HBVdb

Dataset for protein SHBs of genotype C

[Download (right click)] [Sequences] [Repertoires]

10940 sequence(s)

CLUSTAL W (1.8) multiple sequence alignment


KX276967_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ798297_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU979921_SHBs_P-C      --------LGPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPKCPG
AB014360_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AB014361_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AB014362_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AB014363_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLBSWWTSLNFLGGAPTCPG
AB014364_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB014365_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPG
AB014367_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AB014368_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
AB014369_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGEAPXCPG
AB014371_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB014372_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTKILTIPQSLBSWWTSLNFLGGAPACPG
AB014373_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB014374_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB014376_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB014377_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB014378_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGEAPKCPG
AB014379_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
AB014380_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRIRTIPQSLDSWWTSLNFLGGVPKCPG
AB014381_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB014382_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPKCPG
AB014383_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
AB014384_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGEAPKCPG
AB014385_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPG
AB014387_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGEVPKCPG
AB014388_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLBSWWTSLSFLGGAPKCLG
AB014389_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AB014390_SHBs_P-C      MESTTSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AB014391_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
AB014392_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPG
AB014393_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB014394_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB014396_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB014397_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPXCPG
AB014398_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB014399_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB026811_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB026815_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB029950_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPG
AB029951_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AB029952_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029953_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029954_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029955_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
AB029956_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCRG
AB029957_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029958_SHBs_P-C      MESTTSGFLGPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPG
AB029959_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPG
AB029960_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029961_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029962_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029963_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029964_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029965_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029968_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029969_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029970_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029975_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029977_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029990_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB030508_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB030510_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB030511_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPTCPG
AB030512_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTILQSLDSWWTSLNFLGGAPTCPG
AB030514_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB030515_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB030516_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB031262_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
AB033550_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB033551_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB033552_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB039740_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB039741_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB039742_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAHTCPG
AB042282_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB042284_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB042285_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB049610_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLSFLGGAPTCRG
AB050018_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB074047_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLREIPACPG
AB074755_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB105174_SHBs_P-C      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB106895_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB111114_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPACPG
AB111115_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB111116_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB111117_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB111118_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB111119_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB111120_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB111122_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB111123_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
AB111124_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB111946_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB112063_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCSG
AB112065_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB112066_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB112348_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCSV
AB112408_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB112471_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB112472_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB113875_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB113877_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB113878_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
AB113879_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB115417_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSHSFLGGTPTCPG
AB115418_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWRTSLNFLGGAPTCPG
AB176642_SHBs_P-C      MESTTSGFLGPLLVLQXAFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
AB176643_SHBs_P-C      MESTTSGFPGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGEAPXCPG
AB182589_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195930_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
AB195931_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
AB195932_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
AB195936_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195937_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB195942_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195943_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195946_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195948_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB195949_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195953_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB198076_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB202071_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB202072_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB205123_SHBs_P-C      MENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB205124_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222716_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222717_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222719_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222720_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222723_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222727_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222730_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB222732_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222738_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
AB222739_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222741_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222743_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
AB222744_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222747_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222750_SHBs_P-C      MXDTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222752_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKPTCPG
AB222753_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222758_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222760_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222762_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222768_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222770_SHBs_P-C      MESTTAGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222772_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB222774_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222775_SHBs_P-C      MENTTXGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222777_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222781_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232091_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232092_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232093_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232094_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232096_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232097_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232098_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232099_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232100_SHBs_P-C      MESTTSGFLGPPLVLQAGFSLLTRILTIPKSLDSWWTSLNFLGGAPKCPG
AB232101_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232103_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232104_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232106_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232107_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
AB232108_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232109_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB232111_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
AB232113_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB232503_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232507_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232508_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPKCPG
AB232509_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232510_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232512_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232513_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232515_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
AB232517_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232518_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232520_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232521_SHBs_P-C      MESTTSGFLGPLLGLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPG
AB232522_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB241110_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB241111_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB241112_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB241113_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB246346_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB247916_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB250109_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB253407_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB253408_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPACPG
AB253409_SHBs_P-C      MECTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB253411_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB253412_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB253611_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB253612_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB253620_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB284371_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB288026_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB299858_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB300360_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB300368_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB300372_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB300373_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AB362932_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB365438_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPKCPG
AB365440_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPTCPG
AB365442_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
AB365451_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367392_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTKILTIPQSLDLWWTSLNFLGGAPACPG
AB367394_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367395_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367396_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367397_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367398_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367399_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367401_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB367402_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367403_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367404_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367405_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
AB367406_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367407_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367408_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367409_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AB367410_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB367411_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB367412_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB367413_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367414_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367416_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
AB367417_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367418_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367420_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPKCPG
AB367422_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367423_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367424_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367425_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
AB367426_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367427_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367428_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB367429_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367430_SHBs_P-C      MESTTSGFLVPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPG
AB367431_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367432_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367433_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB367434_SHBs_P-C      MENTASGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB367435_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPACPG
AB367802_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
AB367803_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPACPG
AB367804_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB368297_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB485810_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB493839_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
AB493844_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
AB540583_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB540584_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB554018_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AB554025_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPW
AB560661_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AB642097_SHBs_P-C      MESTTSGFLGPLLVLQAGYFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
AB642099_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB644281_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
AB644284_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
AB644287_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
AB670237_SHBs_P-C      MENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670238_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB670239_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670241_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670242_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGAPKCPG
AB670243_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670249_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPG
AB670251_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670252_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AB670253_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTILKNLDSWWTSLSFLGGAPTCPG
AB670255_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670256_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670258_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670259_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPKCLG
AB670260_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
AB670261_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670262_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670263_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670264_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
AB670265_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670267_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670268_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPACRG
AB670269_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AB670270_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670272_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB670273_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670274_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670275_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670277_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670278_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670279_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB670281_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670282_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670285_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670287_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670288_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670289_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRXLTIPQSLDSWWTSLNFLGGAPTCPG
AB670290_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670291_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWLTSLNFLGGAPTCPG
AB670292_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670295_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
AB670297_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670298_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670300_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670301_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670302_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670304_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
AB670306_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670307_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670308_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670310_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB675674_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB697490_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
AB697494_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB697502_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB697510_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB713885_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB713890_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB776870_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB776901_SHBs_P-C      METTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809473_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPG
AB809475_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPACPG
AB809525_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB809527_SHBs_P-C      MEITTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809531_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809536_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPKCPG
AB809539_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809548_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTKILTMPQSLDSWWTSLNFLGGAPACPG
AB809549_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
AB809550_SHBs_P-C      MESTTSGLLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809551_SHBs_P-C      MESTTSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
AB809553_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809554_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809555_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLSFLGGAHACPG
AB809556_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
AB809557_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB900099_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGVPTCPG
AB900109_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPACRG
AB900113_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGAPTCPG
AB931170_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB931171_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB971714_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
AB971715_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
AB981580_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF013631_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF036236_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF036238_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF036239_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF134139_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
AF182802_SHBs_P-C      MQNTTSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AF182803_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AF182804_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPKCPG
AF208867_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF208876_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
AF209390_SHBs_P-C      MECTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGAPTCLG
AF223955_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF223960_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF241410_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AF241411_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AF329858_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF329861_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF329862_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AF329864_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
AF335735_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF335736_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF363961_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF384371_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF411408_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF411410_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRGAPKCPG
AF411412_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
AF415218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF415219_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
AF415220_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPKCPG
AF415223_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPACPG
AF458665_SHBs_P-C      MENTTTGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF461357_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF461358_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AF533983_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTVPQSLDSRWTSLNFLGGAPTCPG
AJ748098_SHBs_P-C      MESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AP011106_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
AY057947_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY066028_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY122487_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122488_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122490_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122491_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122493_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122494_SHBs_P-C      MEGTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122497_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLREAPVCPG
AY122498_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122499_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGEAPVCPG
AY122500_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGEAPRCPG
AY122502_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLREAPVCPG
AY122504_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122505_SHBs_P-C      MENTASGFLGHLLGLQAVFFLLTRILTIPQSLDSWWTSLNFLGETPVCPG
AY122506_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122507_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122508_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122509_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122510_SHBs_P-C      MDNTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122511_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122512_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQNLDSWWTSLNFLGEPPVCHG
AY122514_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122517_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122518_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122519_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122521_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122523_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPRSLDLWWTSLNFLGEAPVCPG
AY122524_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122525_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122527_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEALVCPG
AY122528_SHBs_P-C      MEGTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122529_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122535_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122536_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122537_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122538_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122540_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122543_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122544_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AY122545_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122546_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
AY122547_SHBs_P-C      MENTTSGFLGPLLGLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122548_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRVLTIPQSLDSWWTSLNFLGGAPVCPG
AY122549_SHBs_P-C      MESTTSGLLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122577_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTXPQSLDSWWTSLNFLGEAPACPG
AY122579_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AY122580_SHBs_P-C      MESTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AY122581_SHBs_P-C      MESTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFPGEAPACPG
AY122582_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AY122583_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AY122584_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AY167090_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY167091_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY167092_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPRCPG
AY167099_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPG
AY206376_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPG
AY206378_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY206381_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
AY206382_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AY206384_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY206385_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
AY206386_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY206389_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AY206392_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY220699_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
AY306136_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY345162_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY345163_SHBs_P-C      MESTTSGILGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY582136_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY596107_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY641559_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY641560_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY641561_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY641562_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY641563_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AY646444_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738823_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY738824_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
AY738825_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGESPMCPG
AY738826_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY738827_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY738828_SHBs_P-C      MENTTSGFLGPLLVLQPVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY738829_SHBs_P-C      MENITSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY738830_SHBs_P-C      MENTTSGFHGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY738831_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFSGGAPVCPG
AY738832_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY738833_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY738834_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY738835_SHBs_P-C      MENTTLGFLRPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPKCPG
AY738836_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738837_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738838_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738839_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738841_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738842_SHBs_P-C      MDKTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738843_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738844_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738845_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738846_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
D00630_SHBs_P-C        MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
D10055_SHBs_P-C        MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
D12980_SHBs_P-C        MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
D23681_SHBs_P-C        MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
D23682_SHBs_P-C        MESTTSGFLGPLLVLQAVFFSLTRIHTILQSLDSWWTSLNFLGGAPTCPG
D23683_SHBs_P-C        MESTTSGFLGPLLVLQAVFFSLTRIHTILQSLDSWWTSLNFLGGAPTCPG
D23684_SHBs_P-C        METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
D28880_SHBs_P-C        MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPKCPG
D50519_SHBs_P-C        MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
D50520_SHBs_P-C        MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089756_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
DQ089757_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089758_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
DQ089760_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089761_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089762_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
DQ089763_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
DQ089765_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089766_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089767_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
DQ089768_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
DQ089770_SHBs_P-C      MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089772_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089773_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
DQ089775_SHBs_P-C      MESTTSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089776_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPG
DQ089777_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVAPTCPG
DQ089778_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089780_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
DQ089783_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089784_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
DQ089785_SHBs_P-C      MESTTSGFLGPLLVXQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089786_SHBs_P-C      MESISSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089787_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
DQ089788_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089790_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089791_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
DQ089792_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089794_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
DQ089795_SHBs_P-C      MENTISXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
DQ089796_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
DQ089797_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089799_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089800_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089801_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089802_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089803_SHBs_P-C      MESTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089804_SHBs_P-C      MESTTSGFLXPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ141657_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
DQ141658_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ141659_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ141661_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ141663_SHBs_P-C      MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ141664_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSGWTSLNFLGGTPACPG
DQ141665_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ141667_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ246215_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ315782_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ315783_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ361526_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ361534_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ370438_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ370439_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAHACPG
DQ377161_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ377162_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ377163_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ377164_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ377165_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412229_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412230_SHBs_P-C      MESTTSGFLXPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412232_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
DQ412234_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGEVPKCPG
DQ412236_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412238_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
DQ412239_SHBs_P-C      METTTSGFLGPLRVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGALMCPG
DQ412241_SHBs_P-C      MESTTSGFPGPLRVLQEGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412242_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412243_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412245_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLXSWWTSLNFLGEXPXCPG
DQ412246_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412247_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412252_SHBs_P-C      MENTTSGFLGPLXGLQAGFSLLTRILTIPQSLDSWWTSLNFPGGTPKCPG
DQ412253_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412254_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412255_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412256_SHBs_P-C      TESTTSGFPGPLRVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412258_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412259_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
DQ412261_SHBs_P-C      MESTTSGFLGPLLVLQAGXFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412262_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
DQ412264_SHBs_P-C      MXTQPSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412266_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
DQ412269_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGXXPXCXG
DQ412270_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412275_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412276_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ478885_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ478899_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ478900_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPTCPG
DQ478901_SHBs_P-C      MESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ536410_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
DQ536412_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ683578_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ890381_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ922649_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ922650_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ922651_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ980547_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ980549_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPG
DQ980551_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSPNFLGGAPTCRG
DQ986375_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ986376_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
DQ993691_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ993692_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF137802_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EF137803_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EF494377_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGAPTCPG
EF494379_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF536065_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF536066_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPG
EF645260_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF645261_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF645262_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF645263_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EF645264_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSPDSWWTSLNFLGGAPACPG
EF645265_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGAPTCPG
EF645267_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF645268_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF645269_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGKAPACPG
EF645270_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF688062_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU075315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU139510_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139511_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWASLNFLGGAPTCPG
EU139512_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139513_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139515_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKRLDSWWTSPNFLGGAPTCPG
EU139516_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139517_SHBs_P-C      MENIASGFLGPLLVLQAGFLLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139518_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139520_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139521_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139522_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTVPKSLDSWWTSLNFLGGAPTCPG
EU139524_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139525_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKGLDSWWTSLNFLGGAPTCPG
EU139527_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139532_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139536_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU139540_SHBs_P-C      MENTTSGFLEPLLVLQAGFFLLTRILTIPLSLDSWWTSLNFLGGAPTCPG
EU139541_SHBs_P-C      MENRTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU305541_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGAPTCPG
EU305542_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306671_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
EU306672_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
EU306673_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306674_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306688_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306689_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGAPTCPG
EU306690_SHBs_P-C      MESATSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306691_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306713_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306719_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306721_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPG
EU306725_SHBs_P-C      MESTTSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306726_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306727_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU439009_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILSIPQSLDSWWTSLNFLGGAPTCPG
EU439015_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU498227_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGAPTCPG
EU522068_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU522071_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTLPQSLDSWWTSLNFLGEAPTCPG
EU547559_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU547562_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTILQSLDSWWTSLNFLGGAPTCPG
EU554535_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU554536_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPG
EU554537_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU554540_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU554541_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU554542_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU560438_SHBs_P-C      MENAASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVTPACPG
EU560439_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPTCPG
EU560440_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU562215_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU562217_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU562218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU570067_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU570072_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU570073_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU579442_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU579443_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU589336_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU589340_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU589341_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU589342_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU589345_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU670263_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPMCPG
EU717212_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU717214_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLSFLGGAPTCPG
EU717215_SHBs_P-C      MENTTSGFLGLLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPKCPG
EU717217_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU717218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDLWWTSLNFLGEAPKCPG
EU796069_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU796070_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871969_SHBs_P-C      MENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU871970_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU871971_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPKCPG
EU871972_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU871973_SHBs_P-C      MENTTSGFLGLLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
EU871974_SHBs_P-C      MENTTSGFLGRLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871975_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU871976_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU871978_SHBs_P-C      MENTTSGFLGPLLVLQTGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871980_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
EU872000_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU872002_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU872008_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU872012_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU872013_SHBs_P-C      MENTTSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU881996_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916212_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916214_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916216_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAHVCPG
EU916218_SHBs_P-C      MENTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916219_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGAPTCPG
EU916223_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916225_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916227_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU916233_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916234_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916237_SHBs_P-C      MENTASGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916238_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU919165_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU919168_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPRCPG
EU919169_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
EU921790_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU921792_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU921793_SHBs_P-C      MEYTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU921795_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU921796_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU921797_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
EU921799_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926420_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926423_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926425_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926427_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU926430_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
EU926431_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926433_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926435_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926438_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926439_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926442_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLFXXYPXTQSLDSWWTSLNFLGGAPTCPG
EU926445_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPTCPG
EU926447_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926451_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926452_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926453_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926456_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926457_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGXAPACPG
EU926461_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926469_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926472_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU927151_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927152_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
EU927153_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU927154_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
EU927161_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927163_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
EU927165_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927168_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927169_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927170_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
EU927171_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927172_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
EU927173_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927174_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927175_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927178_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU927179_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927182_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927183_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927185_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927186_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927188_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
EU927193_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927195_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927196_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU927197_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927202_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927203_SHBs_P-C      MENTASXFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927204_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927205_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927206_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927208_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU927209_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU927211_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
EU927214_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927217_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927219_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927221_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927225_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927230_SHBs_P-C      MENTASGFLGPLLXLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPXCPG
EU927232_SHBs_P-C      MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927240_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927241_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927248_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927249_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927255_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
EU927256_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
EU927258_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927260_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927261_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927262_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927265_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927266_SHBs_P-C      MENTTSGFLGPLLVXQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927268_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927270_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927271_SHBs_P-C      MGNTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU927273_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927278_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU927280_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGXAPKCPG
EU927281_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPG
EU927285_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939536_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU939537_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLXFLGGAPTCPG
EU939539_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPG
EU939540_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939542_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
EU939543_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939544_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939545_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939546_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939548_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939550_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPG
EU939553_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939554_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939556_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939557_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939558_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGEAPACPG
EU939561_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939563_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939564_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU939566_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939567_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU939568_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTITQSLDSWWTSLNFLGGAPTCPG
EU939571_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939572_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWLTSLNFLGGAPTCPG
EU939579_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939582_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU939583_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU939585_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPG
EU939586_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPACPG
EU939587_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939588_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939592_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGTPTCPG
EU939594_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939595_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU939596_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU939597_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPACPG
EU939599_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939601_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939603_SHBs_P-C      MESTTSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU939607_SHBs_P-C      MENTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939609_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939612_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939614_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939615_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939617_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939619_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939625_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939626_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939640_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
EU939643_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU939644_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEVPKCPG
EU939645_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU939647_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939649_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPKCPG
EU939651_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPACPG
EU939653_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939654_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939655_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939657_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU939659_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFPGGAPRCPG
FJ023639_SHBs_P-C      MESTTSGFLGPLLVLXEGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023645_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023646_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023648_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023652_SHBs_P-C      MESTTSGFLRPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ023655_SHBs_P-C      MESTTSGFLGPLHVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ023695_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023698_SHBs_P-C      MESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023709_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
FJ023711_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023716_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023726_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023727_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023734_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023735_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023736_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023744_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGXPTCPG
FJ023745_SHBs_P-C      MESXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023747_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023748_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
FJ023753_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023765_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023774_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
FJ023783_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ023785_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023786_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023787_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023795_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023800_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPTCPG
FJ023804_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023805_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FJ023806_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ023807_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ023809_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023818_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQXLDSWWTSLNFLGEAPKCPG
FJ023820_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023821_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023827_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023833_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ023834_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023841_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ023859_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023861_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023868_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023872_SHBs_P-C      MESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023874_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023886_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023891_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023892_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ023927_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ023928_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023932_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPTCPG
FJ023935_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FJ023939_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023945_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023966_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ023977_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPACPG
FJ023980_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPACPG
FJ023985_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ024002_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024021_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCLG
FJ024026_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ024034_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024035_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024037_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ032331_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ032332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ032333_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ032334_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
FJ032336_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ032338_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ032340_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ032341_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ032346_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ032347_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ032350_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ032351_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ032355_SHBs_P-C      MENTTSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ032356_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGAPTCPG
FJ032361_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ358595_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPACPG
FJ358596_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ358597_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ358598_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLNFLGGAPACPG
FJ386589_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPTCLG
FJ386591_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386592_SHBs_P-C      MESTTSGFLXPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACLG
FJ386595_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ386596_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386597_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386598_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386601_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386602_SHBs_P-C      MENTTSGFLGPLLALQAGLFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386603_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386604_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ386605_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386607_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPG
FJ386611_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGALTCPG
FJ386612_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ386613_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386614_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386620_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386621_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386623_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386624_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCLG
FJ386625_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386626_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ386627_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386629_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386630_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ386631_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
FJ386632_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGEAPKCPG
FJ386640_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPKCPG
FJ386641_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386645_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386647_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386651_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386652_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386653_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386657_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386661_SHBs_P-C      MENTTSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ386662_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ386663_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ386670_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSXWTSLNFLGGAPTCRG
FJ386671_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386672_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386673_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ386677_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCRG
FJ386679_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ386689_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ518813_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ560991_SHBs_P-C      MENTTSGFLGPMLVLQAGFFLLTXILTIPXSLDSWWTSLNFLGGAPTCPG
FJ560994_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ560997_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ560999_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLXFLGGAPTCPG
FJ561005_SHBs_P-C      MENTTSGFLRPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561008_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ561010_SHBs_P-C      MENITSGFLGPLLVLQAGFSLLTRVLTIPQSLDSWWTSLNFLGGAPTCPG
FJ561011_SHBs_P-C      MENTXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561012_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561014_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ561016_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561020_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561022_SHBs_P-C      MDNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561028_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561030_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPHSLDSWWTSLNFLGGAPTCPG
FJ561032_SHBs_P-C      MERTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
FJ561033_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561037_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561040_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFPGGAPKCPG
FJ561041_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
FJ561042_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561043_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561045_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ561048_SHBs_P-C      MENTTSGFLGPMLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPTCPG
FJ561049_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPKCPG
FJ562221_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
FJ562225_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ562228_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGVPTCPG
FJ562230_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562235_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ562238_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562239_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562243_SHBs_P-C      MENTTSGFLGPLLVLQGGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562244_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562248_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ562250_SHBs_P-C      MENTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562251_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562255_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTRILTILQSLDSWWTSLNFLGGAPTCPG
FJ562256_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRSPG
FJ562261_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562264_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562265_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562266_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562269_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562270_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562273_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562279_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562284_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562285_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562292_SHBs_P-C      MENTTSGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562293_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562295_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562299_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562300_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562301_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562306_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562307_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562308_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562310_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCSG
FJ562313_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGAPTCPG
FJ562315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562320_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562324_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ562325_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPG
FJ562326_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562333_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPG
FJ562334_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562335_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562337_SHBs_P-C      MESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562339_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562340_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
FJ621589_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ621590_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621591_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621593_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPACPG
FJ621594_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ621595_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621597_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621598_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621599_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
FJ621609_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621610_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621798_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621811_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621812_SHBs_P-C      MENTTSGYLGPLHVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ621813_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621814_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621815_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621816_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPACPG
FJ621817_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ621818_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621820_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCLG
FJ621821_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ621823_SHBs_P-C      MENTTSAFLGPLLVLLAGFSLLTRILTIPQSLDSWWTSLNFLGEVPKCPG
FJ621824_SHBs_P-C      MENTTSGILGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ621825_SHBs_P-C      MENTTSGSLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ621826_SHBs_P-C      MENTTSGFPGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621829_SHBs_P-C      MENTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621830_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPACPG
FJ621831_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621832_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621833_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621834_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621835_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621836_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPTCPG
FJ621837_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621839_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621841_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621843_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621844_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTFLNFLGGAHKCPG
FJ621845_SHBs_P-C      MENTTSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ621846_SHBs_P-C      MENTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621847_SHBs_P-C      MENTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621848_SHBs_P-C      MENTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621849_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621850_SHBs_P-C      MENTTSGFLGPLLVLQAGFILLTRILTIPQSLDSWLTSLSSLGGAPKCPG
FJ621851_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621852_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ621853_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621854_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWLTSLNFLGGAPTCPG
FJ621855_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ621856_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFPGGAPKCPG
FJ621857_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFPGGAPKCPG
FJ621859_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621861_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621862_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621863_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621868_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621869_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621870_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ621871_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ621872_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGVPTCPG
FJ621873_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWLTSLSFLGGTPACPG
FJ621876_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLIRILTIPQSLDSWWTSLNFLGEAPACPG
FJ621877_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLIRILTIPQSLDSWWTSLNFLGEAPACPG
FJ621878_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLIRILTIPQSLDSWWTSLNFLGEAPACPG
FJ621879_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLNIILTIPHRLDSWWTSLNFLGGAPTCPG
FJ621880_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKIHTIPQSLDSWWTSLNFLGGTPTCPG
FJ621881_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621882_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621883_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621884_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621885_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621886_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
FJ621887_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
FJ621889_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPVCPG
FJ621890_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
FJ621891_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILIIPQSLDSWWTSLNFLGGAPRCPG
FJ621892_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPG
FJ621893_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQKLDSWWTSLNFLGGAPTCPG
FJ621894_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPKCPG
FJ621895_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGALKCPG
FJ621896_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
FJ621897_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEAPACPG
FJ621898_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGTPKCPG
FJ621899_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ621901_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ621903_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
FJ621904_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
FJ621905_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
FJ621907_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKPTCPG
FJ621908_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
FJ621909_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
FJ621910_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPACPG
FJ621912_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621913_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621915_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621917_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621923_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621926_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621928_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621930_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621931_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621933_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621934_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621935_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621936_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621937_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621939_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCLG
FJ621940_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621941_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621943_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621944_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621946_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621947_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621949_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621954_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621956_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621957_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621958_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621959_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621962_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621963_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621964_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621965_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621967_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621968_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621972_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621974_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621977_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621979_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621980_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621986_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621987_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621988_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621990_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621991_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621993_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621994_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621996_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622000_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622002_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622004_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622005_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622006_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622007_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622009_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622010_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622015_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622016_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622017_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622018_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622023_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622025_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622027_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622028_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622030_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622033_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622036_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622037_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622040_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622042_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622045_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622046_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622048_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622051_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622052_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622065_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622066_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622067_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622068_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622071_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622072_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622073_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622076_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622078_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622080_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622083_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622084_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622086_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622090_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622091_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622093_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622096_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622097_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622099_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622100_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622101_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622102_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622105_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622107_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622108_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622110_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622111_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622112_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622113_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622116_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622117_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622118_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622120_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622128_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622130_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622131_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622135_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622136_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622137_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622138_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622139_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622143_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622148_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622151_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622152_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622153_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622157_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622158_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622165_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622167_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622169_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622170_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622172_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622174_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622175_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622176_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622177_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622179_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622181_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622183_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622184_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622185_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622186_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622187_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622189_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622190_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622191_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622207_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622213_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622214_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622215_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622219_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622221_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622223_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622224_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622228_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622230_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622231_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622232_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622233_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622236_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622237_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622238_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622239_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622240_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622241_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622242_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622243_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ622245_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTXPG
FJ622247_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ622248_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
FJ622249_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622250_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622255_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622257_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622258_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622259_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622260_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622261_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622262_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622263_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622264_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622265_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622271_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622272_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622273_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622274_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622275_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622276_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622277_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622278_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622280_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622281_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622283_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622286_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622287_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622288_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622289_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622290_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622292_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622294_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622296_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
FJ622297_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
FJ622298_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
FJ622301_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622302_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPKCPG
FJ622303_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
FJ622304_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPACPG
FJ622305_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLWGAPTCPG
FJ622306_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
FJ622307_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
FJ622308_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
FJ622309_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
FJ622310_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGTPACPG
FJ622311_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPKCLG
FJ622313_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622314_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPRCPG
FJ622316_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622320_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLSFLGGAPTCPG
FJ622324_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622325_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622326_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGAPTCPG
FJ622327_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622328_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622329_SHBs_P-C      MENTTSGFLGPLLVLQAGXFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622330_SHBs_P-C      MENTTSGFLGLLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ622332_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTILQSLDLWWTSLNFLGGVPXCPG
FJ622333_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEALKCPG
FJ622334_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622336_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622337_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622342_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622343_SHBs_P-C      MENTASGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622344_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622345_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622346_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622348_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
FJ622349_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
FJ622350_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622352_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622354_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622355_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622357_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622358_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622359_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622363_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622366_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622367_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622368_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622372_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622373_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622374_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622375_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622376_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622377_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622379_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622381_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622384_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622385_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622386_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622390_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622393_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622394_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622395_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622399_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622401_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622403_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622404_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622405_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622406_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622410_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622411_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622412_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622416_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622417_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622418_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622420_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622421_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622422_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622423_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622424_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ622425_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ622426_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ622428_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622429_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
FJ622430_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWISLNFLGGAPKCPG
FJ622431_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
FJ622432_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGAPACPG
FJ622433_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPTCPG
FJ622434_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622435_SHBs_P-C      MENTASGFLGPVLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622436_SHBs_P-C      MENTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622437_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622438_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622441_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622442_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622443_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGAPTCPG
FJ622445_SHBs_P-C      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPTCPG
FJ622446_SHBs_P-C      MENATSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622449_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622450_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622451_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622452_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622455_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGTPKCPG
FJ622457_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622458_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACLG
FJ622459_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPACPG
FJ622460_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTKILTILQSLDSWWTSLNFLGGTPTCPG
FJ622461_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622467_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622469_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622470_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622471_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622472_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622475_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622478_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
FJ622480_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWLTSLSFLGGAPTCPG
FJ622481_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWLTSLNFLGGAPTCPG
FJ622482_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSRSFLGGAPTCPG
FJ622483_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPACPG
FJ622484_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPACPG
FJ622485_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPTCPG
FJ622486_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPACPG
FJ622487_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGVALTCPG
FJ622489_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPKCPG
FJ622490_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ622491_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ622492_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ622493_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ622494_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ622495_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ622496_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
FJ622497_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622499_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622500_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622501_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622502_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622503_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622504_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622505_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622506_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622507_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622508_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622509_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622510_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622511_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622512_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622514_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622520_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622521_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622522_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622526_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622527_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622530_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622531_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622532_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622533_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622535_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622536_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622537_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622538_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622539_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622540_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622542_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622543_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622545_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622546_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622547_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622548_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622551_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622552_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622557_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622558_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622560_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622562_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622565_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622567_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622569_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622570_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622571_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622572_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622575_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622576_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622579_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622581_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622582_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622584_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622586_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622591_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622597_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622602_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622610_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622612_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622613_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622615_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622617_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622618_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622619_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622620_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622621_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622626_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622628_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622630_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622633_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622635_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622637_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622639_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622641_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622642_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622643_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622645_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622648_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622650_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622654_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622656_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622661_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622662_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622663_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622664_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622665_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622668_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622669_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622673_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622674_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622676_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622677_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622678_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622679_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622681_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622683_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622684_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622686_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622690_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622693_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622694_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622696_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622697_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622698_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622701_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622702_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622703_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622704_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622706_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622707_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622708_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ622709_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ622710_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ622711_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ622712_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ622714_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCXG
FJ622716_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622719_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622720_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622721_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622722_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622723_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622724_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622725_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622726_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622727_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622728_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622729_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622730_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622731_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622732_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622734_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622735_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACRG
FJ622737_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALXCPG
FJ622738_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALACPG
FJ622739_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALXCPG
FJ622740_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622742_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622743_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622744_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622745_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPACPG
FJ622746_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPTCPG
FJ622747_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPTCPG
FJ622748_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPACPG
FJ622749_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLEGALKCRG
FJ622750_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPKCPG
FJ622752_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPACPG
FJ622753_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPACPG
FJ622754_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622755_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGGAPTCPG
FJ622756_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622757_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622758_SHBs_P-C      MESTTSGFLGPLLVLQGGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622759_SHBs_P-C      MESTTSGFLGPVLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622760_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
FJ622761_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622763_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622765_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622767_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622768_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622769_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622770_SHBs_P-C      MEITTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622771_SHBs_P-C      MGNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622773_SHBs_P-C      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622774_SHBs_P-C      MESTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622776_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRIHTIPQSLDSWWTSLNFLGGAPTCPG
FJ622779_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622780_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622781_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622782_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLNFLGGAPTCPG
FJ622783_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622787_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622791_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622792_SHBs_P-C      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622793_SHBs_P-C      MESTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ622794_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGEVPKCPG
FJ622796_SHBs_P-C      MESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622797_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622798_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622799_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622800_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622801_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPKCPG
FJ622802_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622805_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGVPTCPG
FJ622807_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCXG
FJ622810_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622811_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622812_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622814_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
FJ622815_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPACPG
FJ622816_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622818_SHBs_P-C      MGTTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
FJ622819_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622820_SHBs_P-C      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622821_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
FJ622823_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622824_SHBs_P-C      MESTTSGFLGPMLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622825_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ622828_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622829_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622830_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622832_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622833_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622834_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622835_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
FJ622838_SHBs_P-C      KENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622839_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622840_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622841_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622842_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622843_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622846_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPTCPG
FJ622847_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622850_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622852_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622853_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622854_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622855_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622859_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622861_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ622862_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPTCPG
FJ622863_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALACPG
FJ622873_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622877_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622878_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ622882_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ709479_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGAPTCRG
FJ715341_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPACPG
FJ715343_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715344_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715351_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715352_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715355_SHBs_P-C      MDNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715359_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGAPTCPG
FJ715360_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ715364_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715365_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
FJ715371_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715375_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ715376_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715377_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715379_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715381_SHBs_P-C      MESTTSGFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715389_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPS
FJ715391_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715392_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715397_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ715400_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715402_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715404_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715405_SHBs_P-C      MESTTSGFLGPLLMLQAGFLLLTRVLTIPQSLDSWWTSLNFLGGAPTCPG
FJ715415_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715416_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715418_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751284_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751289_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ751290_SHBs_P-C      MENTTLGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751291_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751298_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751300_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTKILTIPQRLDSWWTSLNFLGGAPTCPG
FJ751301_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751305_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLSFLGGAPTCPG
FJ751309_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ751318_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751319_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ751321_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751322_SHBs_P-C      MDSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751323_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751326_SHBs_P-C      MDDPTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ751328_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ751329_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751330_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751331_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751332_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751333_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751335_SHBs_P-C      KESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSPNFLGGAPTCPG
FJ751337_SHBs_P-C      KESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSPNFLGGAPTCPG
FJ751338_SHBs_P-C      KESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSPNFLGGAPTCPG
FJ751339_SHBs_P-C      KESTTSGFLGPLLVLQAGFFLLTRILTIPQSPDSWWTSPNFLGGAPTCPG
FJ751345_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751349_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751351_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751353_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751354_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751370_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751379_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
FJ751380_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751381_SHBs_P-C      MEPPAGGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751393_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ751394_SHBs_P-C      MENIASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751396_SHBs_P-C      MENISSGYLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751404_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ751405_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751414_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751418_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751420_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
FJ751422_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751424_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGALKCLG
FJ751428_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ751439_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751441_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTHKCPG
FJ751442_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751444_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGIPTCPG
FJ751445_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPECPG
FJ751454_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGAPTCPG
FJ751455_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPKCPG
FJ751458_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751475_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ751477_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751478_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751484_SHBs_P-C      MENTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751487_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751489_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751501_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751513_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751525_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751536_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751538_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ751542_SHBs_P-C      MENTTSGFLGPLHVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751552_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751553_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751558_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751559_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751561_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQNLDSWWTSLNFLGEALKCSG
FJ751562_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751563_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751569_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751575_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ751576_SHBs_P-C      MENTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751580_SHBs_P-C      MESTTSGFLGPMLVLQAGFFSVTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751581_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
FJ751584_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751593_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751600_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751606_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751607_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ753981_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPG
FJ787441_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787442_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ787447_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787448_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ787449_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ787450_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787452_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ787453_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787455_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ787456_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ787457_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787462_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787463_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787464_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787466_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787467_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPG
FJ787468_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPG
FJ787469_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787471_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ787479_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787481_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787482_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787483_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787487_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPKCPG
FJ787488_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ787489_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ787490_SHBs_P-C      MENTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAHAYPG
FJ899761_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWLTSLNFLGGAPTCPG
FJ899765_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
FJ899767_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
FJ899769_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
FJ899770_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPRCPG
FJ899771_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ899772_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ899773_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
FJ899774_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ899778_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ899783_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ899788_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ899789_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ904423_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
FJ905226_SHBs_P-C      MENNPSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FM200184_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FM200208_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FM200209_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FN295505_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPKCPG
FN295521_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FN295527_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FN295529_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821812_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821813_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821816_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821819_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821823_SHBs_P-C      MESTTSGFLGPLLVLQAGFLLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821828_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTPLNFLGGAPTCPG
FR821830_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821832_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821833_SHBs_P-C      MESTTSGFLGPLLVLRAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821834_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FR821835_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821836_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821837_SHBs_P-C      MESTTSGFLGPLLVLQVGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FR821839_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821841_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821843_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821845_SHBs_P-C      MESTTSGFLGPLLVLQVGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821847_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821849_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821851_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FR821853_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821854_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821856_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821859_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821860_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821861_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821862_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821863_SHBs_P-C      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821864_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821865_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821869_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821870_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821871_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FR821873_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821874_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821877_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
FR821879_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821882_SHBs_P-C      MESTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821883_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821885_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821886_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821895_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821897_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821900_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821901_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGAPTCPG
FR821903_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821904_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821905_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCLG
FR821907_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821910_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821916_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821917_SHBs_P-C      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821919_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGGAPTCPG
FR821923_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTISQSLDSWWTSLNFLGGAPTCPG
FR821926_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821932_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821935_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821936_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821938_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821941_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821942_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821943_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821954_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821959_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FR821961_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FR821963_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FR821967_SHBs_P-C      MENTTSGFLGHLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
FR821968_SHBs_P-C      MENTTSGFLGHLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FR821974_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821976_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821977_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821979_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822002_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822003_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822007_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822011_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822013_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822015_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822018_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822019_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822025_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FR822026_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVRPG
FR822027_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
FR822028_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FR822029_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGALVCPG
FR822030_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FR822031_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
FR822035_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822036_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822037_SHBs_P-C      MESTTSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822039_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRIFTIPQSLDSWWTPLNFLGGAPTCPG
FR822048_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLNFLGGAPTCPG
FR822049_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822052_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822053_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822059_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822061_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGEAPKCPG
FR822064_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FR822066_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FR822075_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGAPTCPG
FR822076_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPTCPG
FR822078_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822079_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FR822098_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822104_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822112_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822116_SHBs_P-C      MESTTSGPLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FR822118_SHBs_P-C      MESTTSGLLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FR822119_SHBs_P-C      MESTTSGLLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FR822120_SHBs_P-C      MESTTSGLLGPLLALQAGFFLLTRILKIPQSLDSWWTSLNFLGGAPTCRG
FR822121_SHBs_P-C      MESTTSGLLGPLLGLQAGFFLLTRILTMPQSLDSWWTSLNFLGGAPTCRG
FR822122_SHBs_P-C      MESTTSGPLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCRG
FR822125_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822136_SHBs_P-C      MESTTSGFLGSLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822140_SHBs_P-C      MESTASGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822143_SHBs_P-C      MESTASGFLGPLLVLRAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822146_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822148_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822149_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822150_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822152_SHBs_P-C      MESTTSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822153_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822154_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822155_SHBs_P-C      MENTTSGFLGPLLVLQAGSFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822156_SHBs_P-C      MESTTSGFLGHLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822166_SHBs_P-C      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FR822170_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822172_SHBs_P-C      MESATSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822173_SHBs_P-C      MESTTSGFLGPLHVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ184326_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPA
GQ227692_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ227696_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ227697_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ259588_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ325782_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ325798_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GQ358153_SHBs_P-C      MESTTSGFLGPLVVLQAGFFLLTKILTIPQNLDSWWTSLNFLGGVPTCPG
GQ358158_SHBs_C-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
GQ372968_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCLG
GQ377518_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGAPTCPG
GQ377524_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377529_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377530_SHBs_P-C      MESTTSGFLGPLLVLQXGFXLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377533_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377536_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377540_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377541_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377543_SHBs_P-C      MENTTXGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377546_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377552_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377553_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377555_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377557_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377559_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377570_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377571_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377586_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
GQ377599_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377605_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377608_SHBs_P-C      MENTTSGLLGPLLVLQAGFFLLTRILKIPQSLDSWWTSLNFLGGAPTCPG
GQ377609_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377615_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377619_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377620_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GQ377628_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377636_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GQ402152_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ402153_SHBs_P-C      MENTTSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ402158_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ402161_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ402162_SHBs_P-C      MENTTSGFLGPLLVVQAGFFLVTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475309_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475316_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475321_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475325_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475333_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GQ475351_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475352_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475353_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GQ475355_SHBs_P-C      MESTTSGFXGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475356_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475357_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486061_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486081_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
GQ486082_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486090_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GQ486091_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGAPTCPG
GQ486107_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCXG
GQ486149_SHBs_P-C      MESTTSGFLGPLXXLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCXG
GQ486189_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486216_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486223_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGEAPRCPG
GQ486226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDXWWTSLNFLGEAPRCPG
GQ486236_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486246_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPG
GQ486264_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCXG
GQ486269_SHBs_P-C      MENTTSGFLGPLLVLQXVFFLLTKILTIPXSLDSWWTSLXFLGEAPRCPG
GQ486288_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
GQ486307_SHBs_P-C      MENTTSGFXGPLLVLQAVFFLLTRILTIPQSLDSWWTSLXFLGEXXXCPG
GQ486311_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
GQ486315_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCHG
GQ486319_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
GQ486320_SHBs_P-C      MESTTSGFLGPLLVLQAGXFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486327_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486335_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486348_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486350_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486372_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTKILTIPQSLDSWWTSLNFLGEAPRCPG
GQ486388_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486390_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCHG
GQ486393_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486394_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486396_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPKCPG
GQ486399_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
GQ486423_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486430_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
GQ486442_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
GQ486450_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486457_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486460_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486463_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486470_SHBs_P-C      MENTTSGFLGPLLVXQAXFFLLTXILTIPQSLDSWWTSLNFLGEAPRCPG
GQ486480_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486495_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486497_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486498_SHBs_P-C      MENTTSGXXGXLLVLQAVFFLLTXILTIPQSLDSWWTSLNFLGEAPRCPG
GQ486509_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486511_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486518_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGAPTCPG
GQ486524_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486533_SHBs_P-C      MESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
GQ486534_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486536_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486538_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
GQ486543_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486553_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486562_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
GQ486574_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486575_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486578_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCLG
GQ486591_SHBs_P-C      MESTTSGFLGPLXVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCXG
GQ486608_SHBs_P-C      MESTTSGFLGPLLVLQAVFXXLTRILTIPQSLDSWWTSLNFLGEAPRCPG
GQ486609_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
GQ486610_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486613_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGXAPTCPG
GQ486618_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGXAPTCPG
GQ486622_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486623_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486624_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
GQ486625_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486632_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486641_SHBs_P-C      MESTTSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486643_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486647_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486649_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486650_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486652_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486653_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPKCPG
GQ486654_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486660_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GQ486685_SHBs_P-C      MESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486688_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486690_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486695_SHBs_P-C      MEITTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486702_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486703_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486724_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486736_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486737_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAXTCPG
GQ486740_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLXSWWTSLNFLGGAPXCPG
GQ486744_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486750_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486760_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486763_SHBs_P-C      MENTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486764_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486766_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486777_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486786_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPKCPG
GQ486791_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
GQ486793_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPG
GQ486794_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGAXTCXG
GQ486800_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486803_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPXCPG
GQ486809_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLXFLGXAPKCPG
GQ486810_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486812_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCXG
GQ486814_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGAPTCPG
GQ486819_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486825_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGEAPACPG
GQ486835_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
GQ486837_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
GQ486839_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPG
GQ486854_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486855_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486859_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPXCPG
GQ486861_SHBs_P-C      MESTTSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486868_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
GQ486869_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486871_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GQ486872_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPG
GQ855370_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ855376_SHBs_P-C      MESTTSGFLRPLHVLQEGFFSLTRILTIPQSLDSWWTSLNFLEGAPTCPG
GQ855397_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
GQ872211_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924609_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924616_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
GQ924620_SHBs_C-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924622_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924629_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPA
GQ924642_SHBs_P-C      MESTASGLLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
GQ924643_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
GQ924658_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924678_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU078796_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
GU078798_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GU078800_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078802_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078811_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
GU078812_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
GU078813_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078820_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078824_SHBs_P-C      MENTTSGFLGPLLXLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
GU078841_SHBs_P-C      MDSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078846_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078852_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPTCPG
GU078857_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078858_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078859_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078860_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079190_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079191_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079195_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079197_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
GU079204_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
GU079205_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079206_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079211_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079213_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079217_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079224_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079225_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079228_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079231_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079233_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079235_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGALACPG
GU079238_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079239_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079240_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079241_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079242_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079243_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPKCPG
GU079244_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079246_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079250_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079252_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079253_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079254_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079255_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
GU079256_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GU079257_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079258_SHBs_P-C      MDNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079259_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079263_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079266_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079267_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079270_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGAPTCPG
GU079273_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079281_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
GU079282_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079283_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079293_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GU079299_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079301_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079302_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079303_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079305_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGALTCPG
GU079308_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGAPTCPG
GU079313_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
GU079314_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079315_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079324_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079332_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLHFSGGAPTFPG
GU079336_SHBs_P-C      MENTASGFLKPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079338_SHBs_P-C      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPTCPG
GU079339_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079342_SHBs_P-C      MESTTSGFLGPLLVLQGGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079347_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079348_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GU079351_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079355_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GU079359_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079360_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079362_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079363_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079364_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079365_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPKCPG
GU079369_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
GU079371_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079376_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079377_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079378_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
GU079379_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079380_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GU079381_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPKCPG
GU079383_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079384_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079387_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079388_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079389_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079390_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079391_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079392_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079393_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079394_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079408_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079409_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079410_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079412_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079424_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079427_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079429_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
GU079430_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079431_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079432_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079434_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079436_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079439_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079442_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079443_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEALKCPG
GU079446_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079447_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079450_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079451_SHBs_P-C      MENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPACPG
GU079452_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079453_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079454_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079458_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079459_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTRILTILQSLDSWWTSLNFLGGAPTCPG
GU079460_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079462_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079464_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079465_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079466_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079467_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079468_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079469_SHBs_P-C      MENTASGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
GU079470_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDPWWASLNFLGGAPTCPG
GU079472_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
GU079475_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
GU079477_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079479_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079480_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079482_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPACPG
GU079483_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079484_SHBs_P-C      MANTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079485_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079487_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU079488_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079490_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079494_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GU324995_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU357845_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU721029_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU798965_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU798981_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
GU798992_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU798994_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU798996_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU799033_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU979912_SHBs_P-C      MASTTSGFLGPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPKCPG
HE652149_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652209_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652223_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPTCPG
HE652240_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652254_SHBs_P-C      MESTTSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652273_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652275_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652295_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652303_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652345_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
HE652347_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652348_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652349_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652352_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652354_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
HE652355_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652358_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
HE652360_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
HE652394_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652400_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652401_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLMTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652461_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652499_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652542_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
HE652546_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652655_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652671_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652675_SHBs_P-C      MESTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652680_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652681_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652687_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPACPG
HE652690_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652691_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPACPG
HE652692_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652695_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652697_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652700_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652701_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652717_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPG
HE652723_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652728_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652755_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652796_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652807_SHBs_P-C      MENTTSGFLGHLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652808_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPTCPG
HE652815_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652818_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652819_SHBs_P-C      MESTTSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652821_SHBs_P-C      MESTTSGFLGPLLVLQAGXFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652822_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652824_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652830_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM011468_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILXIPQSLDSWWTSLNFLGGAPTCPG
HM011479_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLNFLGGVPTCPG
HM011486_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPG
HM011491_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM011493_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM011495_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
HM011500_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM011502_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM172488_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HM172491_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HM750131_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM750137_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM750141_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HQ638218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HQ700456_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700457_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700476_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700496_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700504_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700506_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
HQ700516_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPMCPG
HQ700517_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
HQ700529_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPXCPG
HQ700555_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSXWTSLNFLGEAPRCPG
HQ700556_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700559_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700562_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700563_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700566_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700569_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700570_SHBs_P-C      MENTASGHLGPLLGLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700571_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700572_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700574_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700575_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGEAPRCPG
HQ700576_SHBs_P-C      MENTTSGFXGPLLVXQAVFFLLTRILTIPQSLDSWWTSLSFLGEAPRCPG
HQ700577_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILIIPQSLDSWWTSLNFLGEAPRCPG
HQ700578_SHBs_P-C      MESTTSGYLGPLLVLQAVFFLLTRILTIPQSLDSWWTSRNFLGETPRCPG
JF436920_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JF828905_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JF828906_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JF828907_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JF828908_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JF828910_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JF828913_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JF828916_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
JF828918_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JF828921_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JF828922_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JF828923_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JF828924_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JF828928_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JF828929_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JF828937_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN315779_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
JN604121_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604129_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFRGGAPTCPG
JN604133_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPMCPG
JN604135_SHBs_P-C      MESTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN604140_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604147_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN604151_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604153_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604222_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
JN604231_SHBs_P-C      MESTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604232_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVXPTCPG
JN604243_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN604254_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604258_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604286_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650142_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
JN650143_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650146_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650147_SHBs_P-C      MESTTSGFLGPLLVLQAGFXXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650148_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN650151_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650156_SHBs_P-C      MENTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXLKCPG
JN650158_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650160_SHBs_P-C      MENTTSGFLGPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650161_SHBs_P-C      -DYTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650164_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
JN650165_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTXXQSLDSWWTSLNFLGGAPTCPG
JN650169_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650172_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN650173_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650174_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650179_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPG
JN650181_SHBs_P-C      MENTTSGFQGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650182_SHBs_P-C      MENTISGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPACPG
JN650183_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650185_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650186_SHBs_P-C      MEXTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPTCPG
JN650188_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650190_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650192_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650194_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGEAPKCPG
JN650197_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGXAPXCPG
JN827414_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN827416_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN827417_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN827418_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN827420_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN827421_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN827423_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN827424_SHBs_P-C      MESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980175_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980178_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980179_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGAPKCPG
JN980180_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPTCPG
JN980181_SHBs_P-C      MERQTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980182_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980183_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980185_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN980187_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980188_SHBs_P-C      MESKASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980192_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980195_SHBs_P-C      METNRSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980197_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980200_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980201_SHBs_P-C      MEKTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980202_SHBs_P-C      MEKTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980205_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN980206_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980211_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN980217_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980219_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
JN980221_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980223_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN980225_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPKCPG
JN980226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN980227_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980228_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980229_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980232_SHBs_P-C      MESTTSGFLEPLLGLQAGFFLLTRILTILQSLDLWWTSLNFLGGAPTCPG
JN980235_SHBs_P-C      MESTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980238_SHBs_P-C      MESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980243_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980244_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980251_SHBs_P-C      METATSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JN980253_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980256_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN980257_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN980258_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN980259_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN980260_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN980261_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN980262_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980264_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980265_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPG
JN980266_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980268_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980271_SHBs_P-C      MENTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN980272_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980273_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980278_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN980281_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980283_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980284_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
JN980285_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
JN980286_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
JN980287_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
JN980288_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
JN980292_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPG
JN980293_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPACPG
JN980295_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980297_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
JN980298_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPTCPG
JN980303_SHBs_P-C      MENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980306_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980311_SHBs_P-C      MEAITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980318_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980320_SHBs_P-C      METTTLGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980323_SHBs_P-C      MKLITSGLLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTPTCPG
JN980324_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN980325_SHBs_P-C      MENTASGFLKPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980327_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980328_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980329_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980330_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980331_SHBs_P-C      MENTASGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980333_SHBs_P-C      M-NTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980334_SHBs_P-C      M-NTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980335_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980339_SHBs_P-C      MKHTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980340_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980342_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980343_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980344_SHBs_P-C      MKRTTSGFLRPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPG
JN980345_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
JN980346_SHBs_P-C      MERTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
JN980347_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980349_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN980350_SHBs_P-C      MERPTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980351_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGAPTCRG
JN980352_SHBs_P-C      MGDIDSGLLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGEAPTCRG
JN980353_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPTCPG
JN980357_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980359_SHBs_P-C      MDSGTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980360_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
JN980362_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN980363_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPG
JN980366_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
JN980369_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGVPACPG
JN980370_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980372_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980375_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JN980380_SHBs_P-C      MESTESGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980384_SHBs_P-C      MEKTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980385_SHBs_P-C      MGDTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980386_SHBs_P-C      MEETTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980389_SHBs_P-C      MEGTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
JN980394_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980395_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ027317_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ027318_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLSFLGGAPTCRG
JQ027319_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGEAPKCPG
JQ027320_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ027321_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPXCPG
JQ027322_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGXAPKCPG
JQ027323_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ027324_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGEXPKCPG
JQ040129_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPKCPG
JQ040132_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040139_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040141_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040143_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JQ040144_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040145_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPXCPG
JQ040149_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
JQ040151_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040155_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040164_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JQ040168_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281122_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
JQ281123_SHBs_P-C      MESTTSGFLGPLLVLQXGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281125_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
JQ281126_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281127_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341610_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGAPXCPG
JQ341612_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341614_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341615_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341618_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341619_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGAPTCPG
JQ341620_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341621_SHBs_P-C      MESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPKCPG
JQ341624_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341626_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341628_SHBs_P-C      MESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341630_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JQ341631_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341632_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341633_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341634_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341635_SHBs_P-C      MESTTLGFLGPPHVLQEGFSLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JQ341639_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341642_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341643_SHBs_P-C      MENTTLGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
JQ341647_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAXTCPG
JQ341649_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGXPTCPG
JQ341650_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALXCPG
JQ341651_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341652_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
JQ341653_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341654_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341655_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGAPTCPG
JQ341656_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341660_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341661_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341664_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341665_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341666_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341668_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
JQ341669_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPG
JQ341670_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
JQ416172_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416173_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416179_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416182_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416197_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JQ416206_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JQ416208_SHBs_P-C      MENTTSEFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416209_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLBSWWTSLNFLGGAPTCPG
JQ416215_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIXQSLDSWWTSLNFLGGAPTCPG
JQ416308_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ429078_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514299_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514302_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JQ514303_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514305_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514306_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JQ514307_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JQ514308_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JQ514309_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514310_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514311_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPMCPG
JQ514314_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514403_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
JQ514404_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
JQ514407_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JQ514408_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514412_SHBs_P-C      MDNITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
JQ514414_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JQ514416_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514417_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JQ514419_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514420_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
JQ514422_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
JQ514423_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JQ514424_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514425_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514426_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPACPG
JQ514427_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514508_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514509_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514510_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514535_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514537_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ707707_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ707717_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ707722_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ707725_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ707733_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ707768_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
JQ707771_SHBs_P-C      MENTTSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
JQ707772_SHBs_P-C      MESTTSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGTPTCPG
JQ798295_SHBs_P-C      MENTTSGFLGPLLALQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JQ801472_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801473_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801478_SHBs_P-C      MESTTSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801480_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JQ801481_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801483_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
JQ801490_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801491_SHBs_P-C      MESTTSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
JQ801493_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801497_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801499_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLMTRILTIPQSLDSWWTSLNFLGEAPTCPG
JQ801501_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPTCPG
JQ801509_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801515_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801521_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ809705_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JX026877_SHBs_P-C      MENTTSGFLGPRLVLQAGFFSLTRILTIPQSLDSWLTSLNFLGEAPACPG
JX026880_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX026885_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX036326_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX036327_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLGSWWTSLNFLGGAPTCPG
JX036345_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX036346_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX036351_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLG
JX101329_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPKCPG
JX101330_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
JX125365_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX125366_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX125370_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX125371_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX125372_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGEVPACPG
JX292737_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX292738_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPX
JX292739_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPC
JX292740_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLXRILTIPQSLDSWWTSLNFLGGAPTCPG
JX292741_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPX
JX292742_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPX
JX292743_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGAPXCPG
JX292744_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429907_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429913_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGAPTCPG
JX429914_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429915_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX504534_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX504535_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JX504536_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX504537_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX504541_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JX507204_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX507205_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPXCPG
JX507211_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
JX507212_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPTCPG
JX661489_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661493_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661497_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGIPACPG
JX849633_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX870000_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948749_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948750_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948751_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948755_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948756_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948757_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948758_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948760_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948762_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGAPTCPG
JX948765_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948766_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPTCPG
JX948767_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KC191833_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KC191835_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLYSWWTSLNFLGGAPTCPG
KC191841_SHBs_P-C      MENTTSGFLGPLLVXQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191848_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGAPTCPG
KC191851_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191853_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191858_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191860_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191861_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPACPG
KC191862_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191866_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191867_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLBSWWTSLNFLGGAPTCPG
KC191871_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPACPG
KC191872_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191873_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191878_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGAPTCPG
KC191880_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191882_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191884_SHBs_P-C      MENXTSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLXFLGGAPACPG
KC191885_SHBs_P-C      MESXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPXCPG
KC191886_SHBs_P-C      MENTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWXTSLNFLGGAPXCPG
KC191887_SHBs_P-C      MESTTSGFLGPXLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191889_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCXG
KC191890_SHBs_P-C      MENTASGFLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGXXPTCPG
KC191892_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191893_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191894_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191895_SHBs_P-C      MESTTSGFXGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGAPTCPG
KC191896_SHBs_P-C      MENTASXFLGPLLXLQAGFFXLTRILTIPQSLDSWWTSLXFLGXAPXCPG
KC191897_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGAPTCPG
KC191898_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191899_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
KC191900_SHBs_P-C      MESTTSGFLGPLLVLQAGFXLLXRIXTIPQSLDSWWTSLNFLGGAPTCPG
KC191901_SHBs_P-C      MESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGAPTCPG
KC191905_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGAPTCPG
KC191909_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191910_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191911_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191912_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLXTRILTIPQSLDSWWTSLNFLGXAPACPG
KC191914_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGAPTCPG
KC191915_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFXGGAPXCPG
KC191916_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191918_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191919_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191923_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191924_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGTPACPG
KC191926_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191933_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191934_SHBs_P-C      MESXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191938_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191941_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191946_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191947_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLBSWWTSLNFLGGAPTCPG
KC191949_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRIITIPQSLDSWWTSLNFLGGAPTCPG
KC191951_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191973_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC191974_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPTCPG
KC191976_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191977_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC191978_SHBs_P-C      MENTTSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGXAPACPG
KC191979_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191980_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191981_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191983_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191984_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191987_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRIXTIPQSLDSWWTSLNFLGGAPTCPG
KC191988_SHBs_P-C      MENTTSGFLGPQLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191989_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
KC191990_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPXCPG
KC191992_SHBs_P-C      MENTTSGFLXPLLXLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191997_SHBs_P-C      MENTTSGFXGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPXCPG
KC191998_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191999_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192000_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192001_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192002_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXXPACPG
KC192004_SHBs_P-C      MEXTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192005_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192006_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192008_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLXSWWTSLNFLGGAPTCPG
KC192010_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192012_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192014_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192016_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192017_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192020_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAXXCPG
KC192021_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KC192022_SHBs_P-C      MESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192023_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192024_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCTG
KC192025_SHBs_P-C      MENTTSGFLGPLLAXQAGFFLLTXILTIPQSLDSWLTSLSFLGGAPACPG
KC192035_SHBs_P-C      MENTASGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192037_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
KC192038_SHBs_P-C      MENTTSGFLGPLLVLQAGFXLLTXILTIPQSLDXWWTSLNFLGGAPACPG
KC192039_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192040_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWXTSLNFLGGVPTCPG
KC315399_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774180_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774182_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC774185_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774189_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KC774191_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774192_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774203_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774204_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774205_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KC774207_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774208_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774211_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774213_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774217_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC774219_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
KC774225_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774232_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774242_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774245_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774253_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774254_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774265_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774268_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
KC774269_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
KC774271_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774278_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774281_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774288_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774289_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774290_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774296_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQRLDSWWTSLNFLGGAPTCPG
KC774301_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGAPKCPG
KC774302_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774303_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774304_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774306_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPACPG
KC774311_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774313_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774319_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774325_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774334_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774335_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774340_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774343_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774348_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774353_SHBs_P-C      MENTASGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC774354_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774356_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774358_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPKCPG
KC792656_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KC792658_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792669_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792672_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792691_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KC792700_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCLG
KC792706_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792707_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792710_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
KC792716_SHBs_P-C      MENTTLGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KC792740_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KC792746_SHBs_P-C      MENTTSGXLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPKCPG
KC792757_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792759_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFXGVTPACPG
KC792762_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792771_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792775_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEAPTCPG
KC792793_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KC792799_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792806_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTMPQRLDSWWTSLNFLGGAPKCPG
KC792817_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KC792818_SHBs_P-C      MENTTSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGPPECPG
KC792826_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPKCPG
KC792831_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792833_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGETPKCPG
KC792834_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792853_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTRILTIPQRLDSWWTSLNFLGEAPTCPG
KC792857_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEVTTCPG
KC792862_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGAPTCPG
KC792868_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLIRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792873_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGAPXCPG
KC792876_SHBs_P-C      METTTSGFLGPXXVLQXGXFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
KC792880_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPKCPG
KC792902_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLSFLGGAPTCPG
KC792911_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIXQSLDSWWTSLNFLGGAPTCPG
KC792926_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792927_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792979_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792989_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC792995_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPACPG
KC793003_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793019_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793024_SHBs_P-C      MENTTSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGAPTCPG
KC793037_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793040_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KC793046_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KC793050_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC793074_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
KC793097_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793100_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGDAPACPG
KC793103_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILXIPQSLDSWWTSLNFLGGXPXCPG
KC793107_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGTPTCPG
KC793108_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
KC793110_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793119_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793123_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793129_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEAPACPG
KC793142_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793195_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGDAPRCPG
KC793202_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836780_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836782_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
KC836792_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
KC836799_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836806_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836811_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836812_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836815_SHBs_P-C      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836821_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836823_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC875261_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGAPTCPG
KC875262_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPR
KC875263_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPTCPG
KC875264_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC875267_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC875269_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC875270_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC875272_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC875273_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053161_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
KF053164_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
KF053168_SHBs_P-C      MESTTSGFLRPLLGLQEGFFSLTRILTIPQSLGSWWTSLNFLGGAPKCPG
KF053170_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053173_SHBs_P-C      MESITSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPG
KF053175_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053177_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053181_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053183_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPPCPG
KF053184_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDLWWTSLNFLGGAPTCPG
KF214652_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KF214655_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KF214667_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KF214668_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF214670_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KF214671_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
KF214673_SHBs_P-C      MENTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPVSPG
KF214675_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF414646_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
KF485390_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF495606_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
KF771925_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF771934_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF771935_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF771949_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF779242_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF779300_SHBs_P-C      MENMTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF779327_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
KF873514_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACLG
KF873516_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACRG
KF873520_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPACLG
KF873525_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873526_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873528_SHBs_P-C      MENTTSGFLGPLLXLQAGFFLLTRILTIXQSLDSWWTSLNFLGGAXACLG
KF873529_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAXACLG
KF873536_SHBs_P-C      MENTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLSFLGXXPXCXG
KF873539_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873541_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KF873544_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPACLG
KJ011530_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ011535_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ011538_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ011539_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ011541_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ011542_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173285_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KJ173286_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173290_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KJ173291_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173301_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWSSLNFLGGAPTCPG
KJ173305_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173306_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173309_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KJ173315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173319_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173321_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KJ173323_SHBs_P-C      MESTTSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173335_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173338_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173441_SHBs_P-C      MENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410489_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410491_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEAPRCPG
KJ410492_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEAPRCPG
KJ410493_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
KJ410494_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEAPRCPG
KJ410495_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAHTCPG
KJ410496_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410499_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGEAPRCPG
KJ410510_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410511_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCRG
KJ410514_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410515_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPKCLG
KJ410518_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410521_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KJ460503_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPG
KJ460504_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460505_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460515_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460519_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460520_SHBs_P-C      MENTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460523_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460524_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460528_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460529_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460531_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460536_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLDFLGGAPTCPG
KJ460650_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460651_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460653_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
KJ460655_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNYLGGTPMCPG
KJ460656_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460660_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
KJ460661_SHBs_P-C      MENPTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460665_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460667_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNYLGGTPMCPG
KJ460669_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVAPMCPG
KJ598641_SHBs_P-C      MENTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598644_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598646_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598652_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598659_SHBs_P-C      MENTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598662_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598663_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
KJ598670_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598678_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
KJ598679_SHBs_P-C      MENTTSGFLEPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598681_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598687_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598693_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KJ598703_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598705_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598707_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598710_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPTCPG
KJ598712_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598714_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598715_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598716_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598720_SHBs_P-C      MENTTSGFLQPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598721_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KJ598722_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KJ598724_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KJ598730_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KJ598733_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KJ598734_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KJ598740_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598741_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598743_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598746_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598752_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598762_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598768_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KJ598777_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KJ717791_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPKCPG
KJ717799_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPACPG
KJ717802_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717804_SHBs_P-C      MESTTSGFLGPLLVLQEGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPG
KJ717809_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717821_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717822_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
KJ717825_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPKCPG
KJ717826_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KJ717833_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717839_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KJ717844_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455590_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455591_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KM455594_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTIILTIPHSLNSWWTSLNFLGGAPTCPG
KM455595_SHBs_P-C      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGTPVCLG
KM455596_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455597_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455599_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
KM455610_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KM455614_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
KM455616_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM455617_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455618_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455625_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLTFLGGAPTCPG
KM455626_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KM455628_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455631_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455632_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455636_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455637_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KM455643_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455646_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455655_SHBs_P-C      MESTTSGFLGPLLVLQVGFFLLTRILTVPQSLDSWWTSLNFLGGAPTCPG
KM455656_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455657_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455658_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455659_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455661_SHBs_P-C      MDSTTSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455662_SHBs_P-C      MESTTSGFLGPLLLLQAGFFLLTKILTIPRTLHSWWTSLNFLGGAPTCPG
KM455663_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455664_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KM455665_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGEAPTCPG
KM455667_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455668_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455669_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCHG
KM455670_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455672_SHBs_P-C      MENISSGLLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGAPTCPG
KM455675_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455676_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455677_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455679_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGAPTCPG
KM455680_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455682_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPTCPG
KM455686_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPKCPG
KM455687_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KM455688_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455689_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455690_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455692_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSCWTSFNFLGGAPTCPG
KM455693_SHBs_P-C      MESTTSGFLGPLLGLQEGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455696_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPKCPG
KM455701_SHBs_P-C      MESTTSGFLGPLLVLQAGYFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KM455713_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455714_SHBs_P-C      MESTTSRFLGPLLMLQAGFFLLTRILTIPQSLDSWWTSLTSLGGAPTCPG
KM455728_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455729_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KM455740_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTFFNFLGGAPTCPD
KM455746_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455757_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KM455758_SHBs_P-C      MESTTSGFLGPLRVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455759_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455764_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455767_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455773_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455782_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPACPG
KM455783_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455785_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455787_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455792_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRFLTIPQSLDSWRTSLNFIGGAPTCPG
KM455795_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455796_SHBs_P-C      MENTISGFLGPLLALQTSFFLLTRILTIPQSLDSWWTSLNSLGGAPPCPG
KM455802_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455812_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455813_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KM455823_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455826_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455827_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KM455829_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455832_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KM455835_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455841_SHBs_P-C      MESTTSGFLGPPPVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455843_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455845_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
KM455847_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
KM455854_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLYSWWTSLSFLGGALACPG
KM455857_SHBs_P-C      MESTTSGFLGPLLVLQEGFFSLTIILTIPQSLDSWWTSLNFLWGAPTCPG
KM455859_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455861_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455862_SHBs_P-C      MESTTSGFLGPLLVLQAGVFLLTRILTIPQSLDSWWTSLNFLGGAPTCPD
KM455863_SHBs_P-C      MENIASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGRAPTCPG
KM455864_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455865_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM590916_SHBs_P-C      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM875406_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM875411_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGALTCPG
KM875412_SHBs_P-C      MENTASGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLNFLGGALKCPG
KM875423_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM875424_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM875429_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KP148315_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148465_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148466_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPG
KP148473_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148474_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148475_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148476_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148481_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148489_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148492_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148512_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILAIPQSLDSWWTPLNFLGGAPTCPG
KP148521_SHBs_P-C      MESTTSGFLGPLLVLQARFFLLTRILTIPQSLDSWWTSLNSLGGAPTCPG
KP148525_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148526_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148534_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148535_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148545_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148551_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148559_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148561_SHBs_P-C      MESTTSGFLGPLLVLRAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148563_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148566_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148567_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP997554_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP997644_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCLG
KP997646_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013762_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTISQSLDSWWTSLNFLGGAPTCPG
KR013764_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSRWTSLNFLGGAPTCPG
KR013766_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KR013767_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KR013769_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKIPTIPQSLDSWWTSLNFLGGAPTCPG
KR013770_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSQDSWWTSLNFLGGAPACPG
KR013771_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGAPTCPG
KR013772_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013773_SHBs_P-C      TENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013777_SHBs_P-C      TESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KR013778_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013779_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013780_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013781_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013782_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013786_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013791_SHBs_P-C      MENTISGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KR013793_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013795_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGAPTCPG
KR013796_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPG
KR013799_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013800_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013801_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013802_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013804_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLDFLGGAPTCPG
KR013805_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013808_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013809_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013811_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013812_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013813_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGAPTCPG
KR013814_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013815_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013817_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013820_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013822_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013823_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013824_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013825_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLDFLGGAPTCPG
KR013826_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013827_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013829_SHBs_P-C      MENTTSGFLGPLLVLQARFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013831_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013832_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013833_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013835_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013836_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013837_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013838_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013839_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013840_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013841_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013842_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013844_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013845_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPG
KR013846_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPS
KR013848_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013849_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013853_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLSIRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013854_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013855_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013856_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013858_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013859_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWRTSLNFLGGAPTCPG
KR013860_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013861_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013862_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013864_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013866_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLNSLGGAPTCPG
KR013868_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013869_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013871_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013872_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013874_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSFNFLGGAPTCPG
KR013875_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFPGGAPTCPG
KR013876_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013878_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013882_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013890_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KR013900_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KR013902_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
KR013903_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013905_SHBs_P-C      MESTTSEFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KR013909_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGAPTCPG
KR013927_SHBs_P-C      MESTTSGFLKPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013943_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013974_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013975_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013984_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013993_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013998_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014000_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014002_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014005_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014006_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014007_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014008_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014010_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014011_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014015_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014017_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWRTSLNFLGGAPTCPG
KR014021_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014048_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014059_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014078_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTISQSLDSWWTSLNFLGGAPTCPG
KR014082_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014092_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014137_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPACPG
KR028432_SHBs_P-C      MENTASKFLGPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPKCPG
KR819180_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCRG
KT201169_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT235585_SHBs_P-C      MESTTSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT235592_SHBs_P-C      MESTISGFLGPLLVLKAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KT284757_SHBs_P-C      MENTTSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KT284758_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT284759_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT307718_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT364751_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT366464_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT366624_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT585753_SHBs_P-C      MESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KT585756_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPKCPG
KT585761_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KT585764_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KT585765_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KT585767_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KT585769_SHBs_P-C      MESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KT585771_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCSG
KT585772_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KT585773_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTPLNFLGGAPKCPG
KT585776_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KT585777_SHBs_P-C      MENTTSGYLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KT585778_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLVSWRTSLNFLGGAPACPG
KT585782_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KT585784_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KT987423_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU051424_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU051426_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU605613_SHBs_P-C      MENTASKFLGPLLGLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPKCPG
KU605615_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPKCPG
KU679936_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACXG
KU679937_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLXFLGGAPACLG
KU679947_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679949_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAXAXLG
KU679951_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGAPACRG
KU679957_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU679960_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPACXG
KU746290_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746291_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746292_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746293_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746297_SHBs_P-C      MESTTSRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746299_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGAPACPG
KU746303_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746304_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746306_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746307_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746314_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746320_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746322_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU746327_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751676_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751677_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751679_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751680_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751681_SHBs_P-C      MENTASGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751688_SHBs_P-C      MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751690_SHBs_P-C      MENTTSGFLGPLRGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751692_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751693_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751698_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEVPACPG
KU751701_SHBs_P-C      MESTTSGFQGPLLVLQAGFFSLTRILTIPQSLGSWWTSLNFLGGAPACPG
KU751702_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
KU751704_SHBs_P-C      MESTTSGFQGPLLVLQAGFFSLTRILTIPQSLGSWWTSLNFLGGAPACPG
KU751706_SHBs_P-C      MENTTSGFQGPLLVLQAGFFSLTRILTIPQSLGSWWTSLNFLGGAPACPG
KU751709_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KU751711_SHBs_P-C      MESTTSGFQGPLLVLQAGFFSLTRILTIPQSLGSWWTSLNFLGGAPACPG
KU751712_SHBs_P-C      MENTTSGFQGPLLVLQAGFFSLTRILTIPQSLGSWWTSLNLLGEVPACPG
KU751717_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
KU751718_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
KU751719_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEVPACPG
KU751724_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEVPACPG
KU751726_SHBs_P-C      MENTASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751727_SHBs_P-C      MESTASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751729_SHBs_P-C      MESTASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751730_SHBs_P-C      MENTASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751731_SHBs_P-C      MENTASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751733_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751735_SHBs_P-C      MESTASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751740_SHBs_P-C      MENTASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLRRAPACPG
KU751741_SHBs_P-C      MESTASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751742_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751744_SHBs_P-C      MENTASGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751748_SHBs_P-C      MENTASGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751749_SHBs_P-C      MESTASGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751750_SHBs_P-C      MENTASGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751754_SHBs_P-C      MENTASGFLGPLLVLQAGFFSLTRILTIPQNLDSWWTSLNFLGGAPACPG
KU751756_SHBs_P-C      MESTASGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751758_SHBs_P-C      MESTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751759_SHBs_P-C      MESTASGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751761_SHBs_P-C      MESTASGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751762_SHBs_P-C      MENTASGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751765_SHBs_P-C      MESTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU751766_SHBs_P-C      MESTASGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU963904_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963915_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963920_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964002_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964004_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLEGAPACPG
KU964011_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964012_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964013_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964014_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964018_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLWGAPTCPG
KU964032_SHBs_P-C      MENTTSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964039_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964064_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964169_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPTCPG
KU964170_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964171_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964174_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964177_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964179_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KU964201_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
KU964214_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964220_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964329_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACLG
KU964341_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KU964349_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964358_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964363_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964364_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067077_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067080_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067083_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067089_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067098_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067107_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067108_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067109_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067115_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067122_SHBs_P-C      MENTASGFLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067124_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067130_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
KX067131_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067138_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067144_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067150_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067153_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
KX067155_SHBs_P-C      MENTASGFLKPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067156_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067164_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067168_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
KX067202_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067206_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067209_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCTG
KX067212_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
KX067214_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067216_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067221_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX067222_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067246_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067247_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPACPG
KX067249_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067262_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067273_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067278_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067280_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067282_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX067290_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067291_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067292_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067293_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067304_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067305_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067306_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067310_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KX067324_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067325_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067326_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX067351_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KX067370_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX067373_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067374_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067377_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067378_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067385_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067387_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067405_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067407_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067412_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067421_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067423_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067424_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067434_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067439_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067444_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067445_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067446_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067457_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067466_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067469_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067483_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067487_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX067488_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067492_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067494_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX067495_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067502_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
KX067510_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX067511_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX067519_SHBs_P-C      MENTTSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067520_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067528_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
KX067530_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCLG
KX067531_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067540_SHBs_P-C      MENTTSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067543_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067546_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067553_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067558_SHBs_P-C      MENTASGFLKPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067560_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067592_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067605_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPKCPG
KX067607_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067628_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067629_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067630_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPTCPG
KX067631_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX067632_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067634_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRTLTIPQSLDSWWTSLNFLGGAPTCPG
KX067641_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067643_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067645_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067648_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067650_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067653_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067665_SHBs_P-C      MENTTSGFQGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067680_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067681_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067685_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067690_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067691_SHBs_P-C      MENTTSGFLGPLLELQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067693_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX067697_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
KX067698_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067703_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
KX067708_SHBs_P-C      MESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067711_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067712_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067716_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067719_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067723_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067729_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067731_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067732_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPKCPG
KX067734_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067738_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067741_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
KX067746_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067751_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067755_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067764_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067767_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067769_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067777_SHBs_P-C      MENTTSGLLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264792_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
KX264793_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264796_SHBs_P-C      MESTPSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264797_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX264798_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX264799_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPG
KX264800_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX264802_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
KX264803_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264804_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264805_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264806_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264807_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX264810_SHBs_P-C      MESTTSGFLRPLLGLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX264811_SHBs_P-C      MESTPSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264817_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264818_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KX264819_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPG
KX264820_SHBs_P-C      MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KX264821_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
KX264822_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX264823_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264824_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264825_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPACPG
KX264827_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264829_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX264830_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX264831_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX264833_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX264835_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264837_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264838_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264839_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264840_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGEAPACPG
KX264841_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX264846_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGAPTCPG
KX264847_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSGWTSLNFLGGAPTCPG
KX264850_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264851_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264852_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264856_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264859_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX264860_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX264861_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264864_SHBs_P-C      MESTTSGFLRPLPVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264865_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264868_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPTCPG
KX264869_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX264872_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264874_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264875_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264881_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264882_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264883_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGTPTCPG
KX264884_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
KX264885_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264886_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264888_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264889_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
KX264890_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNSLGGAPACPG
KX264892_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264894_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264897_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264899_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
KX264900_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264902_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLNFLGGAPACPG
KX264903_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX264904_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264907_SHBs_P-C      MENTTSGFLGPLLVLQGGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264909_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264910_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
KX264917_SHBs_P-C      MENTTFGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264919_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KX264920_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KX264921_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWLTSLNFLGGAPTCPG
KX264922_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276831_SHBs_P-C      TENTTSGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276833_SHBs_P-C      MENTXSGFLEPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276837_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTXILIIPQSLDSWWTSLNFLGGVPTCPG
KX276838_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KX276839_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KX276840_SHBs_P-C      MESXTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276841_SHBs_P-C      MESTTSGFLGPLLAFQAGFFXLTRILTIPKSLDSWWTSLSFLGGAPTCPG
KX276844_SHBs_P-C      MESTASGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276846_SHBs_P-C      MESTTSGXLGPLLVLQAGFFLLTKXLTIPQSLDSWWTSLSFLGEAPQCRG
KX276847_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276848_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX276849_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276852_SHBs_P-C      MESTTSGFLGPLLVLQAXFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276853_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276854_SHBs_P-C      MESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPXCPG
KX276855_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIXQRLDSWWTSLNFLGGAPGCPG
KX276963_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTISQSLDSWWTSLNFLGEAPKCLG
KX276964_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276977_SHBs_P-C      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276982_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KX276983_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276985_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX276989_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276992_SHBs_P-C      MESTQLGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPKCPG
KX276993_SHBs_P-C      MESTTLGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX372117_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPG
KX372118_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX372119_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX372120_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX372121_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX372123_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KX372124_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGXAPXCPG
KX372126_SHBs_P-C      MESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX372128_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
KX621062_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621065_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621067_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621072_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621078_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621080_SHBs_P-C      MESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621082_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621085_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX621087_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621090_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
KX621092_SHBs_P-C      MENTTSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621100_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPACPG
KX621102_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621103_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621104_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765821_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765822_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765828_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765832_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765834_SHBs_P-C      MESTTSGFLGPLLVLQEGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765843_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765849_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765855_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX774504_SHBs_P-C      MESTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX774506_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX774510_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777257_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777259_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777262_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777263_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777265_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777266_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777267_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777268_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777269_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777275_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777279_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777282_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777283_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777285_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777286_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777287_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777290_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777291_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777295_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777296_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777297_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777298_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777300_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777308_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777309_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777311_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777312_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777313_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777317_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777320_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777322_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777324_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777326_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777328_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777330_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777335_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777338_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777340_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777342_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777343_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777344_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777346_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777351_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777358_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777360_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777361_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777364_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777366_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777367_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777368_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777370_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777372_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777374_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777375_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777378_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777379_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777381_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777388_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777390_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777394_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777400_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777403_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777404_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777407_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777408_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777409_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777410_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777420_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777425_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777430_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX777437_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777438_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX777439_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777441_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777446_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777450_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
KX777451_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPACPG
KX777453_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777461_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPTCPG
KX777463_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777466_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777469_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777472_SHBs_P-C      MEKTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777474_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777478_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777486_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777487_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777496_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777510_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777514_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777521_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNCLGGAPTCPG
KX777523_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777528_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777532_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPA
KX777535_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777537_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777538_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273205_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY273208_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
KY273212_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
KY273213_SHBs_P-C      MENTTSGFLGPLLVLQARFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273215_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KY273218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPTCPG
KY273220_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273222_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KY273223_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY273224_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGTPTCPG
KY273227_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY273228_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273230_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273231_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273235_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302876_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302881_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302885_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302886_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302891_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLNFLGGAPTCPG
KY302893_SHBs_P-C      MENTTSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKYPG
KY302895_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302896_SHBs_P-C      MESTASGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302899_SHBs_P-C      MESTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTPLNFLGGAPTCPG
KY302901_SHBs_P-C      MENTTSGFLGPLLVLPAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302911_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302920_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302922_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302927_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302953_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302972_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KY302973_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302974_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302977_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302980_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302981_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302982_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302983_SHBs_P-C      MENIASGLLGPLLVLQAGFFLLTKILTIPQSLDSWWASLNFLGGTPVCLG
KY302984_SHBs_P-C      MESTTSGFLGPPLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303000_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY303010_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KY303017_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303020_SHBs_P-C      IENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303021_SHBs_P-C      MENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303022_SHBs_P-C      IENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303023_SHBs_P-C      MENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303024_SHBs_P-C      MENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303025_SHBs_P-C      MENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303026_SHBs_P-C      MENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303040_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303044_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303045_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPTCPG
KY303047_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILKIPRSLDSWWTSLNFLGGAPTCPG
KY303048_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILKIPRSLDSWWTSLNFLGGAPTCPG
KY303049_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRIPKIPRSLDSWWTSLNFLGGAPTCPG
KY303053_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILKIPRSLDSWWTSLNFLGGAPKCPG
KY303055_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303056_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILKIPRSLDSWWTSLNFLGGAPTCPG
KY303064_SHBs_P-C      MENTTSEFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303087_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303089_SHBs_P-C      IENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303090_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303091_SHBs_P-C      -ENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303105_SHBs_P-C      MESTASGFLGHLLVLQAGFFLLTRILTVPQSLDSWWTSLNFLGGAPTCPG
KY303107_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303110_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303111_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303112_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303115_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KY303116_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KY303120_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303123_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303128_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
KY303132_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303133_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303134_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303136_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303138_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303142_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303145_SHBs_P-C      MESTTSGFLGPLLVLQAGLFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303146_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303151_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303156_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303157_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303161_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303165_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGASTCPG
KY303176_SHBs_P-C      MENTTSGFLGPLLVLQAEFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303177_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303182_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303184_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLNFLGGAPTCPG
KY303185_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303186_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303190_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303192_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303195_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303203_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KY303295_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGAPTCPG
KY303296_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQGLDSWWTSLDFLGGAPTCPG
KY303298_SHBs_P-C      MESTTSGFLGPLLVLLAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303299_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY303316_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY303317_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY303323_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY303324_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSPNFLGGAPTCPG
KY303325_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303334_SHBs_P-C      MESATSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303335_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303336_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303339_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303340_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303374_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303380_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGAPTCPG
KY303382_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303391_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303393_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303469_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KY303471_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
KY303474_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303494_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303495_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFVGGAPTCPG
KY303501_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCRG
KY303511_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY303513_SHBs_P-C      MENTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303516_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KY303520_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303533_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KY303539_SHBs_P-C      MENTTSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303541_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY303543_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303556_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303574_SHBs_P-C      MENTTSGFLGPMLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303583_SHBs_P-C      MESTTSGFLGPLHVLQAGFFLLTRILTIPQSLDSWWTSLNFREGAPTCPG
KY303584_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY303585_SHBs_P-C      MENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303586_SHBs_P-C      MENTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY303588_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303589_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPTCPG
KY303590_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KY303591_SHBs_P-C      MENTTSGLLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KY303592_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQNLDLWWTSLNFLGEAPKCPG
KY303594_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
KY303607_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPTCPG
KY316929_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY316945_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KY316955_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY353870_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY353884_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KY353885_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY353887_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTMPQSLDSWWTSLNFLGGAPACPG
KY353888_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360378_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360380_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360382_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360383_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360390_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360392_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360395_SHBs_P-C      MENTTSGSLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360397_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360399_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360400_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360401_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KY360403_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360404_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360408_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360409_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360410_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360412_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360413_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360416_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360417_SHBs_P-C      MEDTASGFLGPLLVLQVGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360419_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGRAPTCPG
KY360420_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360424_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360425_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360426_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPD
KY360427_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360428_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360429_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360430_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360552_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360554_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360556_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360560_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360563_SHBs_P-C      MENTTPGFLGPLLVLQAGFFLLTRILTIPQSLDTWWTSLNFLGGAPTCPG
KY360564_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360565_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360566_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360567_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLNFLGEAPTCPG
KY360570_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360572_SHBs_P-C      MENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360573_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360575_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360576_SHBs_P-C      MENTASGFLGPLLVLQAGFSLSTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360580_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360583_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360584_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360586_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360587_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360590_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360591_SHBs_P-C      MENTTSGFLGPLLVLQAGFFMLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360612_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360613_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360615_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360617_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSPDSWWTSLNFLGGAPTCPG
KY360625_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360626_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360627_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360629_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPTCPG
KY360761_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360765_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360769_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360770_SHBs_P-C      MENTTSGFLGPLLVLQAWFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360778_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360780_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360782_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360787_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360789_SHBs_P-C      MENIASGLLGPLLALQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KY360790_SHBs_P-C      MENTTSGFLGPLLVLQARFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360793_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360796_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360797_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360799_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360800_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
KY360801_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360802_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KY360807_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY360808_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPMCPG
KY360809_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY360812_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY360815_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360819_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGAPTCPG
KY360820_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360821_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360824_SHBs_P-C      MESTTSGFLGPLLMLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KY360826_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360834_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360835_SHBs_P-C      MESTTSGYLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360836_SHBs_P-C      MESTTSRFLGPLPVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGAPTCPG
KY360839_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360845_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360851_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360869_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGVPTCPG
KY360870_SHBs_P-C      MESATSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLNFLGGAPTCPG
KY360871_SHBs_P-C      VESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360872_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360874_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360893_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360961_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360963_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
KY360967_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360978_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLNSWWTSLNFLGGVPTCPG
KY360980_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360981_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KY360983_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360984_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360995_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360997_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360998_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360999_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361001_SHBs_P-C      TENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361013_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361014_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361016_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361056_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361057_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361058_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361082_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361084_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361243_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KY361245_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361246_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361247_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361248_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361249_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361250_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361251_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361264_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KY361266_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361267_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KY361268_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KY361269_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KY361270_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
KY361271_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361273_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361288_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361289_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361306_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY361307_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY361309_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFIGGAPMCPG
KY361332_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361335_SHBs_P-C      MKNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361347_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361350_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361369_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361371_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361372_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361384_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
KY361387_SHBs_P-C      MESTTSGFLGSLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361391_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361392_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361405_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361408_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPTCPG
KY361411_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361428_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361430_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361431_SHBs_P-C      TESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361440_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361442_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361443_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361445_SHBs_P-C      MESTASGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361479_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRNLTIPQSLDSWWTSLNFLGGAPTCPG
KY361480_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361481_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361555_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361557_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KY361558_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361560_SHBs_P-C      MENATSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPKCPG
KY361633_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361635_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361649_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361661_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361662_SHBs_P-C      MENTTPGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPD
KY361664_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361665_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361666_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLNLWWTSLNFLGGAPTCPG
KY361667_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361669_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361693_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361718_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361719_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361720_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTGILTIPQSLDSWWTSLNFLGGAPTCPG
KY361721_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361723_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGGAPTCPG
KY361724_SHBs_P-C      MENTASGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361727_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363252_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
KY363253_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
KY363254_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363256_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KY363257_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363258_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPACPG
KY363260_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363264_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363268_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363274_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
KY363275_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363276_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KY363278_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363281_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGAPTCPG
KY363282_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363286_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPG
KY363287_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPG
KY460002_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460003_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460005_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460006_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460027_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460029_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLNFLGGAPTCPG
KY460038_SHBs_P-C      MENTTSGFLGPLLVLRAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460039_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460043_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460054_SHBs_P-C      MDNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460057_SHBs_P-C      MDNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460058_SHBs_P-C      MDNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460059_SHBs_P-C      MDNTTSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLNFLGGAPTCPG
KY460076_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460081_SHBs_P-C      MENTTSGFLGPLLGLQVGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460083_SHBs_P-C      MENTTSGFLGPMLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460110_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPTCPG
KY460111_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460112_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470873_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470875_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470879_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470880_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470882_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470883_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470889_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470891_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470892_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470894_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470895_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470904_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLARILTIPQSLDSWWTSLNFLGGAPTCPG
KY470905_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGASTCPG
KY470906_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470907_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470908_SHBs_P-C      MENTTSGFLRPLLVLQAGFSSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KY470909_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470910_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
KY470911_SHBs_P-C      MENTTSGFLRPLLVLQAGFSLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KY470912_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470913_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470914_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470916_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470920_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470925_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470927_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470929_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KY470930_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDPWWTSLNFLGGAPACPG
KY470965_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470966_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470967_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470968_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470971_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470973_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470976_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470977_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470980_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470987_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDPWWTSLNFLGGAPTCPG
KY629637_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY660194_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY660202_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY697831_SHBs_P-C      MESTTSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY697851_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KY881802_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSPDSWWTSLNFLGGAPTCPG
KY881809_SHBs_P-C      MENTASGFLGPLLVLQEGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881810_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRVLTIPQSLDSWWTSLNFLGEAPTCPG
KY881811_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPG
KY881812_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTPLNFLGGAPTCPG
KY881814_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881815_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
KY881817_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881870_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSPDSWWTSLNFLGGAPTCPG
KY881871_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881872_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881874_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881875_SHBs_P-C      TENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881876_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881877_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881880_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881881_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881882_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881883_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881885_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881887_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881888_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRVLTIPQSLDSWWTSLNFLGGAPTCPG
KY881890_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881891_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881892_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881915_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881916_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881917_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881925_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881940_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881959_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRIPTIPQSLDSWWTSLNFLGGAPTCPG
KY881961_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881962_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881964_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881965_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881968_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881970_SHBs_P-C      VESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881972_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881973_SHBs_P-C      MENTTSGFLGPLLTLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881974_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881975_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPG
KY881976_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881978_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881979_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881980_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881981_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881983_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881984_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881989_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881991_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881992_SHBs_P-C      MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881994_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881998_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY882003_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC064754_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279250_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279252_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGEAPTCPG
LC279253_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGEAPTCPG
LC279255_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
LC279256_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
LC279274_SHBs_P-C      MENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279275_SHBs_P-C      MENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279276_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC318702_SHBs_P-C      MENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC318703_SHBs_P-C      MENTISGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456110_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456111_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456114_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456115_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456118_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456119_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456121_SHBs_P-C      MESTASGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456124_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456126_SHBs_P-C      MESTASGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPXCPG
LC456129_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456131_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456133_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPACPG
LC516606_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC516609_SHBs_P-C      MENTTSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
LC516610_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC519790_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
LC519796_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
LC519799_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC519805_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC519807_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC519813_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
LC519821_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
LC519822_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPG
M17550_SHBs_P-C        MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
M17687_SHBs_P-C        MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
M17688_SHBs_P-C        MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
M23805_SHBs_P-C        MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
M23806_SHBs_P-C        MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGAPTCPG
M23807_SHBs_P-C        MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFQGGAPTCSG
M23809_SHBs_P-C        MENTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGAPTCPG
M27765_SHBs_P-C        MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
M27766_SHBs_P-C        MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPTCPG
M54892_SHBs_P-C        MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
MF488701_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674390_SHBs_P-C      LHSTTSGFLDPQLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674408_SHBs_P-C      MESTTSGFLGPLLXLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674417_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGAPTCPG
MF674425_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674430_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
MF674444_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQRLDSWWASLNFLGGAPTCPG
MF674463_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MF674467_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674471_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674489_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MF674494_SHBs_P-C      MESTTSEFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674504_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674514_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF682469_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MF682473_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF682476_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
MF682477_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
MF682478_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
MF682479_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF682480_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF682481_SHBs_P-C      MENTTSGFLGPLLVLQVGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF682482_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MF682483_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWASLNFLGGAPACPG
MF682484_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MF682485_SHBs_P-C      IESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MF682488_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MF682489_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPKCPG
MF925365_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925376_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925394_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925395_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925403_SHBs_P-C      MESTTSGFLRHLPVLRAGFFWLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MF925409_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLNFLGGAPTCPG
MG014697_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG383625_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPXSLDSWWTSLNFLGGAPTCPG
MG571332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
MG571335_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG571345_SHBs_P-C      MESATSGFLGPLLVLQAGFFLLTRILKIPQNLDSWWTSLNFLGGAPTCPG
MG571359_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPKCPG
MG714929_SHBs_P-C      MXNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714937_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714938_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714940_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714944_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MG714951_SHBs_P-C      MENTTSGFPGPLLVLQAGFFLWTRILTIPQSLDSWWTSLNFLGGAPKCPG
MG714963_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714965_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714967_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714968_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGAPTCPG
MG714978_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714983_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714984_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714985_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714987_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714991_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MG714994_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGXPTCPG
MG714996_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPG
MG714998_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715005_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715012_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715022_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
MG715035_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
MG715049_SHBs_P-C      MENTASGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715053_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715055_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715056_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715057_SHBs_P-C      MESTTTGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715066_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGAPTCPG
MG715069_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGXAPTCPG
MG715070_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715074_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPXCPG
MG715081_SHBs_P-C      --NTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715086_SHBs_P-C      MXNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715087_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
MG715088_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
MG715093_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715097_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715099_SHBs_P-C      MESTTSGFLGPLLVXQXGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715101_SHBs_P-C      MENTXSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MG715107_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWLTSLNFLGGAPKCPG
MG715111_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
MG715113_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715115_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715118_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715136_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715138_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715139_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715144_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715147_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715153_SHBs_P-C      ---TTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715158_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSXDXWWTSLNFLGGAPTCPG
MG715159_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPG
MG715165_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715187_SHBs_P-C      MESITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715192_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715197_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MG715200_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
MG715201_SHBs_P-C      MESTTSGFLGPLLVLQAGFXLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715202_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPKCPG
MG715211_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
MG715238_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715249_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715252_SHBs_P-C      MXNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG715253_SHBs_P-C      MENTTSGFLGPLLXLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715258_SHBs_P-C      MESTTSXFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715262_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715263_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
MG715268_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715272_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAHKCPG
MG715277_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
MG715278_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715279_SHBs_P-C      MENTTSGLLGPLLVLQAGFFLLTRILAIPQSLDSWWTSLNFLGGAPTCPG
MG715281_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG715284_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715289_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715293_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG715294_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPTCPG
MG715295_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715306_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715309_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715312_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715315_SHBs_P-C      MENTTSGXLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715319_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715320_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715322_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTTPQSLDSWWTSLNFLGGAPTCPG
MG715323_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715327_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715329_SHBs_P-C      MENTTSGFLGPLLVLQAGFFXLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715330_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715331_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715339_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
MG715344_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715345_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
MG715349_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715351_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG715355_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715357_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
MG715358_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715359_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQXLDSWXTSLSFLGGAPTCPG
MG715360_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715363_SHBs_P-C      MENTTSGFLGPLLVLXXGFFLLTRILTIXQSLDSWXTSLNFLGGAPTCPG
MG715364_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715366_SHBs_P-C      -ENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715369_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
MG715371_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
MG715375_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715376_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCAG
MG715377_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLXFLGGAPXCPG
MG715378_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715379_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPXCPG
MG715381_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNXLGGXPXCLG
MG715384_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715385_SHBs_P-C      MENTTSGFLGPLLXLQAGFFLLTRILTIXQSLDSWWTSLNFLGGAPACPG
MG715386_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCRG
MG715391_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MG715395_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715397_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSSLGGALACPG
MG715398_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
MG715403_SHBs_P-C      MENTASGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715404_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MG715405_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG725248_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG738731_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG738734_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG738737_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG738741_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG738743_SHBs_P-C      --SYISRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG738745_SHBs_P-C      ----TSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826122_SHBs_P-C      MESTASGFLGPLFVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
MG826123_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826126_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
MG826129_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826132_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGPPVCPG
MG826136_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826137_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPGCPG
MG826138_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826139_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPRSLDSWWTSLSFLGGAPVCPG
MG826140_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCPG
MG826143_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826225_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG826226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826227_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGETPKCPG
MG826229_SHBs_P-C      MESTTSGFLRPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826230_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPKCPG
MG826232_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
MG826235_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPPCPG
MG826238_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826240_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
MG826244_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826246_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826250_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826252_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826253_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MG826255_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826256_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826257_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPKCHG
MG826259_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826261_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826262_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG826263_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826264_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MG826266_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826267_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
MG826272_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MG826274_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
MG826276_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG826277_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826278_SHBs_P-C      MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG826279_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MG826283_SHBs_P-C      MESTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826288_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826290_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826291_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG826292_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826300_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826304_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826306_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826309_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MG826310_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826312_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826320_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826321_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826322_SHBs_P-C      METTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826323_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826324_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826329_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGPPKCPG
MG826330_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGALKCLG
MG826331_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG826332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826337_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG826349_SHBs_P-C      MESTTSGFLGPLLALQAGFFLLTKILTIPQSLDSWWTSLNFLGEAPVCPG
MG826352_SHBs_P-C      MENTTSGFLGPLLVYRAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826353_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826354_SHBs_P-C      MESTTSGFLRPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826355_SHBs_P-C      MESTTSGFLRPLLVLQEGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826356_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG837060_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG893553_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG893557_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MH220971_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MH507525_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MH507550_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MH507551_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MH818373_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170848_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
MK170851_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPTCPG
MK170852_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
MK170853_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170856_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLSFLGGTPTCHG
MK170861_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
MK170864_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170865_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170867_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
MK170868_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170870_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
MK170873_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK170874_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
MK170879_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MK170880_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFLGGAPTCPG
MK170882_SHBs_P-C      MDNTTSGFLGPLLVLQAGFFLLTRILTIPESLDSWWTSLNFLGGAPTCPG
MK170886_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170893_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170894_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPTCPG
MK170895_SHBs_P-C      MENTTSGFLGPLLALQAGFFLLTRILTIPQSLDSWWTSLSFLGEAPTCPG
MK170897_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
MK170899_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170900_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170903_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGTPTCPG
MK170904_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDLWWTSLNFLGEAPKCPG
MK170905_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170907_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPACPG
MK170910_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170911_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170916_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170917_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK170918_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170919_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170921_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCHG
MK170923_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK170931_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170936_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCHG
MK170938_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170939_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170941_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
MK170942_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170943_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MK170944_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
MK170945_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGALTCPG
MK170954_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK170955_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170968_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170969_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
MK170970_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170974_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MK170991_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGKPTCPG
MK170993_SHBs_P-C      MENTTSGFLRPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170996_SHBs_P-C      MENTASGFLGPLLVLQEGFFSLTRILTIPQSLDSWWTSLSFLGGAPTCPG
MK171001_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFPGGAPRCPG
MK171003_SHBs_P-C      MENTISGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
MK171006_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MK171008_SHBs_P-C      MENTTSGFLEPPLVLQAGFSLLTKILTIPQSLDSWWTSPNFLGGAPTCPG
MK171011_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171012_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
MK171031_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171035_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171036_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPG
MK171039_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171040_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171042_SHBs_P-C      MENTTSGFLGPLLVLQGGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171044_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171046_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171051_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171052_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MK171054_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171057_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171059_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171060_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MK171061_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171062_SHBs_P-C      MENTTSGFLGPLFVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEVPKCPG
MK171067_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171070_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPKCPG
MK171071_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPG
MK171072_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171074_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171077_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALKCPG
MK171084_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
MK171085_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171086_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171089_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171090_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171091_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171097_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171098_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171102_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
MK171113_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171115_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171118_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171120_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171121_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171130_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171143_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171146_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MK171147_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171148_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171149_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171150_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171151_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171152_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPACPG
MK171153_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILMIPQSLDLWWTSLNFLGGAPACPG
MK171157_SHBs_P-C      MENTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MK171158_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171162_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
MK171170_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPACPG
MK171172_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPTCPG
MK171174_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQNLDSWWTSLNFLGGAPACPG
MK171180_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
MK171182_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171183_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQRLDSWWTSLNFLGGAPACPG
MK171187_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171190_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171193_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTACPG
MK171194_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171196_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MK171198_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
MK171204_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171206_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171208_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPMCPG
MK171212_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171220_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171221_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171222_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171224_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPTCPG
MK171229_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171230_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171234_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
MK171235_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
MK171237_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MK171238_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171240_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MK171241_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFPGEAPRCLG
MK171242_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
MK171243_SHBs_P-C      MENTALRFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171246_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171248_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171249_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGAPTCPG
MK171250_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171254_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK286461_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295778_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295780_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295782_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295793_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295796_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295800_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK321266_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343135_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343136_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343139_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343142_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343144_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343145_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343146_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAXTCPG
MK374373_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK374374_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK534557_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCRG
MK534593_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534596_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534597_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK534650_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
MK534657_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534671_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534677_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK534678_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534720_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCLG
MK580102_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSRNFLGGAPTCPG
MK580103_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK580104_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK580106_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK580107_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK580109_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK580110_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK580111_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPACPG
MK580112_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPACPG
MK580114_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK580115_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK580116_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSPDSWWTSLNFLGGAPTCPG
MK580117_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILAIPRSLDSWWTSLNFLGGAPTCPG
MK580118_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK580119_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
MK948399_SHBs_P-C      MESTTSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN562226_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN562227_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN642606_SHBs_P-C      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCSG
MN642607_SHBs_P-C      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN642608_SHBs_P-C      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN642609_SHBs_P-C      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN642610_SHBs_P-C      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN642611_SHBs_P-C      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN642612_SHBs_P-C      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN642613_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPMCPG
MN642614_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN642615_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN683728_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN758706_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT114171_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MT426251_SHBs_P-C      MESTTSGFLGPLLVLQALFFLLTRILTIPQSLDSWCTSLNFLGGAPTCPG
MT426252_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426253_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426259_SHBs_P-C      MESTTSGFLEPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426263_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426264_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426265_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426268_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426271_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426277_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426278_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426279_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426280_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426283_SHBs_P-C      MESTTSGFLGPLLVLQAAFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
MT426284_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426286_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426287_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426288_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426289_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426292_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPPCPG
MT426293_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426295_SHBs_P-C      MESTTSGFLGPLLVLQAAFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
MT426298_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426299_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426301_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNLLGGAPTCPG
MT426303_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426310_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426314_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426316_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426319_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426320_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLSTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426346_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426368_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426370_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426371_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426383_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILIIPQSLDSWWTSLNFLGGAPTCPG
MT426390_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426395_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426409_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426410_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426411_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426417_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426437_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426445_SHBs_P-C      MESTTSGFLGPLLLLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426448_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426449_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426450_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSRWTSLNFLGGAPTCPG
MT426451_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426458_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWGTSLNFLGGAPTCPG
MT426516_SHBs_P-C      MENTASGFLRPLLVFQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426548_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426577_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426588_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426590_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426593_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426598_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426599_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426610_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426612_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426615_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426649_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426659_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426660_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFIGGAPTCPG
MT426662_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426665_SHBs_P-C      MENTTSGFPGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426668_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLHSWWTSLNFLGGAPTCPG
MT426674_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426676_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCHG
MT426679_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426680_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426695_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
MT426720_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWRTSLNFLGGAPTCPG
MT426728_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426729_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
MT426730_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426731_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426733_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426737_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426739_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426743_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426745_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426752_SHBs_P-C      MENTTSGFLGPLPVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426754_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426766_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
MT426767_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426770_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426776_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426778_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426784_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426787_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426789_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWCTSLNFLGGAPTCPG
MT426804_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426805_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426811_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426820_SHBs_P-C      RENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426837_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426838_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426841_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426842_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426843_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426844_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426845_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426846_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426847_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426848_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426849_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426850_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWSSLNFLGGAPTCPG
MT426853_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426855_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426856_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGALTCPG
MT426858_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATTCPG
MT644995_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT644996_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGSPKCPG
MT644997_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MT644999_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGTPACPG
MT645003_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645004_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCSG
MT645007_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPACPG
MT645008_SHBs_P-C      MENTTSGFLGPLLVLQVGFFLLTRILTIPQSLDSWWTSLNFLGGVPACPG
MT645009_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPACPG
MT645010_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
MT645011_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MT645013_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MT645014_SHBs_P-C      MESTTSGFLGPLLVLQAGYFLLTKILTIPQSLDSWWTSLNFLGEAPKCHG
MT645017_SHBs_P-C      MESTPSGFLGPLLVLQAGYFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
MT645019_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
MT645020_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MT645021_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
MT645022_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645024_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
MT645027_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGETPRCPG
MT645032_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
MT645036_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGTLKCPG
MT645037_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645038_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645040_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645043_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPKCPG
MT645046_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MT645050_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGATTCPG
MT645051_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645052_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645054_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645055_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPACPG
MT645059_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
MW248961_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW248962_SHBs_P-C      MESTTSGFLGLLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MW248963_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MW248965_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MW248967_SHBs_P-C      MGSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW248968_SHBs_P-C      MESTPSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLSFLGEPPACPG
MW248969_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPACPG
MW310259_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
MW675885_SHBs_P-C      MDNTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
MW675887_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
MW675888_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW675896_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
MW755445_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPKCPG
MW887641_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGTPKCPG
MW887642_SHBs_P-C      MESTTSGFLGPLHVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW887643_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPTCPG
MW887646_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGETPKCPG
MW887647_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW887650_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW887651_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
MW887652_SHBs_P-C      MESTSSGLLGPLRVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGKPTCPG
MW999617_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999623_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999629_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439270_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439273_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439274_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439281_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439283_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439288_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439290_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439291_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439296_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439302_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439304_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439305_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439334_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439347_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439356_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439393_SHBs_P-C      MESTTSGLLAPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439394_SHBs_P-C      MESTTSGLLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439410_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MZ439412_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439413_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439414_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MZ439420_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MZ439423_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439433_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439439_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439442_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439443_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439451_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439453_SHBs_P-C      MENTASGFLEPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439455_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPTCPG
MZ439456_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439461_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439465_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439467_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPTCPG
MZ439470_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPTCPG
MZ439471_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439472_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439486_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439487_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWLTSLSFLGGAPTCPG
MZ439491_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPTCPG
MZ439506_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPTCPG
MZ439507_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439516_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLSFLGGAPTCPG
MZ439557_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439561_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439580_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
MZ439582_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439583_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439584_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439587_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439593_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
MZ439598_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
MZ439601_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLSFLGGAPACPG
MZ439603_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLSFLGGAPACPG
MZ439604_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MZ439609_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKIHTIPQSLDSWWTSLNFLGGAPACPG
MZ439610_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKIHTIPQSLDSWWTSLNFLGGAPACPG
MZ439611_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLSFLGGAPACPG
MZ439614_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLSFLGGAPACPG
MZ439618_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MZ439623_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQRLDSWWTSLSFLGGAPACPG
MZ439624_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLSFLGGAPACPG
MZ439625_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439626_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439627_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439630_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439632_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439636_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439643_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPG
MZ439645_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPG
MZ439671_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439682_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPRCPG
MZ439684_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPRCPG
MZ439687_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439710_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439715_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCAG
MZ439723_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439724_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
MZ439725_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439729_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439732_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ671234_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ671240_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
MZ671241_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
MZ671244_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ671246_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ671248_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ675791_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ675793_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MZ934422_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MZ934424_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAHTCPG
MZ934431_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
OM471490_SHBs_P-C      MGNTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OM688318_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
ON093164_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
ON402774_SHBs_P-C      MENTTSGFLGPLLVLQAGFVLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
ON402776_SHBs_P-C      MVSTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
ON402777_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
ON402779_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
ON402780_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
ON402782_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGVPTCPG
ON402783_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
OP153980_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OP653498_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OP653500_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTPACLG
OR296293_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OR296294_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OR296295_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OR833942_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
X52939_SHBs_P-C        MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWLTSLNFLGGTPKCPG
X75665_SHBs_P-C        MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
X75667_SHBs_P-C        MENITSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGAPTCPG
X75792_SHBs_P-C        MENTTSGFLGPLLVLQAGFFWLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB642095_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB900115_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ709489_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792653_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264832_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029978_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222714_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222715_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222722_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222724_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222725_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222728_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222729_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222731_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222733_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222734_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222736_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222737_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB471851_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB471852_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB471853_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB485808_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB640730_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670247_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670266_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670283_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB697500_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809546_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF286594_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738847_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751534_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475311_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475312_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475313_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475315_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475319_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475320_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475323_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475324_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475326_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475337_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475339_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486612_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486684_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ872210_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604131_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604215_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604281_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980255_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341662_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX101332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836795_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836796_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836797_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836798_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836800_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836801_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836802_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836803_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836805_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836807_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836808_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836809_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836810_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964065_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964066_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964067_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964068_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964069_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964070_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964071_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964072_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964073_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964074_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964075_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964077_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964078_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964334_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964336_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964337_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964338_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964339_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964340_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964342_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964343_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964344_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964345_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964346_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964347_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964348_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264843_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264855_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264858_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264873_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264876_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264878_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264879_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264880_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264896_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264913_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264915_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279251_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC360507_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
M17549_SHBs_P-C        MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715216_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426109_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029966_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029967_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029971_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029974_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029976_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029980_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029981_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029982_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029985_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029987_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029988_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029989_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029991_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB030507_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195952_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB198079_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB198080_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB198081_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB198082_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB198083_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222726_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222746_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222749_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222751_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222754_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222756_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222757_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222766_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222771_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB246345_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB298720_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB298721_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB300361_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB471848_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB471849_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB471850_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB642100_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670276_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670311_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB675677_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB776869_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB776871_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809540_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB900116_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF458664_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY247032_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY596108_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ141656_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412231_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412233_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412237_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ993693_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF645266_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871979_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871982_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU872001_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU872003_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU872004_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU882005_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916210_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916215_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916222_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926422_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926429_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926444_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926458_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926463_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926467_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927167_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927207_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927252_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927257_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927259_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927263_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939574_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939580_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939604_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939610_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ032359_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386574_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386577_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386588_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386637_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386639_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386644_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386659_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386667_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386685_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ560989_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ560998_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561003_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561006_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561035_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562232_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562274_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562275_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562282_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562290_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562323_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562327_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562329_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621596_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621819_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621842_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621950_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621951_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622008_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622011_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622012_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622013_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622014_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622019_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622020_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622022_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622026_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622029_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622031_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622032_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622034_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622035_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622038_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622039_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622041_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622043_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622044_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622047_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622049_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622050_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622054_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622055_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622058_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622060_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622061_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622063_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622064_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622075_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622079_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622081_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622087_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622089_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622092_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622103_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622104_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622106_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622109_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622115_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622122_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622123_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622124_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622125_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622126_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622127_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622132_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622140_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622141_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622142_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622144_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622145_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622149_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622150_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622154_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622155_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622156_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622159_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622160_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622161_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622162_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622164_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622166_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622168_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622182_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622194_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622196_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622197_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622200_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622202_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622203_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622204_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622205_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622206_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622208_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622210_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622217_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622225_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622300_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622319_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622777_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622778_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715358_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715378_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715380_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751286_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751297_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751303_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751313_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751341_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751343_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751346_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751355_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751363_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751364_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751375_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751378_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751412_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751436_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751446_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751447_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751456_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751457_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751463_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751465_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751524_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751528_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751533_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751539_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751540_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751545_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751546_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751554_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751565_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751567_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751578_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751602_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FM200211_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ325784_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377515_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377521_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377528_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377572_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377574_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377579_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377591_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377601_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377617_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377621_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377624_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377637_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377640_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475328_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486153_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486466_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486491_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486519_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486648_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924633_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078799_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078814_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078815_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078833_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078836_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078844_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079212_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079220_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079236_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079260_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079261_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079262_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079265_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079274_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079279_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079292_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079296_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079310_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079331_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079337_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079354_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079374_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079423_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU145103_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU434374_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM750132_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM750134_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM750135_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM750140_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HQ622095_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650139_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650141_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650162_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650167_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650180_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980176_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980177_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980184_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980193_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980194_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980208_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980222_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980241_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980289_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980301_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980302_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980312_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980332_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980358_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980361_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040163_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341648_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341658_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416166_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416168_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416175_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416180_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416181_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416184_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416202_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416203_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416204_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416212_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416213_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514301_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514304_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514409_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514512_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514539_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ688404_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ798298_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX026884_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429906_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429909_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429912_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429916_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429917_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429918_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX504544_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX504545_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX560519_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661492_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661495_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191831_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191838_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191850_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191857_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191879_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191906_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191920_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191921_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191927_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191928_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191943_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191953_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191958_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191960_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191962_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191965_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192031_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774179_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774196_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774197_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774229_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774237_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774240_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774241_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774243_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774249_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774261_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774262_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774272_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774276_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774282_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774286_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774292_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774297_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774298_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774312_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774314_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774316_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774318_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774327_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774331_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774333_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774336_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774338_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774345_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774347_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774351_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774352_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774360_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792655_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792679_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792690_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792695_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792708_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792713_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792739_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792776_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792792_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792803_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792921_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792923_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792941_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792961_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792962_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792965_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792999_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793051_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793201_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836789_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836790_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836791_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836793_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836794_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173288_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173294_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173296_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173313_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173314_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173316_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173317_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173327_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173328_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173391_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173392_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173426_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173427_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173428_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173429_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173433_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173434_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173443_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173444_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173446_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460502_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460507_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460512_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460513_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460526_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460527_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460532_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460533_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460534_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460535_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460668_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598680_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598689_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598698_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598702_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ790199_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM229703_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455609_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455718_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455860_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013774_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013776_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013792_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013794_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013807_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013828_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013830_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013873_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963937_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963992_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963996_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963997_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964034_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964035_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964036_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964037_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964038_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964040_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964041_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964043_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964044_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964045_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964046_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964047_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964048_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964049_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964050_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964051_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964052_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964053_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964054_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964055_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964056_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964057_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964058_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964059_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964060_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964061_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964062_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964063_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067078_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067079_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067087_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067093_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067094_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067095_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067097_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067101_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067110_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067113_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067114_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067133_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067134_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067135_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067136_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067141_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067145_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067149_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067152_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067154_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067167_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067170_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067171_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067172_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067173_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067175_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067177_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067178_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067179_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067184_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067186_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067187_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067193_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067195_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067199_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067210_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067215_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067220_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067223_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067225_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067227_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067228_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067231_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067232_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067234_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067239_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067240_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067242_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067250_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067256_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067260_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067263_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067266_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067267_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067275_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067277_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067279_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067285_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067287_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067288_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067298_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067299_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067309_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067311_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067315_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067317_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067318_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067323_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067334_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067335_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067338_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067341_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067345_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067347_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067349_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067350_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067355_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067357_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067359_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067363_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067365_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067366_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067367_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067368_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067369_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067371_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067376_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067383_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067386_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067397_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067400_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067403_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067404_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067408_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067411_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067413_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067416_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067417_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067422_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067425_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067426_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067427_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067430_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067441_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067442_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067453_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067456_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067461_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067470_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067475_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067476_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067481_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067484_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067485_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067486_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067493_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067496_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067499_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067501_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067509_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067514_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067521_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067522_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067526_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067532_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067538_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067544_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067548_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067552_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067556_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067562_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067566_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067573_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067576_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067577_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067583_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067588_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067590_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067596_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067598_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067608_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067614_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067620_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067622_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067623_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067627_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067636_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067640_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067644_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067652_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067657_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067662_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067663_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067669_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067671_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067674_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067677_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067678_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067684_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067688_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067689_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067700_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067705_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067707_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067718_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067720_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067727_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067728_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067730_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067737_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067744_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067758_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067762_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067765_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067768_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067771_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264844_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264862_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264863_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264877_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264911_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276835_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276966_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621063_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621064_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621071_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621084_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621086_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621091_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621094_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621101_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621113_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621115_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621120_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621123_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777413_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777415_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777419_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777421_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777423_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777424_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777426_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777427_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777434_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777435_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777440_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777448_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777449_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777455_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777457_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777462_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777464_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777467_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777468_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777475_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777476_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777484_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777491_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777500_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777502_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777503_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777511_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777515_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777517_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777518_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777520_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777522_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777524_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777530_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777531_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777534_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777536_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777539_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX925297_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273200_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273229_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273232_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273238_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273239_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273242_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302875_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302877_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302878_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302889_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302892_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302902_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302907_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302908_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302915_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302916_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302917_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302918_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302944_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302969_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303037_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303038_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303039_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303041_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303042_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303043_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303046_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303149_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303150_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303152_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303154_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303155_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303160_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303162_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303164_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303167_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303168_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303169_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303178_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303180_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303312_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303327_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303375_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303376_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303378_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303379_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303381_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303390_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303392_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303488_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303509_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303564_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303565_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303569_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303577_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303580_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303596_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303598_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303603_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303608_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303611_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303617_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303619_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303620_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303623_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360372_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360373_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360374_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360375_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360376_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360384_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360385_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360386_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360387_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360388_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360389_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360391_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360553_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360555_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360558_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360559_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360562_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360568_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360569_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360581_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360589_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360758_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360759_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360760_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360762_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360763_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360767_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360798_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360852_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360853_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360855_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360856_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360857_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360858_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360860_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360861_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360862_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360863_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360864_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360876_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360877_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360879_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360880_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360882_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360894_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360900_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360902_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360969_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360970_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361008_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361046_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361080_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361083_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361285_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361286_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361290_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361291_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361292_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361293_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361294_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361295_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361297_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361308_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361310_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361314_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361316_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361317_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361318_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361327_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361328_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361329_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361331_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361333_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361336_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361339_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361341_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361343_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361346_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361351_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361352_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361353_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361355_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361357_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361358_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361360_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361362_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361363_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361586_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361627_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361628_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361629_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361630_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361632_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361634_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361636_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361670_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361671_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361672_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361674_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361675_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361676_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361679_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361685_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361686_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361687_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361689_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361692_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361694_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY363284_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460030_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460032_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460035_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460037_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460040_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460041_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460105_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460107_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460108_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460113_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470926_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470933_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470934_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC090200_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279245_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279246_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279247_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279248_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279249_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279258_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279260_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279261_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC279262_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC730886_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF458550_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714979_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714982_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714999_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715018_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715037_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715043_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715045_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715048_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715054_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715059_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715063_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715082_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715090_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715094_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715105_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715120_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715121_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715133_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715140_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715142_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715145_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715150_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715160_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715161_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715221_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715222_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715248_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715266_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715271_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715282_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715290_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715292_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715300_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715303_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715310_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715313_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715314_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715317_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715348_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715367_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715406_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826125_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826298_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826299_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826301_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826302_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826326_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826328_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG893558_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MH887433_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK127852_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170850_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170859_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170888_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170929_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170932_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170937_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170951_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170958_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170972_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170975_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170984_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170992_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171002_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171022_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171023_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171028_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171032_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171034_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171037_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171063_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171064_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171069_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171088_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171093_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171094_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171106_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171109_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171112_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171116_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171122_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171125_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171134_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171141_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171179_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171202_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171211_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171216_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171251_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343143_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343147_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343148_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343151_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN683726_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN683727_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426106_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426644_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426654_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426655_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426656_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426657_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426658_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426661_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426664_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426666_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426667_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426669_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426670_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426671_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426673_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426675_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426678_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426682_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426684_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426685_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426686_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426687_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426688_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426689_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426690_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426691_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426693_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426694_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426696_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426697_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426698_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426699_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426700_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426701_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426702_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426703_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426704_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426705_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426706_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426707_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426708_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426709_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426710_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426711_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426712_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426713_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426714_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426715_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426716_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426717_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426718_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426719_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426721_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426722_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426723_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426724_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426725_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426726_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426727_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426732_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426735_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426736_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426741_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426742_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426744_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426746_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426748_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426756_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426757_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426758_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426759_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426760_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426761_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426762_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426763_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426764_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426765_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426768_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426769_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426771_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426772_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426773_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426775_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426779_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426780_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426781_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426782_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426783_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426785_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426786_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426788_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426790_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426791_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426792_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426793_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426794_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426795_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426796_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426797_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426799_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426800_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426801_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426802_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426803_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426806_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426807_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426808_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426809_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426810_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426812_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426813_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426814_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426815_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426817_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426818_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426819_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426821_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426822_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426823_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426824_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426825_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426826_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426827_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426828_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426829_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426830_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426831_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426832_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426833_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426834_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426835_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426836_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426839_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426840_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426851_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426854_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426857_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645034_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW675890_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OP153979_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OP153981_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OP153982_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OP653499_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
V00867_SHBs_P-C        MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ975272_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
FJ622244_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
KJ460643_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
MK171199_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
AB026812_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB026813_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB026814_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222776_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB540585_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY738840_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622062_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622070_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622188_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410508_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013810_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067529_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067589_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067609_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067615_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067686_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273209_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303523_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303616_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826284_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475343_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU306722_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561039_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562288_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751315_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191957_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621077_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621106_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777411_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222721_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067321_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195945_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195947_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222718_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222748_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222755_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB300362_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB365439_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670305_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809535_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622844_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622881_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ709483_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751604_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377642_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475305_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475317_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475322_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475329_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475332_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475342_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475346_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604246_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836816_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836817_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP784761_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067169_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067314_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067379_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067380_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067381_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067382_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067742_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264794_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264836_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264871_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264893_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264895_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264916_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361688_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY660200_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715061_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715117_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029972_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029973_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222740_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW675886_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW675891_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW675893_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029984_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB111121_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475344_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475354_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836813_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836814_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264795_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264816_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264898_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264912_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029979_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029983_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB198077_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB198078_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222778_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222779_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222780_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB300359_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB300365_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB776877_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB776893_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809530_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AP011098_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY641558_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089793_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412267_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412268_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412274_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306720_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916211_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916213_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU916226_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926424_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926441_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927150_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927157_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927159_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927180_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927184_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927237_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927253_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927254_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927282_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939590_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939591_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939600_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939618_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939648_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939652_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386587_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386609_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386619_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561029_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561031_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562268_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562283_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562330_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622454_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622513_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622516_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622517_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622518_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622525_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622528_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622534_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622544_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622587_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622588_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622589_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622593_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622594_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622595_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622596_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622598_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622599_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622600_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622601_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622604_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622605_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622608_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622609_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622611_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622614_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622616_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622622_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622623_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622625_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622629_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622631_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622632_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622634_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622636_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622638_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622644_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622651_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622652_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622655_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622660_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622667_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622671_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622675_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622682_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622685_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622687_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622691_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622692_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622700_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622741_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622795_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622857_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622858_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715382_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715383_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715403_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715407_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715409_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ743729_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ743736_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751320_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751344_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751382_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751409_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751410_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751432_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751437_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751440_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751443_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751460_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751497_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751499_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751500_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751506_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751507_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751510_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751519_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751548_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751586_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ899777_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377514_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377527_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377551_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377576_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377577_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377584_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475306_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475307_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475308_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475310_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475314_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475330_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475331_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475348_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078807_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078818_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078823_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078834_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078843_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078848_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079207_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079309_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079346_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079349_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079406_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079426_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079492_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM750138_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN400087_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN400088_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN400089_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980203_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980210_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980224_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980233_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980242_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980245_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980341_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980354_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040162_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040172_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341636_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416163_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416177_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416183_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416192_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416193_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416195_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416201_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429904_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX504546_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191832_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191877_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191888_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191903_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191925_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191935_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191954_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191966_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191969_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191970_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191971_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192027_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192028_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192029_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774181_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774184_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774194_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774195_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774215_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774216_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774220_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774221_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774238_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774244_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774248_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774250_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774251_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774255_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774280_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774293_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774300_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774330_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836819_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836820_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836822_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836824_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173287_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173310_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173331_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173439_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173440_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460508_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460509_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460652_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013923_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963871_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963872_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963873_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963874_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963875_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963876_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963877_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963878_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963879_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963880_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963881_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963882_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963884_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963885_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964185_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964186_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964187_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964188_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964189_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964190_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964191_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964192_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964193_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964194_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964195_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964196_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964197_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964198_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964199_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067082_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067085_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067088_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067125_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067128_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067139_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067142_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067143_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067162_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067181_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067189_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067190_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067191_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067196_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067197_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067201_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067208_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067217_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067224_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067229_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067236_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067238_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067241_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067244_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067248_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067265_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067269_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067272_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067274_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067294_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067316_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067340_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067342_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067343_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067354_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067364_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067372_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067375_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067388_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067389_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067419_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067420_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067447_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067451_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067465_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067467_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067468_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067505_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067508_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067513_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067524_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067535_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067559_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067563_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067564_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067572_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067575_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067618_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067660_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067675_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067683_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067692_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067694_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067699_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067709_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067726_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067747_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067753_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067761_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067776_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264808_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264809_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264812_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264853_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264901_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264914_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276960_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621054_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621093_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621111_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621122_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777278_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777289_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777302_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777323_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777329_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777341_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777350_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777385_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777392_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777396_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777398_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777402_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777412_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777418_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777422_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777429_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777445_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777465_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777471_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777488_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777489_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777492_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777495_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777506_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777508_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777512_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777540_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273236_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273243_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273244_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302879_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302883_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302884_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302919_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303137_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303188_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303189_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303191_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303193_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303194_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303196_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303197_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303313_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303331_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303333_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303338_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303503_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303572_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303595_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303601_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303606_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303610_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303614_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303621_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303622_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360833_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360837_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360838_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360841_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360844_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360846_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360847_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360848_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360849_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360850_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360979_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360982_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360987_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360988_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360989_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360994_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361011_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361015_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361017_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361047_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361275_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361276_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361278_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361280_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361281_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361283_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361284_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361402_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361646_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361647_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361648_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361650_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470896_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470897_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470900_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881736_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881737_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881738_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881739_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881742_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881743_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881744_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881748_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881749_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881750_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881751_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881754_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881755_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881758_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881762_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881763_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881764_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881765_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881766_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881767_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881768_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881769_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881770_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881771_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881772_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881773_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881774_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881775_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881776_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY881777_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714980_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714986_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715039_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715128_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715129_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715207_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715276_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715407_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826305_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826313_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826333_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826334_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826335_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG893556_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG893560_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170878_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170883_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170902_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170913_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170952_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170963_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171004_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171038_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171043_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171045_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171047_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171049_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171056_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171076_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171082_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171107_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171111_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171131_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171137_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171161_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171176_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171205_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171226_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171228_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171233_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343137_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343149_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534674_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426105_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645031_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645047_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999624_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999625_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OM688317_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB029986_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222761_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926468_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927160_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927176_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927199_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939560_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939573_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939613_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622056_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622085_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622129_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622180_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622198_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622199_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751434_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751491_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751502_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377597_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377623_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486188_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486661_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079276_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079297_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079322_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980215_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980338_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416178_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774199_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774287_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774337_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053172_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173293_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173393_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173394_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803765_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014055_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014057_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014060_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067176_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067180_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067254_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067258_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067270_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067295_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067331_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067390_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067394_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067402_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067448_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067463_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067507_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067533_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067537_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067578_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067582_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067602_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067611_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067637_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067743_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067763_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264891_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777458_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273225_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303092_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303344_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303383_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303496_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303555_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303563_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360393_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360394_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360398_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360402_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360405_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360407_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360803_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360884_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360976_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361494_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361663_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361668_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361722_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460075_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460077_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460078_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460079_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460080_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460082_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715163_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715250_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170957_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170959_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170964_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170966_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170989_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171078_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171132_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171163_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171164_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534592_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622577_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191940_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836818_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455694_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777519_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470874_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470877_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475338_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264905_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB030517_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621989_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715372_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715398_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067198_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826318_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170997_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171145_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB033553_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB033556_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB042283_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222767_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412240_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412250_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306675_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU554538_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU554539_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU570068_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926459_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926466_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927264_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939541_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939578_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561026_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562220_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562280_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621601_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622353_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622362_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622365_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622369_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622371_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622378_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622382_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622387_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622388_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622391_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622397_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622398_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622402_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622407_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622408_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622409_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622427_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715374_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751492_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377523_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377538_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377580_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377593_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377603_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486241_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486619_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078794_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078825_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078842_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079232_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079333_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980191_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980213_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980279_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980282_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980316_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416214_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX026878_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429903_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX429905_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191843_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191854_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191902_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191908_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191929_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191937_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191942_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191944_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191986_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191993_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192011_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774210_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774223_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774252_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774257_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774259_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774274_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774275_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774279_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774295_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774326_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793039_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793187_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ011529_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173395_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173396_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM213037_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455649_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455652_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455697_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013783_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013784_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT284753_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067086_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067102_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067106_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067140_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067146_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067157_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067159_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067160_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067183_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067219_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067257_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067264_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067281_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067289_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067297_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067301_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067312_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067313_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067384_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067410_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067414_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067418_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067478_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067491_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067504_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067541_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067574_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067597_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067638_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067656_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067664_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067667_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067739_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067740_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067745_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067749_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067754_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276836_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621056_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621057_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621058_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621059_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621060_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621097_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621098_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621099_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777477_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777497_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777499_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777505_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777516_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777525_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY022423_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303341_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303483_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303618_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360411_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360418_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360422_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360964_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360973_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361012_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC373511_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC373512_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714935_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715032_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715076_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715091_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715156_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715230_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715291_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715308_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826289_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826294_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826295_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826297_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MH094411_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170862_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170948_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170956_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170961_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170994_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171026_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171095_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171114_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171119_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171245_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171253_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK343150_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK720629_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK720630_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426474_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426552_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OK106255_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB074756_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB105173_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB117758_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB205125_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222735_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222759_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222769_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222773_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232089_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232090_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232095_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232102_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232105_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232110_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232502_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232504_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232505_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232511_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232514_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232516_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB232524_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB300363_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF223954_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF223956_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF223957_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF223958_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF223959_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF223961_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF473543_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AP011097_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY862869_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089764_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089769_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089771_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089779_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089781_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089782_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ089789_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ141668_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ315781_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ361533_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412235_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412248_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412249_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412260_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412263_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412265_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412271_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU305540_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306685_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306687_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306694_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927218_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927227_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927228_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927229_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927238_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927283_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023641_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023642_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023643_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023644_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023647_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023649_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023650_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023653_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023654_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023657_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023658_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023699_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023708_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023710_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023714_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023719_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023730_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023733_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023737_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023740_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023742_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023758_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023764_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023775_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023777_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023778_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023788_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023789_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023790_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023791_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023793_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023796_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023798_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023799_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023812_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023815_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023819_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023823_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023824_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023826_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023828_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023839_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023840_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023843_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023849_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023851_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023866_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023875_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023877_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023890_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023901_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023904_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023906_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023912_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023917_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023920_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023931_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023942_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023943_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023944_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023947_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023949_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023955_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023967_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023988_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023991_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024003_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024007_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024009_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024011_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024024_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024025_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024028_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024031_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024039_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ349225_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ560993_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621611_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751357_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751520_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FN295540_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FN295541_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FN295542_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FN295543_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FN295544_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821811_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821814_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821815_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821818_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821826_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821827_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821898_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821964_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821965_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821970_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822033_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822034_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822038_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822073_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822074_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822077_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822124_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822126_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822127_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822128_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822129_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822131_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822133_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822134_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822137_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822138_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ358154_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486096_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486462_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486516_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486581_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486607_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486621_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486723_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ855393_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924604_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924612_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924613_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924615_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924649_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924650_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078855_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU563561_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU798968_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU798970_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU798986_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU798987_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU799010_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU799055_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652393_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652395_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652396_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652397_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652398_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652399_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652402_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652404_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652405_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652406_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652413_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652522_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652523_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652526_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652529_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652530_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652532_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652664_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652669_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652689_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652696_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652699_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652703_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652706_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652714_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652752_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652769_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652806_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652809_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652811_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652812_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652813_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652814_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652816_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652817_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652823_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652825_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652826_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652829_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM011497_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JF899336_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604118_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604144_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604182_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604256_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650176_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650189_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ027333_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040133_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281113_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281117_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281119_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281120_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281121_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281124_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281128_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341616_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341622_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341637_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341644_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341663_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416210_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514410_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514415_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514418_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514511_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514540_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ688403_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801470_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801475_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801486_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801488_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801495_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801500_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801502_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801503_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801504_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801505_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801511_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801513_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801519_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801520_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801522_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX292753_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX292756_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX292757_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX507214_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191829_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192033_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774228_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836825_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC875271_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC885759_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC885760_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC885765_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053167_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053169_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053187_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF214672_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF771947_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410501_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410504_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410513_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717803_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717810_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717811_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717812_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717823_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717828_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ717834_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803759_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803761_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803780_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803793_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803799_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803800_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803811_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803815_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ803818_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455593_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455615_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455619_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455623_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455624_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455627_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455629_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455634_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455635_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455642_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455673_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455674_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455678_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455683_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455708_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455712_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455715_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455716_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455724_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455725_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455726_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455727_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455735_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455736_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455738_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455741_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455742_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455756_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455765_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455768_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455769_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455770_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455775_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455776_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455814_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455821_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455824_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455833_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455836_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455850_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455852_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455867_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM875404_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148462_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148468_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148469_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148471_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148479_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148480_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148482_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148488_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148513_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148514_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148517_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148520_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148523_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148528_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148529_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148531_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148532_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148537_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148538_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148540_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148543_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148547_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148548_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148549_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148552_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148554_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148555_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148558_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148562_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148570_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148571_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148572_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148573_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148574_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP165812_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP244016_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013857_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT201171_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT235588_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT235602_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT235609_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT347089_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT364721_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT987424_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU051423_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU051425_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU847720_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX372125_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX372127_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765818_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765820_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765824_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765826_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765829_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765830_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765831_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765833_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765836_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765837_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765838_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765839_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765840_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765844_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765846_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765848_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765850_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765851_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765853_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX774503_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX774512_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777432_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777480_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777526_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303200_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303207_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY353886_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY353892_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361255_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361262_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470936_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470937_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456117_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456122_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456125_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC519818_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC592171_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC592172_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF488703_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674386_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674388_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674398_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674402_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674403_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674412_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674418_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674435_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674442_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674454_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674468_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674472_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674474_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674475_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674484_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674486_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674501_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674502_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925359_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925369_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925374_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925375_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925377_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925387_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925406_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925408_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925410_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715015_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715116_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715190_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715198_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715204_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715206_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715325_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715326_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715328_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715333_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715335_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715338_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715341_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826233_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826234_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826236_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826239_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826243_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826248_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826254_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826260_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826268_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826281_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826285_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170858_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171007_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171129_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295779_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295785_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295786_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295794_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295795_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295797_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295799_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534604_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534619_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534624_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534628_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534631_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534642_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534643_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534644_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534645_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534647_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534666_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534667_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK628732_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK818227_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT111596_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426107_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426248_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426254_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426255_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426256_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426257_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426258_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426260_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426261_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426262_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426281_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426282_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426291_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426294_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426304_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426305_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426307_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426309_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426312_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426313_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426315_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426317_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426318_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426321_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426322_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426323_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426324_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426325_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426326_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426327_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426328_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426329_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426330_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426331_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426333_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426334_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426335_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426336_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426337_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426338_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426339_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426340_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426341_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426342_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426343_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426344_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426345_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426347_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426349_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426350_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426351_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426352_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426353_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426355_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426356_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426358_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426359_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426362_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426364_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426366_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426367_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426369_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426372_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426373_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426374_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426375_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426376_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426377_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426378_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426379_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426380_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426381_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426382_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426384_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426385_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426387_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426388_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426389_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426391_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426392_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426393_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426394_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426396_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426397_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426398_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426399_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426400_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426401_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426402_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426403_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426404_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426405_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426406_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426407_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426408_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426413_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426414_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426415_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426416_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426418_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426419_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426420_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426422_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426423_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426424_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426425_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426426_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426427_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426428_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426429_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426430_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426431_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426432_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426433_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426434_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426435_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426436_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426438_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426439_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426440_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426441_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426442_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426443_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426444_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426446_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426452_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426453_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426454_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645000_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645012_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999619_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999620_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999621_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999622_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999627_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999628_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999630_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439271_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439275_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439278_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439280_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439289_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439333_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439335_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439341_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439352_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439353_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439354_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439359_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439368_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439392_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439396_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439401_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439552_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439553_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439554_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439555_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439558_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439560_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439562_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439563_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439564_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439566_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439567_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439569_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439570_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439641_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439642_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439644_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439647_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439648_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439649_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439650_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439651_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439652_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439653_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439654_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439655_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439656_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439657_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439658_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439659_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439660_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439662_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439663_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439664_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439665_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439666_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439667_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439668_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439669_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439670_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439672_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439675_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439677_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439678_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439679_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439680_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439681_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439683_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439685_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439686_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439688_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439689_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439690_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439691_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439694_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439695_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439696_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439697_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439698_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439701_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439702_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439703_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439704_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439708_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439709_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439711_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439712_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439713_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439714_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439716_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439717_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439718_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439719_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439720_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439721_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ671242_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ671243_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ934425_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF209402_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY167096_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927162_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939562_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622021_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622439_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964202_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964203_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964205_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG837059_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170965_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171110_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171197_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621995_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB111125_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB246344_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB113876_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX067449_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195938_SHBs_P-C      MENTTSGFLGPLLVLQAGFSLLTRILTIPQSLDSWWTSLNFLGGAPACPG
AB195944_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171123_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645033_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB195954_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926428_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621997_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621998_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621999_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622001_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622003_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622813_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751574_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191972_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622689_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377578_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475318_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486713_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980252_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774247_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067346_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067626_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067659_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067759_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715307_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY247031_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067756_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777452_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622338_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622339_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KC774200_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KC774202_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KC774283_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KR013761_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KR013763_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KR013765_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KR013768_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067259_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067432_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067438_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067473_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067516_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067547_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067567_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067617_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067633_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067752_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX777431_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
LC279254_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
LC279257_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MW675889_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MW675892_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MW675895_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KC836784_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836785_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836786_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836787_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC836788_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067735_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067512_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412244_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927158_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561000_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562242_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621864_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621866_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751304_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751423_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751560_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040166_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX504539_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191846_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460109_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171079_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222745_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926421_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927267_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622647_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622658_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622659_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622672_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622856_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751448_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751496_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377583_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475341_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475345_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475349_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079400_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN604148_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980189_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774239_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173289_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173334_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173337_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173437_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173438_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460510_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460511_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013883_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013885_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963886_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963887_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963888_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963889_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963890_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963891_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963892_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963893_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963894_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963895_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963896_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963897_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963898_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963899_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067120_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067192_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067200_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067243_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067330_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067336_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067479_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067497_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067571_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067655_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264867_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264908_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621083_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621112_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777304_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777481_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302897_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302898_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303113_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303605_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360814_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360816_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360817_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360818_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360822_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360823_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360825_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360827_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360828_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360829_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360830_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360831_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360832_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361424_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361425_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361426_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361427_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361429_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361432_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361433_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715126_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715372_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170890_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171010_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171144_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222763_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222764_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB222765_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562241_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622098_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622192_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622211_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377600_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661496_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173431_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173432_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598635_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598636_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598639_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598647_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598649_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598651_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598656_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598658_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ598661_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067116_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067163_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067237_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067320_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067515_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273241_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303615_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360779_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360781_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360783_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360784_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360785_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360788_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360791_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360792_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360794_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360795_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714981_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826317_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ141662_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067205_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF068756_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079287_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU798999_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652827_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801523_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC875274_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ410505_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455837_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT364718_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170875_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295798_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455761_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455763_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013821_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY470915_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715189_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439272_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023640_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023656_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023768_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023844_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023856_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023907_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023969_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822022_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU799032_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU799046_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652272_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281114_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341613_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341641_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341657_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514413_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801482_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801496_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774236_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF214676_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455638_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455681_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455702_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455720_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455739_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455753_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455755_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM875428_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276851_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765842_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777507_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY353898_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC519804_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674429_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674457_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF925405_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715343_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826249_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826258_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826265_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170979_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295784_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534605_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534622_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534649_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534652_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645006_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439556_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439571_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439572_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439573_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439574_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439575_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439576_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439577_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439578_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023781_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023782_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295781_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ023802_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023845_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822054_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822057_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822091_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822099_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822100_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822101_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822103_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822111_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822114_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822115_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822176_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377632_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486651_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652668_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514313_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514513_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053185_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765823_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765825_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765827_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826228_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826280_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW999618_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439407_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439408_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439409_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439411_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439417_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439418_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439419_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439421_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439424_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439425_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439426_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439427_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439429_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439431_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439434_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439435_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439436_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439437_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439438_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439440_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439444_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439445_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439446_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439448_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439449_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439450_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439452_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439454_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439457_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439462_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439468_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439469_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439474_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439476_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439477_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439480_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439485_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439488_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439490_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439494_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439497_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439498_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439499_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439500_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439501_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439502_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439510_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439511_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439512_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439514_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439515_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514514_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053176_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674428_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826245_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK295783_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514298_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
JQ514402_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
LC519792_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
AB232523_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AP011099_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AP011100_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AP011101_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU410079_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU410080_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
EU410081_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JN604226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
AB253615_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EF384204_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN827422_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX670227_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX670230_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX670233_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX670238_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX670240_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB426467_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264887_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622380_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622383_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622392_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079219_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386579_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777339_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777349_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777352_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777280_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB809545_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622808_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCRG
AB367801_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ325785_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB560662_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AY122578_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AY122586_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
GQ358157_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
HQ700522_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
HQ700543_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
GU079461_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067399_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB670240_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622606_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264834_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562319_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079326_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939642_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562304_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562331_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622024_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622053_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751541_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079269_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171184_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715254_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460663_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067352_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927269_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939552_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621810_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622837_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622849_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622851_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191847_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191859_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192003_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774260_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774267_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013850_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067104_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067600_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067651_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777473_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777509_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715137_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645030_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
D50517_SHBs_P-C        MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
D50518_SHBs_P-C        MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926426_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927250_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927276_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386575_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386664_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622549_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622550_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622554_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622556_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622566_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622573_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622574_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622578_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622766_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622806_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622809_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715342_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715350_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715368_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715370_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377563_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377598_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377616_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079215_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079318_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661488_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191952_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191994_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192026_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192036_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774233_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774339_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774361_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173283_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173284_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067268_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067401_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067459_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067500_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067549_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067639_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067682_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777270_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777305_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777315_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777348_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777353_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777384_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302985_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302992_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303121_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303122_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303124_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303125_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303126_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303127_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303294_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303297_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303300_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361060_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361063_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361066_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361404_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361406_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361407_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361409_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361410_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361412_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361416_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361417_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361419_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361420_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361421_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361422_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361549_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361550_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714971_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715269_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170881_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171027_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927275_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191856_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191922_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF214651_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302910_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361385_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361386_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361388_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361389_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361390_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361393_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171024_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171236_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AB675675_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU306714_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622733_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622751_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ751517_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN980296_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964318_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964319_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964320_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964321_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964322_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964323_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964324_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964325_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964326_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964327_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964328_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964330_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964331_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964332_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KU964333_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX067204_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX621076_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX621105_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171065_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171247_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MZ671249_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MZ671251_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622220_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067096_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF485389_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067527_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067084_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303604_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF036237_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF208868_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF208869_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023696_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148568_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT201170_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439699_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439706_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439707_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023754_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ023784_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ023822_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ023847_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ023894_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ023914_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ023929_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ024001_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FR821955_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FR821956_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FR821957_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FR821958_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FR821960_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652548_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652693_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652694_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN827415_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455598_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KM455611_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KT585775_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KT585783_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK534638_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MW999626_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX067137_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
MG714960_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPACPG
AF329865_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ621902_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
FJ751362_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
EU560441_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787486_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ899776_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX276994_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621069_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621070_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621074_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621075_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171232_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF411411_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ975273_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ980550_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562249_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622074_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622133_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980374_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460644_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460645_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964200_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171173_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF461363_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AF461359_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MN891835_SHBs_P-C      MESTSSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AP011107_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
DQ141660_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
JX292755_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KX067105_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KY303557_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
KY303571_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826131_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826133_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826134_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826135_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826342_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826343_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826345_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826346_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MG826347_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
MK171167_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPVCPG
DQ412273_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ560988_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562233_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621948_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622134_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751433_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377575_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079214_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416211_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067118_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067129_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067337_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067391_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067415_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067458_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067490_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067760_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY122489_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122501_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122516_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122522_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122533_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122541_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
GQ486600_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700567_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122492_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122515_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700495_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700544_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700558_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
HQ700561_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122534_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122539_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122495_SHBs_P-C      MEGTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122496_SHBs_P-C      MEGTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122503_SHBs_P-C      MEGTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPRCPG
AY122531_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122532_SHBs_P-C      MESTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
AY122513_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122520_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122526_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122530_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122550_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700502_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700545_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700564_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700565_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
HQ700573_SHBs_P-C      MENTASGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGEAPVCPG
AY122542_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPVCPG
KC774321_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067348_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939605_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622059_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622114_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792682_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067194_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170863_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT645044_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
AY206379_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTILQSLDSWWTSLNFLGGAPTCPG
EU939641_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622762_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622764_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980307_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661491_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173292_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173303_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067218_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067436_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067437_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303106_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361439_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361450_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622094_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622193_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622195_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787445_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX560520_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ475350_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777498_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927274_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939538_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939616_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386576_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386678_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561017_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562318_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621961_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621966_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621969_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621971_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621973_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621976_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621978_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621981_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621983_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621985_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622831_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715366_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715367_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ899763_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ899775_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377517_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079223_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079234_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079356_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040165_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191830_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191931_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191961_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191963_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191964_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774190_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774206_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774209_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP027477_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT284756_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067284_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067353_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067455_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067539_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067584_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067595_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067603_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067646_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067696_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067701_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067714_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777490_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777494_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302900_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361413_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714989_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715025_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715078_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170962_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171048_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171128_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023897_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023908_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821962_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU798979_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801489_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774299_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148463_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067462_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067721_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534595_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426386_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980174_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980209_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980392_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067211_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715270_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171142_SHBs_P-C      METTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
S75184_SHBs_P-C        MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDLWWTSLNFLGGAPKCPG
GQ924655_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924623_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801498_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023794_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
HE652831_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MT426296_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KR013899_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455743_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455745_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148546_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148560_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456130_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562258_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562272_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562281_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079335_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191913_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774346_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067489_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067649_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562298_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622216_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751529_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964020_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964021_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964022_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964023_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964024_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964025_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964026_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964027_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964028_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964029_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964030_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964031_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964033_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715208_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826357_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171018_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171215_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171217_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171255_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023837_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ924636_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826251_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622784_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622785_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622786_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622788_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622789_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622790_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426360_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426361_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926449_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU926454_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU927194_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
EU939570_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ562252_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622251_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622267_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622269_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622284_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622340_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ751474_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KJ460517_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KJ598769_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX067121_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KY460028_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG715380_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK170973_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK170981_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MT645028_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KJ410519_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
DQ412257_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622341_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460521_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460646_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460659_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460525_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460522_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460518_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFRGGAPTCPG
KJ460642_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSPNFLGGAPTCRG
KJ460649_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460662_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460647_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
FJ561046_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621953_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622069_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751274_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980304_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191876_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173430_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014043_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067333_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067480_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302873_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY302874_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303159_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303179_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303183_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303187_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303314_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303536_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303573_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360582_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360585_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360588_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360764_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360766_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360768_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360771_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360772_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360773_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360774_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360775_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360776_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360777_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360962_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360966_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360968_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361048_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361296_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361300_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361304_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361338_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361349_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361354_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361726_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460036_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715318_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826327_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067392_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303163_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360965_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361342_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361348_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171177_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486576_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM875430_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621927_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621932_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX067361_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067477_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170971_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622524_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622541_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514312_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ798294_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX661490_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264845_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777383_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715251_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170908_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU139531_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139523_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139528_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
EU139530_SHBs_P-C      MENIASGFLGPLLVLQAGFFLLTRILTVPKSLDSWWTSLNFLGGAPTCPG
EU306728_SHBs_P-C      MESTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ032345_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622285_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622447_SHBs_P-C      MENAASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGVTPACPG
FJ622347_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFPGGAPTCPG
GQ402155_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078791_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079288_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079306_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079343_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622555_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622559_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622561_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622563_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622564_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622553_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU570074_SHBs_P-C      MENTTSGFLGPLLVLQAVFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622321_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622322_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622323_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622880_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562276_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622256_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JX504542_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622147_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067112_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067233_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067666_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777483_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU872005_SHBs_P-C      MESTTSGFLGPLLVLQAGFSLLTKILTIPQSLDSWWTSLSFLGGAPTCPG
EU796072_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871977_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPKSLDSWWTSLNFLGGAPTCPG
KY360379_SHBs_P-C      MENTTSGFLGPLLVLQTGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU871998_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPRSLDSWWTSLNFLGGAPTCPG
EU916217_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAHVCPG
EU916224_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU921798_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386628_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486658_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927245_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927246_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622121_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622171_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622804_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751426_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751481_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751549_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751550_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486783_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078819_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980367_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514538_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173281_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173282_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067076_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067406_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067474_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067625_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067642_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067654_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264801_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303326_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303386_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303389_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360897_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360899_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361007_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171055_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079249_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622627_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622666_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622860_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774285_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774308_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013819_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT364752_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX670223_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX670237_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX670241_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777501_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273233_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY273234_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303581_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303582_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715264_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171139_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM011472_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303328_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361009_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622477_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
JN980246_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX067360_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KX264849_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KY273240_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KY303612_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
MW675894_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751310_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792790_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT284754_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980186_SHBs_P-C      MENTTSGFLGPLLGLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714928_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715228_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU926446_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGXPTCPG
GQ475336_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079375_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067557_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX264870_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927166_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
EU939611_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ386594_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621914_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621924_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622836_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GQ377526_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GU079341_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
GU079418_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MG826293_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MK170860_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MK343141_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ622715_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ622736_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ386618_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
KX067542_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067579_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067586_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170999_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939593_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078809_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040161_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964215_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964216_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964217_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964218_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964221_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964222_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964223_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964224_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964225_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964227_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU964228_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067158_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067307_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067621_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715104_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622227_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715305_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191865_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191907_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC792940_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067329_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777454_SHBs_P-C      MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM011489_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ622360_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622361_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191991_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ011532_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621600_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622364_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622396_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751583_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191855_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173295_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173311_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173312_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173445_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013797_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013798_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR013961_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067188_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067271_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067554_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067673_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777527_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303342_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303343_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360974_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360975_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715064_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ460654_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067687_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621079_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621108_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714932_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
OM688313_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939576_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622229_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622234_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622235_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751377_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040131_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067081_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067161_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067450_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067454_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303181_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361298_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426645_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426646_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426647_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426648_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426650_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426651_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426652_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426653_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426740_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426747_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426749_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426750_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426751_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426753_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426755_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486757_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG714953_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715092_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715311_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927212_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ622295_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPXCPG
FJ622163_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561025_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621838_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621945_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621960_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621970_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621975_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621982_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621984_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715422_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377545_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377554_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377562_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377585_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ377618_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079216_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079316_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HM750139_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JN980308_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191834_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191868_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC192007_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774329_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067090_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067091_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067100_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067123_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067126_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067151_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067165_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067166_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067230_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067261_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067396_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067523_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067555_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067599_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067601_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067670_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067774_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067775_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX621107_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777460_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777533_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303558_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715296_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170946_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171100_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK534586_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170960_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU927277_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622419_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622845_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ751327_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC191875_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KY303345_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KY360977_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MG715130_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK170909_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK170912_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171200_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ562286_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY303153_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY361361_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426777_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MW310260_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079209_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079441_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622268_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC191975_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC774355_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826314_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622351_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
JX026888_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067300_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171256_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ562291_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622529_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191891_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
EU939656_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456128_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023779_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023887_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486272_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486595_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486742_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486743_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281112_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281116_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ281118_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341611_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341617_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ341659_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX292758_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765852_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023780_SHBs_P-C      MESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486606_SHBs_P-C      MESTTSGFLXPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023712_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023713_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023717_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023721_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023722_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023725_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023751_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023752_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023756_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023757_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023759_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023760_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023761_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023766_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023769_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023922_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023961_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024023_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ024043_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821820_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821822_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821824_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821831_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821838_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821840_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821842_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821846_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821848_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821850_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821852_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821857_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821858_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821866_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821868_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821872_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821876_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821878_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821880_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821881_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821887_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821888_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821890_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821891_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821893_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821894_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821896_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821899_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821908_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821915_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821918_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821920_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821921_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821922_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821924_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR821927_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822165_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822168_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822169_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652244_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652274_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652277_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652297_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652306_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652502_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652535_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652539_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652647_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652654_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652656_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652658_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652665_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652666_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652667_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652670_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652672_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652679_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652682_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652684_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652685_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652686_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652784_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652794_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652799_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023898_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023956_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822006_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822012_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822014_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822016_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822017_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486617_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU799027_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652545_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF214677_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148564_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MF674399_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426447_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023728_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023732_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023755_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTXILTIPQSLDSWWTSLNFLGGAPTCPG
GU799031_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652541_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715336_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023926_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ023938_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514534_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ514536_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT987425_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT987426_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765819_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765845_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX765847_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX774511_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456132_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
LC456135_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ671247_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ675790_SHBs_P-C      MESTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KF053193_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439568_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652688_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652698_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
HE652702_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KP148483_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KP148491_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426249_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426306_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FR822135_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426421_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439722_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439727_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439730_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439735_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ486526_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652350_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652351_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652353_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
HE652356_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KT366463_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426348_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426354_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MZ439565_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ801508_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
JQ801518_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
MT426365_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
MT644998_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPTCPG
GU798975_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622775_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ386665_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622414_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
FJ622415_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCLG
FJ032339_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622585_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621925_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KX777485_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MK580113_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ386687_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622718_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ621888_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGALTCPG
FJ622266_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ622468_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ560990_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622519_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622653_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ416217_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173435_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KJ173436_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067302_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067724_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360614_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360616_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360618_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360619_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360620_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360624_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY360630_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715357_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751295_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC793035_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK170928_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MK171195_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621865_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621867_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751427_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067213_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067534_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826325_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ040158_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KX067207_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC191828_SHBs_P-C      MENTTSGFLGPMLVLQAGFFLLTXILTIPXSLDSWWTSLNFLGGAPTCPG
KC191836_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTKILTIPQSLDSWWTSLNFLGGAPTCPG
KC191839_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILSIPQSLDSWWTSLXFLGGAPTCPG
KC191881_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KC191932_SHBs_P-C      MENTXSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191936_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLIRILTIPQSLDSWWTSLNFLGGAPTCPG
JN650138_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191939_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191948_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622212_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774187_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774226_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067203_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067550_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY316918_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191956_SHBs_P-C      MESTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ561047_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFPGGAPKCPG
KC191845_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFPGGAPKCPG
KC191852_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLSFPGGAPKCPG
KC191864_SHBs_P-C      MENTTSGFLGPLLALQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC191869_SHBs_P-C      MESTTSGFLGPLLVLQAGFFXLTXILTIPQSLDSWWTSLNFLGGAPTCPG
KC191874_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KC191870_SHBs_P-C      MENTTSGFLGPMLVLQAGFFLLTKILTIPKSLDSWWTSLNFLGGAPTCPG
GU079323_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622209_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787439_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067433_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
KX777417_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171066_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
MK171257_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
JN980371_SHBs_P-C      MENTASGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777271_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777299_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777444_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426578_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426579_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426580_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426581_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426582_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426585_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426586_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426587_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426589_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426592_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426594_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426595_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426596_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426600_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426601_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426602_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426603_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426604_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426605_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426606_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426607_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426608_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426609_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426611_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426613_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426614_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426616_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426617_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426618_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426619_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426620_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426621_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426622_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426623_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426624_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426625_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426626_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426627_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426628_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426629_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426630_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426631_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426632_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426633_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426634_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426635_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426636_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426637_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426638_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426639_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426640_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426641_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426642_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MT426643_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ751551_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU078835_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JQ412089_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KC774235_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KM455855_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963900_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963901_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963902_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963903_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963905_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963906_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963907_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963908_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963909_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963910_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963911_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963912_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963913_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KU963914_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX777459_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460004_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY460007_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY629631_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KY670782_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715083_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715157_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG715243_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826127_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MG826339_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621860_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ622822_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MG715382_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
MK170967_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
KC191904_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
MN683729_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ621822_SHBs_P-C      MESTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
GU078810_SHBs_P-C      MENTTSGILGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
KY361631_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNSLGGAPTCPG
FJ621840_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ787443_SHBs_P-C      MENTTSGFLGPLLVSQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPACPG
FJ621858_SHBs_P-C      MENTTSGFLGPLLVLQAGFFSLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ621900_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGEAPKCPG
FJ621929_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPKCPG
FJ621942_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KR014012_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GQ402159_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
JX948759_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
GU079289_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
FJ715395_SHBs_P-C      MENTTSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGAPTCPG
KX067619_SHBs_P-