSP_P-D      LPARDHAEPARHLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MW999650_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSZNSYGS
MW999656_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRMETAPVFPSHHPGLSENSYGS
MW999657_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAHVFPSHHPGLSENSYGS
MW999658_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRKEIAPVFPSHHLGLSENSYGS
MZ097624_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTETAPVFPSHHPGLSENSYGS
MZ097627_HBSP_P-D      PPARDPAEPARLLLKGPLCIPPVAVQNLRMETAPVFPSHHPGLSQNSYGS
MZ097628_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097629_HBSP_P-D      PPARDPAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MZ097631_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLWTEIAPVFPSHHPGLSENSYGS
MZ097632_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097633_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097634_HBSP_P-D      PPARDPAEPARLLLKEPLCIPPVAVPNPRTEIAPVFPSHHLGLSENSYGS
MZ097636_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLXENSYGS
MZ097637_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097639_HBSP_P-D      PPARDHAEPAQLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MZ097642_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MZ097643_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097645_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097647_HBSP_P-D      XPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097651_HBSP_P-D      PPARDHAXPARPVLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097654_HBSP_P-D      PPARDHAEPARLLLKEPLYIPPVAVPNLRTEIAPVFPSHHPGLSENTYGS
MZ097655_HBSP_P-D      PPARDHAEPARPLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097656_HBSP_P-D      PPARDHAEPARLLLKEPLCIPXVAVPNLRTEIAPVFPSHHPGLSXNSYGS
MZ097658_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGVSENSYGS
MZ097659_HBSP_P-D      PPAREHAKTARLLLKEPLCIPSVAVPNLRSQIAPVFPSHHPGLSENSYGG
MZ097660_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
MZ097661_HBSP_P-D      QPARDHAEPARLLLKEPLCIPPVVVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097662_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MZ097663_HBSP_P-D      PPAREHAEPARLLLKEXLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097664_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097665_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097668_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSZNSYGS
MZ097669_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAHVFPSHHPGLSENSYGS
MZ097670_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097672_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097677_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MZ097678_HBSP_P-D      LPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097681_HBSP_P-D      LPARAHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097682_HBSP_P-D      PPAQDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097683_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097684_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVSNLRTEIAPVFPSHHPGLSENSYGS
MZ097686_HBSP_P-D      LPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097688_HBSP_P-D      PPARDHAKPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MZ097691_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097692_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097693_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSQNSYGS
MZ097696_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097697_HBSP_P-D      PPARDPAEPARLLLKEPLCIPXVAVQNLRMETAPVFPSHHPGLSENSYGS
MZ097698_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MZ097699_HBSP_P-D      LPARDHAGPARLLLKETLCIPPVAVPNLRTEIALVFPSHHPGLSENSYGS
MZ097700_HBSP_P-D      LQARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MZ097701_HBSP_P-D      RPARDHAEPARLLLKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097704_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVXNLRTEIAPVFPSHHPGLSENSYGS
MZ097705_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097707_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHLGLSENSYGS
MZ097709_HBSP_P-D      LPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097710_HBSP_P-D      PPARDHAGPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097711_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MZ097713_HBSP_P-D      PPARDHAEPARLLLKEPLCIPHVAVQNLRTEIAPVFPSHHLGLSENSYGS
MZ097715_HBSP_P-D      PPVRDHAEPARQLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097717_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHHGLSENSYGS
MZ097720_HBSP_P-D      PPARDHAEPARLLLKEPLCIPXVAVQNLRTEIAPVFPSHHPGLSENSYGS
MZ097728_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097730_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPAAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097750_HBSP_P-D      PPAWDHAEPARLLFKEPLCIPHVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097751_HBSP_P-D      PPARDHAEPARPLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097765_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVQNLRTEIAPVFPSHHPGLSENSYGS
MZ097771_HBSP_P-D      PPARDHAEPARLLLKEPXCIPPVAVPNLRTEIAPVFPSHHLGLSENSYGS
MZ097772_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097779_HBSP_P-D      PPARDXAEPAXLLLKEPLCIPPVAVPNLXTEIAPVFPSHHPGLSENSYGS
MZ097780_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097787_HBSP_P-D      LPARDHAEPARLLLKEPLCIPPVAVXNLRTEIAPVFPSHHPGLSENSYGS
MZ097789_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFPSHHPGLSENSYGS
MZ097792_HBSP_P-D      PPARDHAEPARLLLKEPLCIPPVAVPNLRTEIAPVFP